Index: trunk/l10n-kf5/ru/messages/frameworks/kcoreaddons5_qt.po =================================================================== --- trunk/l10n-kf5/ru/messages/frameworks/kcoreaddons5_qt.po (revision 1549882) +++ trunk/l10n-kf5/ru/messages/frameworks/kcoreaddons5_qt.po (revision 1549883) @@ -1,10408 +1,10408 @@ # KDE - kdelibs/kdelibs4.po Russian translation. # Copyright (C) 2005, KDE Russian translation team. # # Denis Perchine , 2000. # Gregory Mokhin , 2000, 2004, 2005. # Albert R. Valiev , 2002, 2008. # Leonid Kanter , 2002-2004, 2005, 2008. # Andrey Cherepanov , 2005-2007, 2008, 2009, 2011. # Nick Shaforostoff , 2004, 2006, 2007, 2008, 2009. # Nick Shaforostoff , 2009. -# Alexander Potashev , 2009, 2010, 2011, 2014, 2015, 2016, 2017, 2018. +# Alexander Potashev , 2009, 2010, 2011, 2014, 2015, 2016, 2017, 2018, 2019. # Yury G. Kudryashov , 2011. # Yuri Efremov , 2012. # Inga Barinova , 2012. # Julia Dronova , 2012. # Alexander Lakhin , 2013. # Alexander Yavorsky , 2019. msgid "" msgstr "" "Project-Id-Version: kdelibs4\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" "POT-Creation-Date: 2014-03-23 01:50+0000\n" -"PO-Revision-Date: 2019-06-20 18:58+0300\n" -"Last-Translator: Alexander Yavorsky \n" +"PO-Revision-Date: 2019-08-18 04:49+0300\n" +"Last-Translator: Alexander Potashev \n" "Language-Team: Russian \n" "Language: ru\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Lokalize 19.04.2\n" -"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n" -"%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" +"X-Generator: Lokalize 19.07.70\n" +"Plural-Forms: nplurals=3; plural=(n%10==1 && n%100!=11 ? 0 : n%10>=2 && n%10<" +"=4 && (n%100<10 || n%100>=20) ? 1 : 2);\n" "X-Environment: kde\n" "X-Accelerator-Marker: &\n" "X-Text-Markup: kde4\n" "X-Qt-Contexts: true\n" #: lib/kaboutdata.cpp:296 msgctxt "KAboutLicense|" msgid "" "No licensing terms for this program have been specified.\n" "Please check the documentation or the source for any\n" "licensing terms.\n" msgstr "" "Лицензия в данной программе не указана.\n" "Возможно, она указана в документации или в исходных текстах этой программы.\n" #: lib/kaboutdata.cpp:306 #, qt-format msgctxt "KAboutLicense|" msgid "This program is distributed under the terms of the %1." msgstr "Программа распространяется на условиях %1." #: lib/kaboutdata.cpp:352 msgctxt "KAboutLicense|@item license (short name)" msgid "GPL v2" msgstr "GPL v2" #: lib/kaboutdata.cpp:353 msgctxt "KAboutLicense|@item license" msgid "GNU General Public License Version 2" msgstr "GNU General Public License, версия 2" #: lib/kaboutdata.cpp:356 msgctxt "KAboutLicense|@item license (short name)" msgid "LGPL v2" msgstr "LGPL v2" #: lib/kaboutdata.cpp:357 msgctxt "KAboutLicense|@item license" msgid "GNU Lesser General Public License Version 2" msgstr "GNU Lesser General Public License, версия 2" #: lib/kaboutdata.cpp:360 msgctxt "KAboutLicense|@item license (short name)" msgid "BSD License" msgstr "Лицензия BSD" #: lib/kaboutdata.cpp:361 msgctxt "KAboutLicense|@item license" msgid "BSD License" msgstr "Лицензия BSD" #: lib/kaboutdata.cpp:364 msgctxt "KAboutLicense|@item license (short name)" msgid "Artistic License" msgstr "Artistic License" #: lib/kaboutdata.cpp:365 msgctxt "KAboutLicense|@item license" msgid "Artistic License" msgstr "Artistic License" #: lib/kaboutdata.cpp:368 msgctxt "KAboutLicense|@item license (short name)" msgid "QPL v1.0" msgstr "QPL v1.0" #: lib/kaboutdata.cpp:369 msgctxt "KAboutLicense|@item license" msgid "Q Public License" msgstr "Q Public License" #: lib/kaboutdata.cpp:372 msgctxt "KAboutLicense|@item license (short name)" msgid "GPL v3" msgstr "GPL v3" #: lib/kaboutdata.cpp:373 msgctxt "KAboutLicense|@item license" msgid "GNU General Public License Version 3" msgstr "GNU General Public License, версия 3" #: lib/kaboutdata.cpp:376 msgctxt "KAboutLicense|@item license (short name)" msgid "LGPL v3" msgstr "LGPL v3" #: lib/kaboutdata.cpp:377 msgctxt "KAboutLicense|@item license" msgid "GNU Lesser General Public License Version 3" msgstr "GNU Lesser General Public License, версия 3" #: lib/kaboutdata.cpp:380 msgctxt "KAboutLicense|@item license (short name)" msgid "LGPL v2.1" msgstr "LGPL v2.1" #: lib/kaboutdata.cpp:381 msgctxt "KAboutLicense|@item license" msgid "GNU Lesser General Public License Version 2.1" msgstr "GNU Lesser General Public License, версия 2.1" #: lib/kaboutdata.cpp:385 msgctxt "KAboutLicense|@item license" msgid "Custom" msgstr "Другая лицензия" #: lib/kaboutdata.cpp:388 msgctxt "KAboutLicense|@item license" msgid "Not specified" msgstr "Лицензия не указана" # BUGME: keep this up to date --aspotashev #: lib/kaboutdata.cpp:937 msgctxt "KAboutData|replace this with information about your translation team" msgid "" "

KDE is translated into many languages thanks to the work of the " "translation teams all over the world.

For more information on KDE " "internationalization visit https://l10n.kde." "org

" msgstr "" "

Графическая среда KDE переведена на многие языки благодаря работе команд " "переводчиков в разных странах.

Для дополнительной информации о " -"переводе KDE зайдите на https://l10n.kde." -"org, а также на http://kde.ru. Там вы " -"сможете узнать о работе команды, переводившей KDE на русский язык, и, " +"переводе KDE зайдите на l10n.kde.org, а " +"также на kde.ru/translation. Там " +"вы сможете узнать о работе команды, переводившей KDE на русский язык, и, " "возможно, сами захотите участвовать в этой работе.

" #: lib/kaboutdata.cpp:1168 msgctxt "KAboutData CLI|" msgid "Show author information." msgstr "Показать сведения об авторе." #: lib/kaboutdata.cpp:1169 msgctxt "KAboutData CLI|" msgid "Show license information." msgstr "Показать сведения о лицензии." #: lib/kaboutdata.cpp:1171 msgctxt "KAboutData CLI|" msgid "The base file name of the desktop entry for this application." msgstr "Имя файла .desktop (без пути) для этого приложения." #: lib/kaboutdata.cpp:1172 msgctxt "KAboutData CLI|" msgid "file name" msgstr "имя файла" #: lib/kaboutdata.cpp:1181 msgctxt "KAboutData CLI|" msgid "This application was written by somebody who wants to remain anonymous." msgstr "Автор программы пожелал остаться неизвестным." #: lib/kaboutdata.cpp:1183 #, qt-format msgctxt "KAboutData CLI|" msgid "%1 was written by:" msgstr "%1 написали:" #: lib/kaboutdata.cpp:1194 msgctxt "KAboutData CLI|" msgid "Please use https://bugs.kde.org to report bugs." msgstr "Используйте https://bugs.kde.org для отправки сообщений об ошибках." #: lib/kaboutdata.cpp:1196 #, qt-format msgctxt "KAboutData CLI|" msgid "Please report bugs to %1." msgstr "Используйте %1 для отправки сообщений об ошибках." #: lib/plugin/kpluginloader.cpp:121 #, qt-format msgctxt "KPluginLoader|" msgid "The library %1 does not offer a KPluginFactory." msgstr "" "Библиотека %1 не предоставляет механизма создания компонентов KPluginFactory." #: lib/util/kformatprivate.cpp:116 msgctxt "KFormat|SI prefix for 10^⁻24" msgid "y" msgstr "и" #: lib/util/kformatprivate.cpp:117 msgctxt "KFormat|SI prefix for 10^⁻21" msgid "z" msgstr "з" #: lib/util/kformatprivate.cpp:118 msgctxt "KFormat|SI prefix for 10^⁻18" msgid "a" msgstr "а" #: lib/util/kformatprivate.cpp:119 msgctxt "KFormat|SI prefix for 10^⁻15" msgid "f" msgstr "ф" #: lib/util/kformatprivate.cpp:120 msgctxt "KFormat|SI prefix for 10^⁻12" msgid "p" msgstr "п" #: lib/util/kformatprivate.cpp:121 msgctxt "KFormat|SI prefix for 10^⁻9" msgid "n" msgstr "н" #: lib/util/kformatprivate.cpp:122 msgctxt "KFormat|SI prefix for 10^⁻6" msgid "µ" msgstr "мк" #: lib/util/kformatprivate.cpp:123 msgctxt "KFormat|SI prefix for 10^⁻3" msgid "m" msgstr "м" #: lib/util/kformatprivate.cpp:125 msgctxt "KFormat|SI prefix for 10^3" msgid "k" msgstr "к" #: lib/util/kformatprivate.cpp:125 msgctxt "KFormat|IEC binary prefix for 2^10" msgid "Ki" msgstr "Ки" #: lib/util/kformatprivate.cpp:126 msgctxt "KFormat|SI prefix for 10^6" msgid "M" msgstr "М" #: lib/util/kformatprivate.cpp:126 msgctxt "KFormat|IEC binary prefix for 2^20" msgid "Mi" msgstr "Ми" #: lib/util/kformatprivate.cpp:127 msgctxt "KFormat|SI prefix for 10^9" msgid "G" msgstr "Г" #: lib/util/kformatprivate.cpp:127 msgctxt "KFormat|IEC binary prefix for 2^30" msgid "Gi" msgstr "Ги" #: lib/util/kformatprivate.cpp:128 msgctxt "KFormat|SI prefix for 10^12" msgid "T" msgstr "Т" #: lib/util/kformatprivate.cpp:128 msgctxt "KFormat|IEC binary prefix for 2^40" msgid "Ti" msgstr "Ти" #: lib/util/kformatprivate.cpp:129 msgctxt "KFormat|SI prefix for 10^15" msgid "P" msgstr "П" #: lib/util/kformatprivate.cpp:129 msgctxt "KFormat|IEC binary prefix for 2^50" msgid "Pi" msgstr "Пи" #: lib/util/kformatprivate.cpp:130 msgctxt "KFormat|SI prefix for 10^18" msgid "E" msgstr "Э" #: lib/util/kformatprivate.cpp:130 msgctxt "KFormat|IEC binary prefix for 2^60" msgid "Ei" msgstr "Эи" #: lib/util/kformatprivate.cpp:131 msgctxt "KFormat|SI prefix for 10^21" msgid "Z" msgstr "З" #: lib/util/kformatprivate.cpp:131 msgctxt "KFormat|IEC binary prefix for 2^70" msgid "Zi" msgstr "Зи" #: lib/util/kformatprivate.cpp:132 msgctxt "KFormat|SI prefix for 10^24" msgid "Y" msgstr "И" #: lib/util/kformatprivate.cpp:132 msgctxt "KFormat|IEC binary prefix for 2^80" msgid "Yi" msgstr "Ии" #: lib/util/kformatprivate.cpp:140 msgctxt "KFormat|Symbol of binary digit" msgid "bit" msgstr "бит" #: lib/util/kformatprivate.cpp:143 msgctxt "KFormat|Symbol of byte" msgid "B" msgstr "Б" #: lib/util/kformatprivate.cpp:146 msgctxt "KFormat|Symbol of meter" msgid "m" msgstr "м" #: lib/util/kformatprivate.cpp:149 msgctxt "KFormat|Symbol of hertz" msgid "Hz" msgstr "Гц" #. value without prefix, format " " #: lib/util/kformatprivate.cpp:158 #, qt-format msgctxt "KFormat|no Prefix" msgid "%1 %2" msgstr "%1 %2" #. value with prefix, format " " #: lib/util/kformatprivate.cpp:177 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 %2%3" msgstr "%1 %2%3" #. MetricBinaryDialect size in bytes #: lib/util/kformatprivate.cpp:228 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 B" msgstr "%1 Б" #. MetricBinaryDialect size in 1000 bytes #: lib/util/kformatprivate.cpp:231 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 kB" msgstr "%1 КБ" #. MetricBinaryDialect size in 10^6 bytes #: lib/util/kformatprivate.cpp:234 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 MB" msgstr "%1 МБ" #. MetricBinaryDialect size in 10^9 bytes #: lib/util/kformatprivate.cpp:237 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 GB" msgstr "%1 ГБ" #. MetricBinaryDialect size in 10^12 bytes #: lib/util/kformatprivate.cpp:240 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 TB" msgstr "%1 ТБ" #. MetricBinaryDialect size in 10^15 bytes #: lib/util/kformatprivate.cpp:243 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 PB" msgstr "%1 ПБ" #. MetricBinaryDialect size in 10^18 byte #: lib/util/kformatprivate.cpp:246 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 EB" msgstr "%1 ЭБ" #. MetricBinaryDialect size in 10^21 bytes #: lib/util/kformatprivate.cpp:249 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 ZB" msgstr "%1 ЗБ" #. MetricBinaryDialect size in 10^24 bytes #: lib/util/kformatprivate.cpp:252 #, qt-format msgctxt "KFormat|MetricBinaryDialect" msgid "%1 YB" msgstr "%1 ЙБ" #. JEDECBinaryDialect memory size in bytes #: lib/util/kformatprivate.cpp:258 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 B" msgstr "%1 Б" # BUGME: "КБ" or "КиБ" here? --aspotashev #. JEDECBinaryDialect memory size in 1024 bytes #: lib/util/kformatprivate.cpp:261 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 KB" msgstr "%1 КиБ" #. JEDECBinaryDialect memory size in 10^20 bytes #: lib/util/kformatprivate.cpp:264 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 MB" msgstr "%1 МиБ" #. JEDECBinaryDialect memory size in 10^30 bytes #: lib/util/kformatprivate.cpp:267 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 GB" msgstr "%1 ГиБ" #. JEDECBinaryDialect memory size in 10^40 bytes #: lib/util/kformatprivate.cpp:270 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 TB" msgstr "%1 ТиБ" #. JEDECBinaryDialect memory size in 10^50 bytes #: lib/util/kformatprivate.cpp:273 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 PB" msgstr "%1 ПиБ" #. JEDECBinaryDialect memory size in 10^60 bytes #: lib/util/kformatprivate.cpp:276 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 EB" msgstr "%1 ЭиБ" #. JEDECBinaryDialect memory size in 10^70 bytes #: lib/util/kformatprivate.cpp:279 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 ZB" msgstr "%1 ЗиБ" #. JEDECBinaryDialect memory size in 10^80 bytes #: lib/util/kformatprivate.cpp:282 #, qt-format msgctxt "KFormat|JEDECBinaryDialect" msgid "%1 YB" msgstr "%1 ЙиБ" #. IECBinaryDialect size in bytes #: lib/util/kformatprivate.cpp:288 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 B" msgstr "%1 Б" #. IECBinaryDialect size in 1024 bytes #: lib/util/kformatprivate.cpp:291 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 KiB" msgstr "%1 КиБ" # BUGME: something is wrong in the comment extracted from source code: it says 10^20 while it should 2^20 --aspotashev #. IECBinaryDialect size in 10^20 bytes #: lib/util/kformatprivate.cpp:294 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 MiB" msgstr "%1 МиБ" #. IECBinaryDialect size in 10^30 bytes #: lib/util/kformatprivate.cpp:297 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 GiB" msgstr "%1 ГиБ" #. IECBinaryDialect size in 10^40 bytes #: lib/util/kformatprivate.cpp:300 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 TiB" msgstr "%1 ТиБ" #. IECBinaryDialect size in 10^50 bytes #: lib/util/kformatprivate.cpp:303 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 PiB" msgstr "%1 ПиБ" #. IECBinaryDialect size in 10^60 bytes #: lib/util/kformatprivate.cpp:306 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 EiB" msgstr "%1 ЭиБ" #. IECBinaryDialect size in 10^70 bytes #: lib/util/kformatprivate.cpp:309 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 ZiB" msgstr "%1 ЗиБ" #. IECBinaryDialect size in 10^80 bytes #: lib/util/kformatprivate.cpp:312 #, qt-format msgctxt "KFormat|IECBinaryDialect" msgid "%1 YiB" msgstr "%1 ЙиБ" #. @item:intext Duration format minutes, seconds and milliseconds #: lib/util/kformatprivate.cpp:351 #, qt-format msgctxt "KFormat|" msgid "%1m%2.%3s" msgstr "%1м%2,%3с" #. @item:intext Duration format minutes and seconds #: lib/util/kformatprivate.cpp:356 #, qt-format msgctxt "KFormat|" msgid "%1m%2s" msgstr "%1м%2с" #. @item:intext Duration format hours and minutes #: lib/util/kformatprivate.cpp:360 #, qt-format msgctxt "KFormat|" msgid "%1h%2m" msgstr "%1ч%2м" #. @item:intext Duration format hours, minutes, seconds, milliseconds #: lib/util/kformatprivate.cpp:364 #, qt-format msgctxt "KFormat|" msgid "%1h%2m%3.%4s" msgstr "%1ч%2м%3,%4с" #. @item:intext Duration format hours, minutes, seconds #: lib/util/kformatprivate.cpp:370 #, qt-format msgctxt "KFormat|" msgid "%1h%2m%3s" msgstr "%1ч%2м%3с" #. @item:intext Duration format minutes, seconds and milliseconds #: lib/util/kformatprivate.cpp:380 #, qt-format msgctxt "KFormat|" msgid "%1:%2.%3" msgstr "%1:%2,%3" #. @item:intext Duration format minutes and seconds #. ---------- #. @item:intext Duration format hours and minutes #: lib/util/kformatprivate.cpp:385 lib/util/kformatprivate.cpp:389 #, qt-format msgctxt "KFormat|" msgid "%1:%2" msgstr "%1:%2" #. @item:intext Duration format hours, minutes, seconds, milliseconds #: lib/util/kformatprivate.cpp:393 #, qt-format msgctxt "KFormat|" msgid "%1:%2:%3.%4" msgstr "%1:%2:%3,%4" #. @item:intext Duration format hours, minutes, seconds #: lib/util/kformatprivate.cpp:399 #, qt-format msgctxt "KFormat|" msgid "%1:%2:%3" msgstr "%1:%2:%3" #. @item:intext %1 is a real number, e.g. 1.23 days #: lib/util/kformatprivate.cpp:414 #, qt-format msgctxt "KFormat|" msgid "%1 days" msgstr "%1 дня" #. @item:intext %1 is a real number, e.g. 1.23 hours #: lib/util/kformatprivate.cpp:417 #, qt-format msgctxt "KFormat|" msgid "%1 hours" msgstr "%1 часа" #. @item:intext %1 is a real number, e.g. 1.23 minutes #: lib/util/kformatprivate.cpp:420 #, qt-format msgctxt "KFormat|" msgid "%1 minutes" msgstr "%1 минуты" #. @item:intext %1 is a real number, e.g. 1.23 seconds #: lib/util/kformatprivate.cpp:423 #, qt-format msgctxt "KFormat|" msgid "%1 seconds" msgstr "%1 секунды" #. @item:intext %1 is a whole number #: lib/util/kformatprivate.cpp:428 #, qt-format msgctxt "KFormat|" msgid "%n millisecond(s)" msgid_plural "%n millisecond(s)" msgstr[0] "%n миллисекунда" msgstr[1] "%n миллисекунды" msgstr[2] "%n миллисекунд" #. @item:intext %n is a whole number #: lib/util/kformatprivate.cpp:446 #, qt-format msgctxt "KFormat|" msgid "%n day(s)" msgid_plural "%n day(s)" msgstr[0] "%n день" msgstr[1] "%n дня" msgstr[2] "%n дней" #. @item:intext %n is a whole number #: lib/util/kformatprivate.cpp:451 #, qt-format msgctxt "KFormat|" msgid "%n hour(s)" msgid_plural "%n hour(s)" msgstr[0] "%n час" msgstr[1] "%n часа" msgstr[2] "%n часов" #. @item:intext %n is a whole number #: lib/util/kformatprivate.cpp:456 #, qt-format msgctxt "KFormat|" msgid "%n minute(s)" msgid_plural "%n minute(s)" msgstr[0] "%n минута" msgstr[1] "%n минуты" msgstr[2] "%n минут" #. @item:intext %n is a whole number #: lib/util/kformatprivate.cpp:461 #, qt-format msgctxt "KFormat|" msgid "%n second(s)" msgid_plural "%n second(s)" msgstr[0] "%n секунда" msgstr[1] "%n секунды" msgstr[2] "%n секунд" #. @item:intext days and hours. This uses the previous item:intext messages. If this does not fit the grammar of your language please contact the i18n team to solve the problem #. ---------- #. @item:intext hours and minutes. This uses the previous item:intext messages. If this does not fit the grammar of your language please contact the i18n team to solve the problem #. ---------- #. @item:intext minutes and seconds. This uses the previous item:intext messages. If this does not fit the grammar of your language please contact the i18n team to solve the problem #: lib/util/kformatprivate.cpp:486 lib/util/kformatprivate.cpp:492 #: lib/util/kformatprivate.cpp:498 #, qt-format msgctxt "KFormat|" msgid "%1 and %2" msgstr "%1 %2" #: lib/util/kformatprivate.cpp:509 msgctxt "" "KFormat|used when a relative date string can't be generated because the date " "is invalid" msgid "Invalid date" msgstr "Недопустимая дата" #: lib/util/kformatprivate.cpp:519 msgctxt "KFormat|" msgid "Tomorrow" msgstr "Завтра" #: lib/util/kformatprivate.cpp:521 msgctxt "KFormat|" msgid "Today" msgstr "Сегодня" #: lib/util/kformatprivate.cpp:523 msgctxt "KFormat|" msgid "Yesterday" msgstr "Вчера" #: lib/util/kformatprivate.cpp:529 msgctxt "KFormat|most recent such day before today" msgid "Last Monday" msgstr "Прошедший понедельник" #: lib/util/kformatprivate.cpp:531 msgctxt "KFormat|most recent such day before today" msgid "Last Tuesday" msgstr "Прошедший вторник" #: lib/util/kformatprivate.cpp:533 msgctxt "KFormat|most recent such day before today" msgid "Last Wednesday" msgstr "Прошедшая среда" #: lib/util/kformatprivate.cpp:535 msgctxt "KFormat|most recent such day before today" msgid "Last Thursday" msgstr "Прошедший четверг" #: lib/util/kformatprivate.cpp:537 msgctxt "KFormat|most recent such day before today" msgid "Last Friday" msgstr "Прошедшая пятница" #: lib/util/kformatprivate.cpp:539 msgctxt "KFormat|most recent such day before today" msgid "Last Saturday" msgstr "Прошедшая суббота" #: lib/util/kformatprivate.cpp:541 msgctxt "KFormat|most recent such day before today" msgid "Last Sunday" msgstr "Прошедшее воскресенье" #: lib/util/kformatprivate.cpp:546 msgctxt "KFormat|the next such day after today" msgid "Next Monday" msgstr "Ближайший понедельник" #: lib/util/kformatprivate.cpp:548 msgctxt "KFormat|the next such day after today" msgid "Next Tuesday" msgstr "Ближайший вторник" #: lib/util/kformatprivate.cpp:550 msgctxt "KFormat|the next such day after today" msgid "Next Wednesday" msgstr "Ближайшая среда" #: lib/util/kformatprivate.cpp:552 msgctxt "KFormat|the next such day after today" msgid "Next Thursday" msgstr "Ближайший четверг" #: lib/util/kformatprivate.cpp:554 msgctxt "KFormat|the next such day after today" msgid "Next Friday" msgstr "Ближайшая пятница" #: lib/util/kformatprivate.cpp:556 msgctxt "KFormat|the next such day after today" msgid "Next Saturday" msgstr "Ближайшая суббота" #: lib/util/kformatprivate.cpp:558 msgctxt "KFormat|the next such day after today" msgid "Next Sunday" msgstr "Ближайшее воскресенье" # BUGME: translate as "%1 в %2"? Need testing. --aspotashev #. relative datetime with %1 result of formatReleativeDate() and %2 the formatted time If this does not fit the grammar of your language please contact the i18n team to solve the problem #: lib/util/kformatprivate.cpp:573 #, qt-format msgctxt "KFormat|" msgid "%1, %2" msgstr "%1, %2" # [https://bugs.kde.org/show_bug.cgi?id=335106] BUGME: grammatical genders are down here; even worse -- we can't use Transcript --aspotashev #~ msgctxt "KFormat|" #~ msgid "Last %1" #~ msgstr "Прошедший %1" # [https://bugs.kde.org/show_bug.cgi?id=335106] BUGME: grammatical genders are down here; even worse -- we can't use Transcript --aspotashev #~ msgctxt "KFormat|" #~ msgid "Next %1" #~ msgstr "Ближайший %1" #, fuzzy #~ msgctxt "KPluginLoader|" #~ msgid "Could not find plugin '%1' for application '%2'" #~ msgstr "Не удалось найти модуль «%1» для приложения «%2»." #, fuzzy #~ msgctxt "KAboutLicense|GNU General Public License Version 2" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|GNU Lesser General Public License Version 2" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|BSD License" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|Artistic License" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|Q Public License" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|GNU General Public License Version 3" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|GNU Lesser General Public License Version 3" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|Custom" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "KAboutLicense|Not specified" #~ msgid "@item license" #~ msgstr "Artistic License" #, fuzzy #~ msgctxt "" #~ "KAboutData|

KDE is translated into many languages thanks to the work of " #~ "the translation teams all over the world.

For more information on " #~ "KDE internationalization visit http://" #~ "l10n.kde.org

" #~ msgid "replace this with information about your translation team" #~ msgstr "Опишите загружаемые материалы на английском языке." #~ msgctxt "NAME OF TRANSLATORS" #~ msgid "Your names" #~ msgstr "" #~ "Григорий Мохин,Николай Шафоростов,Андрей Черепанов,Леонид Кантер,Альберт " #~ "Валиев" #~ msgctxt "EMAIL OF TRANSLATORS" #~ msgid "Your emails" #~ msgstr "" #~ "mok@kde.ru,shaforostoff@kde.ru,skull@kde.ru,leon@asplinux.ru," #~ "darkstar@altlinux.ru" #~ msgid "Name" #~ msgstr "Название" #~ msgid "Host" #~ msgstr "Узел" #~ msgid "Port" #~ msgstr "Порт" #~ msgid "i18n() takes at least one argument" #~ msgstr "Функция i18n() требует хотя бы один аргумент." #~ msgid "i18nc() takes at least two arguments" #~ msgstr "Функция i18nc() требует хотя бы два аргумента." #~ msgid "i18np() takes at least two arguments" #~ msgstr "Функция i18np() требует хотя бы два аргумента." #~ msgid "i18ncp() takes at least three arguments" #~ msgstr "Функция i18ncp() требует хотя бы три аргумента." #~ msgid "System Default (currently: %1)" #~ msgstr "Стандартный (сейчас: %1)" #~ msgid "Editor Chooser" #~ msgstr "Редактор по умолчанию" #~ msgid "" #~ "Please choose the default text editing component that you wish to use in " #~ "this application. If you choose System Default, the application " #~ "will honor your changes in the System Settings. All other choices will " #~ "override that setting." #~ msgstr "" #~ "Выберите компонент редактирования текста, который вы хотите использовать " #~ "с этим приложением по умолчанию. Если вы выберете Стандартный, " #~ "приложение будет использовать компонент, указанный вами в параметрах " #~ "системы. При выборе любого другого варианта глобальные настройки будут " #~ "игнорироваться." #~ msgid "" #~ "The template needs information about you, which is stored in your address " #~ "book.\n" #~ "However, the required plugin could not be loaded.\n" #~ "\n" #~ "Please install the KDEPIM/Kontact package for your system." #~ msgstr "" #~ "Для заполнения шаблона требуются данные о вас, хранящиеся в адресной " #~ "книге.\n" #~ "Требуемое для этого расширение не найдено.\n" #~ "\n" #~ "Установите пакет KDEPIM/Kontact." #~ msgid "TETest" #~ msgstr "TETest" #~ msgid "Only local files are supported." #~ msgstr "Поддерживаются только локальные файлы." #~ msgid "Keep output results from scripts" #~ msgstr "Сохранять коды выхода из скриптов" #~ msgid "Check whether config file itself requires updating" #~ msgstr "Проверять, требует ли обновления сам файл конфигурации" #~ msgid "File to read update instructions from" #~ msgstr "Читать инструкции по обновлению из файла" #~ msgid "KConf Update" #~ msgstr "KConf Update" #~ msgid "KDE Tool for updating user configuration files" #~ msgstr "Утилита KDE для обновления файлов настроек пользователей" #~ msgid "(c) 2001, Waldo Bastian" #~ msgstr "© Waldo Bastian, 2001" #~ msgid "Waldo Bastian" #~ msgstr "Waldo Bastian" #~ msgid "??" #~ msgstr "??" #~ msgid "&About" #~ msgstr "&О программе" #~ msgid "" #~ "No information available.\n" #~ "The supplied KAboutData object does not exist." #~ msgstr "" #~ "К сожалению, информация отсутствует.\n" #~ "Программа не предоставила объекта KAboutData." #~ msgid "A&uthor" #~ msgstr "А&втор" #~ msgid "A&uthors" #~ msgstr "&Авторы" #~ msgid "" #~ "Please use http://bugs.kde.org to " #~ "report bugs.\n" #~ msgstr "" #~ "Используйте http://bugs.kde.org для " #~ "сообщения об ошибках.\n" #~ msgid "Please report bugs to %2.\n" #~ msgstr "" #~ "Используйте %2 для сообщения об ошибках.\n" #~ msgid "&Thanks To" #~ msgstr "&Благодарности" #~ msgid "T&ranslation" #~ msgstr "&Перевод" #~ msgid "&License Agreement" #~ msgstr "&Лицензия" #~ msgid "Author" #~ msgstr "Автор" #~ msgid "Email" #~ msgstr "Адрес электронной почты" #~ msgid "Homepage" #~ msgstr "Веб-сайт" #~ msgid "Task" #~ msgstr "Задача" #~ msgid "" #~ "%1
version %2
Using KDE %3" #~ msgstr "" #~ "%1
версия %2
В составе KDE " #~ "%3" #~ msgid "Other Contributors:" #~ msgstr "Другие участники:" #~ msgid "(No logo available)" #~ msgstr "(Логотип отсутствует)" #~ msgid "About %1" #~ msgstr "О программе %1" #~ msgid "Undo: %1" #~ msgstr "Отменить: %1" #~ msgid "Redo: %1" #~ msgstr "Повторить: %1" #~ msgid "&Undo" #~ msgstr "О&тменить действие" #~ msgid "&Redo" #~ msgstr "&Повторить отменённое действие" #~ msgid "&Undo: %1" #~ msgstr "&Отменить: %1" #~ msgid "&Redo: %1" #~ msgstr "&Повторить: %1" #~ msgid "Close" #~ msgstr "Закрыть" #~ msgctxt "Freeze the window geometry" #~ msgid "Freeze" #~ msgstr "Зафиксировать" #~ msgctxt "Dock this window" #~ msgid "Dock" #~ msgstr "Встроить" #~ msgid "Detach" #~ msgstr "Отделить" #~ msgid "Hide %1" #~ msgstr "Скрыть %1" #~ msgid "Show %1" #~ msgstr "Показать %1" #~ msgid "Search Columns" #~ msgstr "Столбцы для поиска" #~ msgid "All Visible Columns" #~ msgstr "Все показанные столбцы" #~ msgctxt "Column number %1" #~ msgid "Column No. %1" #~ msgstr "Столбец № %1" #~ msgid "S&earch:" #~ msgstr "&Поиск:" #~ msgid "&Password:" #~ msgstr "&Пароль:" #~ msgid "&Keep password" #~ msgstr "Сохранить паро&ль" #~ msgid "&Verify:" #~ msgstr "&Проверка:" #~ msgid "Password strength meter:" #~ msgstr "Датчик надёжности пароля:" #~ msgid "" #~ "The password strength meter gives an indication of the security of the " #~ "password you have entered. To improve the strength of the password, " #~ "try:\n" #~ " - using a longer password;\n" #~ " - using a mixture of upper- and lower-case letters;\n" #~ " - using numbers or symbols, such as #, as well as letters." #~ msgstr "" #~ "Датчик показывает защищённость или надёжность введённого пароля. Пароль " #~ "будет более надёжным, если:\n" #~ " - он имеет достаточную длину;\n" #~ " - в него входят как прописные, так и строчные буквы;\n" #~ " - в него входят помимо букв числа и специальные символы, такие как #." #~ msgid "Passwords do not match" #~ msgstr "Пароли не совпадают" #~ msgid "You entered two different passwords. Please try again." #~ msgstr "Введённые пароли не совпадают. Попробуйте ещё раз." #~ msgid "" #~ "The password you have entered has a low strength. To improve the strength " #~ "of the password, try:\n" #~ " - using a longer password;\n" #~ " - using a mixture of upper- and lower-case letters;\n" #~ " - using numbers or symbols as well as letters.\n" #~ "\n" #~ "Would you like to use this password anyway?" #~ msgstr "" #~ "Введён слабый пароль. Пароль будет более надёжным, если:\n" #~ " - он имеет достаточную длину;\n" #~ " - в него входят как прописные, так и строчные буквы;\n" #~ " - в него входят помимо букв числа и специальные символы.\n" #~ "\n" #~ "Использовать введённый пароль?" #~ msgid "Low Password Strength" #~ msgstr "Слабый пароль" #~ msgid "Password Input" #~ msgstr "Ввод пароля" #~ msgid "Password is empty" #~ msgstr "Пустой пароль" #~ msgid "Password must be at least 1 character long" #~ msgid_plural "Password must be at least %1 characters long" #~ msgstr[0] "Пароль должен быть не короче %1 символа" #~ msgstr[1] "Пароль должен быть не короче %1 символов" #~ msgstr[2] "Пароль должен быть не короче %1 символов" #~ msgstr[3] "Пароль должен быть не короче %1 символа" #~ msgid "Passwords match" #~ msgstr "Пароли совпадают" #~ msgctxt "@option:check" #~ msgid "Do Spellchecking" #~ msgstr "Проверить орфографию" #~ msgctxt "@option:check" #~ msgid "Create &root/affix combinations not in dictionary" #~ msgstr "Соз&давать сочетания корней/аффиксов не в словаре" #~ msgctxt "@option:check" #~ msgid "Consider run-together &words as spelling errors" #~ msgstr "С&читать ошибкой написанные вместе слова" #~ msgctxt "@label:listbox" #~ msgid "&Dictionary:" #~ msgstr "&Словарь:" #~ msgctxt "@label:listbox" #~ msgid "&Encoding:" #~ msgstr "&Кодировка:" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "International Ispell" #~ msgstr "Международный Ispell" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Aspell" #~ msgstr "Aspell" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Hspell" #~ msgstr "Hspell" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Zemberek" #~ msgstr "Zemberek" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Hunspell" #~ msgstr "Hunspell" #~ msgctxt "@label:listbox" #~ msgid "&Client:" #~ msgstr "&Программа проверки:" #~ msgctxt "@item Spelling dictionary" #~ msgid "Hebrew" #~ msgstr "Иврит" #~ msgctxt "@item Spelling dictionary" #~ msgid "Turkish" #~ msgstr "Турецкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "English" #~ msgstr "Английский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Spanish" #~ msgstr "Испанский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Danish" #~ msgstr "Датский" #~ msgctxt "@item Spelling dictionary" #~ msgid "German" #~ msgstr "Немецкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "German (new spelling)" #~ msgstr "Немецкий (новая орфография)" #~ msgctxt "@item Spelling dictionary" #~ msgid "Brazilian Portuguese" #~ msgstr "Португальский (Бразилия)" #~ msgctxt "@item Spelling dictionary" #~ msgid "Portuguese" #~ msgstr "Португальский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Esperanto" #~ msgstr "Эсперанто" #~ msgctxt "@item Spelling dictionary" #~ msgid "Norwegian" #~ msgstr "Норвежский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Polish" #~ msgstr "Польский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Russian" #~ msgstr "Русский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Slovenian" #~ msgstr "Словенский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Slovak" #~ msgstr "Словацкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "Czech" #~ msgstr "Чешский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Swedish" #~ msgstr "Шведский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Swiss German" #~ msgstr "Швейцарский немецкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "Ukrainian" #~ msgstr "Украинский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Lithuanian" #~ msgstr "Литовский" #~ msgctxt "@item Spelling dictionary" #~ msgid "French" #~ msgstr "Французский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Belarusian" #~ msgstr "Белорусский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Hungarian" #~ msgstr "Венгерский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Unknown" #~ msgstr "Неизвестный" #~ msgctxt "@item Spelling dictionary" #~ msgid "ISpell Default" #~ msgstr "ISpell по умолчанию" #~ msgctxt "@item Spelling dictionary: %1 dictionary name, %2 file name" #~ msgid "Default - %1 [%2]" #~ msgstr "По умолчанию: %1 [%2]" #~ msgctxt "@item Spelling dictionary" #~ msgid "ASpell Default" #~ msgstr "ASpell по умолчанию" #~ msgctxt "@item Spelling dictionary: %1 dictionary name" #~ msgid "Default - %1" #~ msgstr "По умолчанию: %1" #~ msgctxt "@item Spelling dictionary" #~ msgid "Hunspell Default" #~ msgstr "Hunspell по умолчанию" #~ msgid "You have to restart the dialog for changes to take effect" #~ msgstr "Чтобы изменения вступили в силу, необходимо перезапустить диалог" #~ msgid "Spell Checker" #~ msgstr "Проверка орфографии" #~ msgid "Check Spelling" #~ msgstr "Проверить орфографию" #~ msgid "&Finished" #~ msgstr "&Готово" #~ msgid "" #~ "

This word was considered to be an \"unknown word\" because it does " #~ "not match any entry in the dictionary currently in use. It may also be a " #~ "word in a foreign language.

\n" #~ "

If the word is not misspelled, you may add it to the dictionary by " #~ "clicking Add to Dictionary. If you do not want to add the unknown " #~ "word to the dictionary, but you want to leave it unchanged, click " #~ "Ignore or Ignore All.

\n" #~ "

However, if the word is misspelled, you can try to find the correct " #~ "replacement in the list below. If you cannot find a replacement there, " #~ "you may type it in the text box below, and click Replace or " #~ "Replace All.

\n" #~ "" #~ msgstr "" #~ "

Это слово отсутствует в текущем словаре. Возможно, это иностранное " #~ "слово или неологизм.

\n" #~ "

Если вы уверены, что слово не содержит ошибок, вы можете его " #~ "Добавить в словарь. Если вы не хотите это делать, просто нажмите " #~ "Игнорировать или Игнорировать везде.

\n" #~ "

Если слово содержит опечатку, выберите из списка подходящий вариант. " #~ "Если такого не имеется, введите слово вручную и нажмите Заменить " #~ "или Заменить все.

\n" #~ "" #~ msgid "Unknown word:" #~ msgstr "Неизвестное слово:" #~ msgid "Unknown word" #~ msgstr "Неизвестное слово" #~ msgid "misspelled" #~ msgstr "ошибочно" #~ msgid "" #~ "\n" #~ "

Select the language of the document you are proofing here.

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Выберите язык проверяемого документа.

\n" #~ "" #~ msgid "&Language:" #~ msgstr "&Язык:" #~ msgid "Text excerpt showing the unknown word in its context." #~ msgstr "Отрывок текста со словом, содержащим ошибку." #~ msgid "" #~ "\n" #~ "

Here you can see a text excerpt showing the unknown word in its " #~ "context. If this information is not sufficient to choose the best " #~ "replacement for the unknown word, you can click on the document you are " #~ "proofing, read a larger part of the text and then return here to continue " #~ "proofing.

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Здесь показывается контекст слова, содержащего ошибку. Если этого " #~ "отрывка недостаточно, щёлкните на документе, прочитайте основной текст и " #~ "вернитесь в диалог проверки орфографии.

\n" #~ "" #~ msgid "... the misspelled word shown in context ..." #~ msgstr "... ошибочное слово показано в контексте ..." #~ msgid "" #~ "\n" #~ "

The unknown word was detected and considered unknown because it is not " #~ "included in the dictionary.
\n" #~ "Click here if you consider the unknown word not to be misspelled, and you " #~ "want to avoid wrongly detecting it again in the future. If you want to " #~ "let it remain as is, but not add it to the dictionary, then click " #~ "Ignore or Ignore All instead.

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Это слово отсутствует в текущем словаре. Возможно, это иностранное " #~ "слово или неологизм.

\n" #~ "

Если вы уверены, что слово не содержит ошибок, вы можете его " #~ "Добавить в словарь. Если вы не хотите это делать, просто нажмите " #~ "Игнорировать или Игнорировать везде.

\n" #~ "" #~ msgid "<< Add to Dictionary" #~ msgstr "<< Добавить в словарь" #~ msgid "" #~ "\n" #~ "

Click here to replace all occurrences of the unknown text with the " #~ "text in the edit box above (to the left).

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Заменить это слово во всём документе.

\n" #~ "" #~ msgid "R&eplace All" #~ msgstr "Зам&енить все" #~ msgid "Suggestion List" #~ msgstr "Предлагаемые варианты" #~ msgid "" #~ "\n" #~ "

If the unknown word is misspelled, you should check if the correction " #~ "for it is available and if it is, click on it. If none of the words in " #~ "this list is a good replacement you may type the correct word in the edit " #~ "box above.

\n" #~ "

To correct this word click Replace if you want to correct only " #~ "this occurrence or Replace All if you want to correct all " #~ "occurrences.

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Если слово содержит ошибку, проверьте наличие правильного варианта в " #~ "предлагаемом списке. Если его там не будет, вы можете ввести правильный " #~ "вариант вручную.

\n" #~ "

Чтобы исправить это слово только в этом месте нажмите Заменить, " #~ "а чтобы исправить его во всём документе, воспользуйтесь Заменить все.

\n" #~ "" #~ msgid "Suggested Words" #~ msgstr "Предлагаемые слова" #~ msgid "" #~ "\n" #~ "

Click here to replace this occurrence of the unknown text with the " #~ "text in the edit box above (to the left).

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Заменить слово в данном случае.

\n" #~ "" #~ msgid "&Replace" #~ msgstr "&Заменить" #~ msgid "" #~ "\n" #~ "

If the unknown word is misspelled, you should type the correction for " #~ "your misspelled word here or select it from the list below.

\n" #~ "

You can then click Replace if you want to correct only this " #~ "occurrence of the word or Replace All if you want to correct all " #~ "occurrences.

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Введите здесь правильный вариант написания слова или выберите го из " #~ "списка.

\n" #~ "

Затем нажмите Заменить либо Заменить все.

\n" #~ "" #~ msgid "Replace &with:" #~ msgstr "Заменить &на:" #~ msgid "" #~ "\n" #~ "

Click here to let this occurrence of the unknown word remain as is.\n" #~ "

This action is useful when the word is a name, an acronym, a foreign " #~ "word or any other unknown word that you want to use but not add to the " #~ "dictionary.

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Не проверять это слово.

\n" #~ "

Это может быть полезно, если слово является именем, сокращением, " #~ "иностранным словом или любым другим словом, которое вы хотите " #~ "использовать, но не хотите добавлять в словарь.

\n" #~ "" #~ msgid "&Ignore" #~ msgstr "&Игнорировать" #~ msgid "" #~ "\n" #~ "

Click here to let all occurrences of the unknown word remain as they " #~ "are.

\n" #~ "

This action is useful when the word is a name, an acronym, a foreign " #~ "word or any other unknown word that you want to use but not add to the " #~ "dictionary.

\n" #~ "" #~ msgstr "" #~ "\n" #~ "

Не проверять все вхождения этого слова в тексте.

\n" #~ "

Это может быть полезно, если слово является именем, сокращением, " #~ "иностранным словом или любым другим словом, которое вы хотите " #~ "использовать, но не хотите добавлять в словарь.

\n" #~ "" #~ msgid "I&gnore All" #~ msgstr "Игнорировать вез&де" #~ msgid "S&uggest" #~ msgstr "В&ариант" #~ msgid "Language Selection" #~ msgstr "Выбор языка" #~ msgid "As-you-type spell checking enabled." #~ msgstr "Проверка орфографии на лету включена." #~ msgid "As-you-type spell checking disabled." #~ msgstr "Проверка орфографии на лету выключена." #~ msgid "Incremental Spellcheck" #~ msgstr "Проверка орфографии на лету" #~ msgid "Too many misspelled words. As-you-type spell checking disabled." #~ msgstr "" #~ "Слишком много ошибочных слов. Проверка орфографии на лету выключена." #~ msgid "Check Spelling..." #~ msgstr "Проверить орфографию..." #~ msgid "Auto Spell Check" #~ msgstr "Автоматическая проверка орфографии" #~ msgid "Allow Tabulations" #~ msgstr "Разрешить табуляцию" #~ msgid "Spell Checking" #~ msgstr "Проверка орфографии" #~ msgid "&Back" #~ msgstr "&Назад" #~ msgctxt "Opposite to Back" #~ msgid "&Next" #~ msgstr "&Вперёд" #~ msgid "Unknown View" #~ msgstr "Неизвестный вид" #~ msgid "" #~ "A command-line application that can be used to run KUnitTest modules." #~ msgstr "Утилита командной строки для запуска модулей KUnitTest." #~ msgid "Only run modules whose filenames match the regexp." #~ msgstr "Запустить только модули, совпадающие с регулярным выражением." #~ msgid "" #~ "Only run tests modules which are found in the folder. Use the query " #~ "option to select modules." #~ msgstr "" #~ "Запустить модули тестов из папки. Измените параметры запроса для выбора " #~ "модулей." #~ msgid "" #~ "Disables debug capturing. You typically use this option when you use the " #~ "GUI." #~ msgstr "" #~ "Отключить отладку захвата. Обычно применяется при использовании " #~ "графического интерфейса." #~ msgid "KUnitTest ModRunner" #~ msgstr "KUnitTest ModRunner" #~ msgid "(C) 2005 Jeroen Wijnhout" #~ msgstr "© Jeroen Wijnhout, 2005" #~ msgid "DBus Backend error: connection to helper failed. %1" #~ msgstr "Внутренняя ошибка DBus: сбой подключения к обработчику. %1" # BUGME: Message error -> error message #~ msgid "" #~ "DBus Backend error: could not contact the helper. Connection error: %1. " #~ "Message error: %2" #~ msgstr "" #~ "Внутренняя ошибка DBus: сбой подключения к обработчику. Ошибка " #~ "подключения: %1. Сообщение об ошибке: %2" # BUGME: absolutely no information on what "%1" is #~ msgid "DBus Backend error: received corrupt data from helper %1 %2" #~ msgstr "" #~ "Внутренняя ошибка DBus: получены повреждённые данные от обработчика. %1 %2" #~ msgid "Please contact your system administrator." #~ msgstr "Свяжитесь с вашим системным администратором." #~ msgid "Configuration file \"%1\" not writable.\n" #~ msgstr "Файл конфигурации «%1» защищён от записи.\n" #~ msgid "No target filename has been given." #~ msgstr "Не указан целевой файл." #~ msgid "Already opened." #~ msgstr "Файл уже открыт." #~ msgid "Insufficient permissions in target directory." #~ msgstr "Недостаточно прав для записи в целевую папку." #~ msgid "Unable to open temporary file. Error was: %1." #~ msgstr "Не удалось открыть временный файл. Произошла ошибка: %1" #~ msgid "Synchronization to disk failed" #~ msgstr "Ошибка синхронизации с диском" #~ msgid "Error during rename." #~ msgstr "Ошибка при попытке переименования." #~ msgid "kde4-config" #~ msgstr "kde4-config" #~ msgid "A little program to output installation paths" #~ msgstr "Программа, выводящая пути каталогов KDE" #~ msgid "(C) 2000 Stephan Kulow" #~ msgstr "© Stephan Kulow, 2000" #~ msgid "Left for legacy support" #~ msgstr "Зарезервировано для устаревших приложений" #~ msgid "Compiled in prefix for KDE libraries" #~ msgstr "Встроенный prefix для библиотек KDE" #~ msgid "Compiled in exec_prefix for KDE libraries" #~ msgstr "Встроенный exec_prefix для библиотек KDE" #~ msgid "Compiled in library path suffix" #~ msgstr "Встроенный путь к библиотекам" #~ msgid "Prefix in $HOME used to write files" #~ msgstr "Путь в $HOME для записи файлов" #~ msgid "Compiled in version string for KDE libraries" #~ msgstr "Встроенная строка - версия библиотек KDE" #~ msgid "Available KDE resource types" #~ msgstr "Доступные типы ресурсов KDE" #~ msgid "Search path for resource type" #~ msgstr "Путь поиска типов ресурсов" #~ msgid "Find filename inside the resource type given to --path" #~ msgstr "Поиск имени файла для типа ресурса, указанного в --path" #~ msgid "User path: desktop|autostart|document" #~ msgstr "Пользовательский путь: desktop|autostart|document" #~ msgid "Prefix to install resource files to" #~ msgstr "Путь для установки файлов ресурсов" #~ msgid "Installation prefix for Qt" #~ msgstr "Путь к установленной библиотеке Qt" #~ msgid "Location of installed Qt binaries" #~ msgstr "Расположение установленных бинарных файлов Qt" #~ msgid "Location of installed Qt libraries" #~ msgstr "Расположение установленных библиотек Qt" #~ msgid "Location of installed Qt plugins" #~ msgstr "Расположение установленных расширений Qt" #~ msgid "Applications menu (.desktop files)" #~ msgstr "Меню приложений (файлы .desktop)" #~ msgid "Autostart directories" #~ msgstr "Папки автозапуска" #~ msgid "Cached information (e.g. favicons, web-pages)" #~ msgstr "Кэшированная информация (например, значки сайтов, веб-страницы)" #~ msgid "CGIs to run from kdehelp" #~ msgstr "CGI, вызываемые из kdehelp" #~ msgid "Configuration files" #~ msgstr "Конфигурационные файле" #~ msgid "Where applications store data" #~ msgstr "Хранилище данных приложений" #~ msgid "Emoticons" #~ msgstr "Смайлики" #~ msgid "Executables in $prefix/bin" #~ msgstr "Исполняемые файлы из $prefix/bin" #~ msgid "HTML documentation" #~ msgstr "Документация HTML" #~ msgid "Icons" #~ msgstr "Значки" #~ msgid "Configuration description files" #~ msgstr "Файлы описания конфигурации" #~ msgid "Libraries" #~ msgstr "Библиотеки" #~ msgid "Includes/Headers" #~ msgstr "Заголовки" #~ msgid "Translation files for KLocale" #~ msgstr "Файлы перевода для KLocale" #~ msgid "Mime types" #~ msgstr "Типы MIME" #~ msgid "Loadable modules" #~ msgstr "Загружаемые расширения" #~ msgid "Legacy pixmaps" #~ msgstr "Устаревшие значки" #~ msgid "Qt plugins" #~ msgstr "Расширения Qt" #~ msgid "Services" #~ msgstr "Службы" #~ msgid "Service types" #~ msgstr "Типы служб" #~ msgid "Application sounds" #~ msgstr "Звуковые файлы приложений" #~ msgid "Templates" #~ msgstr "Шаблоны" #~ msgid "Wallpapers" #~ msgstr "Обои" #~ msgid "XDG Application menu (.desktop files)" #~ msgstr "Меню приложений XDG (файлы .desktop)" #~ msgid "XDG Menu descriptions (.directory files)" #~ msgstr "Описание меню XDG (файлы .directory)" #~ msgid "XDG Icons" #~ msgstr "Значки XDG" #~ msgid "XDG Mime Types" #~ msgstr "Типы MIME XDG" #~ msgid "XDG Menu layout (.menu files)" #~ msgstr "Меню XDG (файлы .menu)" #~ msgid "XDG autostart directory" #~ msgstr "Папки автозапуска XDG" #~ msgid "Temporary files (specific for both current host and current user)" #~ msgstr "" #~ "Временные файлы (для конкретного компьютера и текущего пользователя)" #~ msgid "UNIX Sockets (specific for both current host and current user)" #~ msgstr "Сокеты UNIX (для конкретного компьютера и текущего пользователя)" #~ msgid "%1 - unknown type\n" #~ msgstr "%1 - неизвестный тип\n" #~ msgid "%1 - unknown type of userpath\n" #~ msgstr "%1 - неизвестный тип или путь\n" #~ msgctxt "@item license" #~ msgid "BSD License" #~ msgstr "Лицензия BSD" #~ msgid "Use the X-server display 'displayname'" #~ msgstr "Использовать дисплей X-сервера «displayname»" #~ msgid "Use the QWS display 'displayname'" #~ msgstr "Использовать QWS дисплей «displayname»" #~ msgid "Restore the application for the given 'sessionId'" #~ msgstr "Восстановить сеанс приложения по ключу «sessionId»" #~ msgid "" #~ "Causes the application to install a private color\n" #~ "map on an 8-bit display" #~ msgstr "" #~ "В случае 8-битного дисплея приложение\n" #~ "будет использовать собственную таблицу\n" #~ "цветов" #~ msgid "" #~ "Limits the number of colors allocated in the color\n" #~ "cube on an 8-bit display, if the application is\n" #~ "using the QApplication::ManyColor color\n" #~ "specification" #~ msgstr "" #~ "Ограничить количество используемых \n" #~ "цветов на 8-битном дисплее. Этот параметр \n" #~ "работает только для приложений, \n" #~ "использующих режим\n" #~ "QApplication::ManyColor." #~ msgid "tells Qt to never grab the mouse or the keyboard" #~ msgstr "Запрещает Qt перехватывать мышь или клавиатуру" #~ msgid "" #~ "running under a debugger can cause an implicit\n" #~ "-nograb, use -dograb to override" #~ msgstr "" #~ "при запуске в отладчике применять\n" #~ "-nograb. Используйте -dograb, чтобы явно включить этот режим" #~ msgid "switches to synchronous mode for debugging" #~ msgstr "включает синхронный режим для отладки" #~ msgid "defines the application font" #~ msgstr "определяет шрифт приложения" #~ msgid "" #~ "sets the default background color and an\n" #~ "application palette (light and dark shades are\n" #~ "calculated)" #~ msgstr "" #~ "задаёт цвет фона по умолчанию и палитру\n" #~ "приложения (светлые и тёмные тени\n" #~ "вычисляются)." #~ msgid "sets the default foreground color" #~ msgstr "определяет цвет текста по умолчанию" #~ msgid "sets the default button color" #~ msgstr "определяет цвет кнопок по умолчанию" #~ msgid "sets the application name" #~ msgstr "определяет имя приложения" #~ msgid "sets the application title (caption)" #~ msgstr "устанавливает заголовок приложения" #~ msgid "load the testability framework" #~ msgstr "загрузить тестовое окружение" #~ msgid "" #~ "forces the application to use a TrueColor visual on\n" #~ "an 8-bit display" #~ msgstr "" #~ "Приложение будет работать с 8-битным\n" #~ "дисплеем как с полноцветным устройством." #~ msgid "" #~ "sets XIM (X Input Method) input style. Possible\n" #~ "values are onthespot, overthespot, offthespot and\n" #~ "root" #~ msgstr "" #~ "Устанавливает тип ввода XIM (X Input Method).\n" #~ "Возможные значения: onthespot, overthespot, offthespot и \n" #~ "root." #~ msgid "set XIM server" #~ msgstr "устанавливает сервер XIM" #~ msgid "disable XIM" #~ msgstr "запретить XIM" #~ msgid "forces the application to run as QWS Server" #~ msgstr "Заставляет приложение работать как QWS сервер" #~ msgid "mirrors the whole layout of widgets" #~ msgstr "отразить расположение виджетов" #~ msgid "applies the Qt stylesheet to the application widgets" #~ msgstr "применяет стиль Qt к графическим элементам приложения" #~ msgid "" #~ "use a different graphics system instead of the default one, options are " #~ "raster and opengl (experimental)" #~ msgstr "" #~ "использовать указанную графическую подсистему для эффектов: raster или " #~ "opengl" #~ msgid "" #~ "QML JS debugger information. Application must be\n" #~ "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" #~ "enabled" #~ msgstr "" #~ "Отладочная информация QML JS. Для включения\n" #~ "отладчика приложение должно быть собрано с ключом\n" #~ "-DQT_DECLARATIVE_DEBUG" #~ msgid "Use 'caption' as name in the titlebar" #~ msgstr "Использовать имя «caption» в заголовке" #~ msgid "Use 'icon' as the application icon" #~ msgstr "Использовать «icon» как значок приложения" #~ msgid "Use alternative configuration file" #~ msgstr "Использовать альтернативный файл конфигурации" #~ msgid "Disable crash handler, to get core dumps" #~ msgstr "" #~ "Отключить обработчик сбоев. Это позволит в случае сбоя получить core dump." #~ msgid "Waits for a WM_NET compatible windowmanager" #~ msgstr "Ожидать инициализации WM_NET-совместимого оконного менеджера" #~ msgid "sets the application GUI style" #~ msgstr "устанавливает стиль графического интерфейса приложения" #~ msgid "" #~ "sets the client geometry of the main widget - see man X for the argument " #~ "format (usually WidthxHeight+XPos+YPos)" #~ msgstr "" #~ "устанавливает положение и размер главного окна приложения - формат " #~ "аргумента см. в man X (обычно это ШИРИНА×ВЫСОТА+X+Y)" #~ msgid "KDE Application" #~ msgstr "Приложение KDE" #~ msgid "Qt" #~ msgstr "Qt" #~ msgid "KDE" #~ msgstr "KDE" #~ msgid "Unknown option '%1'." #~ msgstr "Неизвестный параметр %1." #~ msgctxt "@info:shell %1 is cmdoption name" #~ msgid "'%1' missing." #~ msgstr "Отсутствует %1." #~ msgctxt "" #~ "@info:shell message on appcmd --version; do not translate 'Development " #~ "Platform'%3 application name, other %n version strings" #~ msgid "" #~ "Qt: %1\n" #~ "KDE Development Platform: %2\n" #~ "%3: %4\n" #~ msgstr "" #~ "Qt: %1\n" #~ "KDE: %2\n" #~ "%3: %4\n" #~ msgid "Unexpected argument '%1'." #~ msgstr "Недопустимый аргумент %1." #~ msgid "Use --help to get a list of available command line options." #~ msgstr "Используйте --help для вывода списка доступных параметров." #~ msgid "[options] " #~ msgstr "[параметры] " #~ msgid "[%1-options]" #~ msgstr "[параметры %1]" #~ msgid "Usage: %1 %2\n" #~ msgstr "Использование: %1 %2\n" #~ msgid "" #~ "\n" #~ "Generic options:\n" #~ msgstr "" #~ "\n" #~ "Общие параметры:\n" #~ msgid "Show help about options" #~ msgstr "Показать справку о параметрах" #~ msgid "Show %1 specific options" #~ msgstr "Показать специфические параметры %1" #~ msgid "Show all options" #~ msgstr "Показать список всех параметров" #~ msgid "Show version information" #~ msgstr "Показать сведения о версии" #~ msgid "End of options" #~ msgstr "Конец параметров" #~ msgid "" #~ "\n" #~ "%1 options:\n" #~ msgstr "" #~ "\n" #~ "Параметры %1:\n" #~ msgid "" #~ "\n" #~ "Options:\n" #~ msgstr "" #~ "\n" #~ "Параметры:\n" #~ msgid "" #~ "\n" #~ "Arguments:\n" #~ msgstr "" #~ "\n" #~ "Аргументы:\n" #~ msgid "The files/URLs opened by the application will be deleted after use" #~ msgstr "" #~ "Файлы или ссылки, открытые приложением, будут удалены после использования" #~ msgid "KDE-tempfile" #~ msgstr "KDE-tempfile" #~ msgid "Function must be called from the main thread." #~ msgstr "Функция должна быть вызвана из основного потока процесса." #~ msgid "" #~ "Error launching %1. Either KLauncher is not running anymore, or it failed " #~ "to start the application." #~ msgstr "" #~ "Не удалось запустить «%1». KLauncher либо не запущен, либо не смог " #~ "запустить приложение." #~ msgid "" #~ "KLauncher could not be reached via D-Bus. Error when calling %1:\n" #~ "%2\n" #~ msgstr "" #~ "KLauncher недоступен через D-Bus, ошибка вызова %1:\n" #~ "%2\n" #~ msgid "" #~ "Could not launch the KDE Help Center:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить Центр справки KDE:\n" #~ "\n" #~ "%1" #~ msgid "Could not Launch Help Center" #~ msgstr "Не удалось запустить Центр справки KDE" #~ msgid "" #~ "Could not launch the mail client:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить почтовый клиент:\n" #~ "\n" #~ "%1" #~ msgid "Could not launch Mail Client" #~ msgstr "Не удалось запустить почтовый клиент" #~ msgid "" #~ "Could not launch the browser:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить веб-браузер:\n" #~ "\n" #~ "%1" #~ msgid "Could not launch Browser" #~ msgstr "Не удалось запустить веб-браузер" #~ msgid "" #~ "Could not launch the terminal client:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить эмулятор терминала:\n" #~ "\n" #~ "%1" #~ msgid "Could not launch Terminal Client" #~ msgstr "Не удалось запустить эмулятор терминала" #~ msgctxt "@item Text character set" #~ msgid "Western European" #~ msgstr "Западная Европа" #~ msgctxt "@item Text character set" #~ msgid "Central European" #~ msgstr "Центральная Европа" #~ msgctxt "@item Text character set" #~ msgid "Baltic" #~ msgstr "Прибалтийское письмо" #~ msgctxt "@item Text character set" #~ msgid "South-Eastern Europe" #~ msgstr "Юго-восточная Европа" #~ msgctxt "@item Text character set" #~ msgid "Turkish" #~ msgstr "Турецкое письмо" #~ msgctxt "@item Text character set" #~ msgid "Cyrillic" #~ msgstr "Кириллица" # Здесь речь идёт не о локали, а о наборе символов. В случае локали перевод "Китайский (Тайвань)", т.к. локаль zh_TW. #~ msgctxt "@item Text character set" #~ msgid "Chinese Traditional" #~ msgstr "Китайское письмо (традиционное)" #~ msgctxt "@item Text character set" #~ msgid "Chinese Simplified" #~ msgstr "Китайское письмо (упрощённое)" #~ msgctxt "@item Text character set" #~ msgid "Korean" #~ msgstr "Корейское письмо" #~ msgctxt "@item Text character set" #~ msgid "Japanese" #~ msgstr "Японское письмо" #~ msgctxt "@item Text character set" #~ msgid "Greek" #~ msgstr "Греческое письмо" #~ msgctxt "@item Text character set" #~ msgid "Arabic" #~ msgstr "Арабское письмо" #~ msgctxt "@item Text character set" #~ msgid "Hebrew" #~ msgstr "Иврит" #~ msgctxt "@item Text character set" #~ msgid "Unicode" #~ msgstr "Юникод" #~ msgctxt "@item Text character set" #~ msgid "Northern Saami" #~ msgstr "Северносаамский" #~ msgctxt "@item Text character set" #~ msgid "Other" #~ msgstr "Другие" #~ msgctxt "@item %1 character set, %2 encoding" #~ msgid "%1 ( %2 )" #~ msgstr "%1 (%2)" #~ msgctxt "@item" #~ msgid "Other encoding (%1)" #~ msgstr "Другая кодировка (%1)" #~ msgctxt "@item Text encoding: %1 character set, %2 encoding" #~ msgid "%1 ( %2 )" #~ msgstr "%1 (%2)" #~ msgctxt "@item Text character set" #~ msgid "Disabled" #~ msgstr "Отключена" #~ msgctxt "@item Text character set" #~ msgid "Universal" #~ msgstr "Универсальная" #~ msgctxt "digit set" #~ msgid "Arabic-Indic" #~ msgstr "Арабские цифры, используемые в арабских странах" #~ msgctxt "digit set" #~ msgid "Bengali" #~ msgstr "Бенгальские цифры" #~ msgctxt "digit set" #~ msgid "Devanagari" #~ msgstr "Деванагари" #~ msgctxt "digit set" #~ msgid "Eastern Arabic-Indic" #~ msgstr "Персидские цифры" #~ msgctxt "digit set" #~ msgid "Gujarati" #~ msgstr "Цифры гуджарати" #~ msgctxt "digit set" #~ msgid "Gurmukhi" #~ msgstr "Цифры гурмукхи" #~ msgctxt "digit set" #~ msgid "Kannada" #~ msgstr "Цифры каннада" #~ msgctxt "digit set" #~ msgid "Khmer" #~ msgstr "Кхмерские цифры" #~ msgctxt "digit set" #~ msgid "Malayalam" #~ msgstr "Цифры малаялам" #~ msgctxt "digit set" #~ msgid "Oriya" #~ msgstr "Цифры ория" #~ msgctxt "digit set" #~ msgid "Tamil" #~ msgstr "Тамильские цифры" #~ msgctxt "digit set" #~ msgid "Telugu" #~ msgstr "Цифры телугу" #~ msgctxt "digit set" #~ msgid "Thai" #~ msgstr "Тайские цифры" #~ msgctxt "digit set" #~ msgid "Arabic" #~ msgstr "Арабские цифры" #~ msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" #~ msgid "%1 (%2)" #~ msgstr "%1 (%2)" #~ msgctxt "memory size in 2^20 bytes" #~ msgid "%1 MB" #~ msgstr "%1 МБ" #~ msgctxt "memory size in 2^30 bytes" #~ msgid "%1 GB" #~ msgstr "%1 ГБ" #~ msgctxt "memory size in 2^40 bytes" #~ msgid "%1 TB" #~ msgstr "%1 ТБ" #~ msgctxt "memory size in 2^50 bytes" #~ msgid "%1 PB" #~ msgstr "%1 ПБ" #~ msgctxt "memory size in 2^60 bytes" #~ msgid "%1 EB" #~ msgstr "%1 ЭБ" #~ msgctxt "memory size in 2^70 bytes" #~ msgid "%1 ZB" #~ msgstr "%1 ЗБ" #~ msgctxt "memory size in 2^80 bytes" #~ msgid "%1 YB" #~ msgstr "%1 ЙБ" #~ msgctxt "@item:intext" #~ msgid "1 day" #~ msgid_plural "%1 days" #~ msgstr[0] "%1 день" #~ msgstr[1] "%1 дня" #~ msgstr[2] "%1 дней" #~ msgstr[3] "%1 день" #~ msgctxt "@item:intext" #~ msgid "1 hour" #~ msgid_plural "%1 hours" #~ msgstr[0] "%1 час" #~ msgstr[1] "%1 часа" #~ msgstr[2] "%1 часов" #~ msgstr[3] "%1 час" #~ msgctxt "@item:intext" #~ msgid "1 minute" #~ msgid_plural "%1 minutes" #~ msgstr[0] "%1 минута" #~ msgstr[1] "%1 минуты" #~ msgstr[2] "%1 минут" #~ msgstr[3] "%1 минута" #~ msgctxt "@item:intext" #~ msgid "1 second" #~ msgid_plural "%1 seconds" #~ msgstr[0] "%1 секунда" #~ msgstr[1] "%1 секунды" #~ msgstr[2] "%1 секунд" #~ msgstr[3] "%1 секунда" #~ msgctxt "" #~ "@item:intext hours and minutes. This uses the previous item:intext " #~ "messages. If this does not fit the grammar of your language please " #~ "contact the i18n team to solve the problem" #~ msgid "%1 and %2" #~ msgstr "%1 %2" #~ msgctxt "" #~ "@item:intext minutes and seconds. This uses the previous item:intext " #~ "messages. If this does not fit the grammar of your language please " #~ "contact the i18n team to solve the problem" #~ msgid "%1 and %2" #~ msgstr "%1 %2" #~ msgctxt "Before Noon KLocale::LongName" #~ msgid "Ante Meridiem" #~ msgstr "до полудня" #~ msgctxt "Before Noon KLocale::NarrowName" #~ msgid "A" #~ msgstr "A" #~ msgctxt "After Noon KLocale::LongName" #~ msgid "Post Meridiem" #~ msgstr "после полудня" #~ msgctxt "After Noon KLocale::ShortName" #~ msgid "PM" #~ msgstr "PM" #~ msgctxt "concatenation of date/time and time zone" #~ msgid "%1 %2" #~ msgstr "%1 %2" #~ msgctxt "@title/plain" #~ msgid "== %1 ==" #~ msgstr "== %1 ==" #~ msgctxt "@title/rich" #~ msgid "

%1

" #~ msgstr "

%1

" #~ msgctxt "@subtitle/plain" #~ msgid "~ %1 ~" #~ msgstr "~ %1 ~" #~ msgctxt "@subtitle/rich" #~ msgid "

%1

" #~ msgstr "

%1

" #~ msgctxt "@item/plain" #~ msgid " * %1" #~ msgstr " * %1" #~ msgctxt "@item/rich" #~ msgid "
  • %1
    • " #~ msgstr "
  • %1
    • " #~ msgctxt "@note/plain" #~ msgid "Note: %1" #~ msgstr "Примечание: %1" #~ msgctxt "@note/rich" #~ msgid "Note: %1" #~ msgstr "Примечание: %1" #~ msgctxt "" #~ "@note-with-label/plain\n" #~ "%1 is the note label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "" #~ "@note-with-label/rich\n" #~ "%1 is the note label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "@warning/plain" #~ msgid "WARNING: %1" #~ msgstr "Внимание: %1" #~ msgctxt "@warning/rich" #~ msgid "Warning: %1" #~ msgstr "Внимание: %1" #~ msgctxt "" #~ "@warning-with-label/plain\n" #~ "%1 is the warning label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "" #~ "@warning-with-label/rich\n" #~ "%1 is the warning label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "" #~ "@link-with-description/plain\n" #~ "%1 is the URL, %2 is the descriptive text" #~ msgid "%2 (%1)" #~ msgstr "%2 (%1)" #~ msgctxt "" #~ "@link-with-description/rich\n" #~ "%1 is the URL, %2 is the descriptive text" #~ msgid "%2" #~ msgstr "%2" #~ msgctxt "@filename/plain" #~ msgid "‘%1’" #~ msgstr "«%1»" #~ msgctxt "@filename/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@application/plain" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@application/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@command/plain" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@command/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "" #~ "@command-with-section/plain\n" #~ "%1 is the command name, %2 is its man section" #~ msgid "%1(%2)" #~ msgstr "%1(%2)" #~ msgctxt "" #~ "@command-with-section/rich\n" #~ "%1 is the command name, %2 is its man section" #~ msgid "%1(%2)" #~ msgstr "%1(%2)" #~ msgctxt "@resource/plain" #~ msgid "“%1”" #~ msgstr "«%1»" #~ msgctxt "@resource/rich" #~ msgid "“%1”" #~ msgstr "«%1»" #~ msgctxt "@icode/plain" #~ msgid "“%1”" #~ msgstr "«%1»" #~ msgctxt "@icode/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@shortcut/plain" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@shortcut/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@interface/plain" #~ msgid "|%1|" #~ msgstr "|%1|" #~ msgctxt "@interface/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@emphasis/plain" #~ msgid "*%1*" #~ msgstr "*%1*" #~ msgctxt "@emphasis/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@emphasis-strong/plain" #~ msgid "**%1**" #~ msgstr "**%1**" #~ msgctxt "@emphasis-strong/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@placeholder/plain" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "@placeholder/rich" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "@email/plain" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "@email/rich" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "" #~ "@email-with-name/plain\n" #~ "%1 is name, %2 is address" #~ msgid "%1 <%2>" #~ msgstr "%1 <%2>" #~ msgctxt "" #~ "@email-with-name/rich\n" #~ "%1 is name, %2 is address" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@envar/plain" #~ msgid "$%1" #~ msgstr "$%1" #~ msgctxt "@envar/rich" #~ msgid "$%1" #~ msgstr "$%1" #~ msgctxt "@message/plain" #~ msgid "/%1/" #~ msgstr "/%1/" #~ msgctxt "@message/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "shortcut-key-delimiter/plain" #~ msgid "+" #~ msgstr "+" #~ msgctxt "shortcut-key-delimiter/rich" #~ msgid "+" #~ msgstr "+" #~ msgctxt "gui-path-delimiter/plain" #~ msgid "→" #~ msgstr "➤" #~ msgctxt "gui-path-delimiter/rich" #~ msgid "→" #~ msgstr "➤" #~ msgctxt "keyboard-key-name" #~ msgid "Alt" #~ msgstr "Alt" #~ msgctxt "keyboard-key-name" #~ msgid "AltGr" #~ msgstr "AltGr" #~ msgctxt "keyboard-key-name" #~ msgid "Backspace" #~ msgstr "Backspace" #~ msgctxt "keyboard-key-name" #~ msgid "CapsLock" #~ msgstr "CapsLock" #~ msgctxt "keyboard-key-name" #~ msgid "Control" #~ msgstr "Control" #~ msgctxt "keyboard-key-name" #~ msgid "Ctrl" #~ msgstr "Ctrl" #~ msgctxt "keyboard-key-name" #~ msgid "Del" #~ msgstr "Del" #~ msgctxt "keyboard-key-name" #~ msgid "Delete" #~ msgstr "Delete" #~ msgctxt "keyboard-key-name" #~ msgid "Down" #~ msgstr "Стрелка вниз" #~ msgctxt "keyboard-key-name" #~ msgid "End" #~ msgstr "End" #~ msgctxt "keyboard-key-name" #~ msgid "Enter" #~ msgstr "Enter" #~ msgctxt "keyboard-key-name" #~ msgid "Esc" #~ msgstr "Esc" #~ msgctxt "keyboard-key-name" #~ msgid "Escape" #~ msgstr "Escape" #~ msgctxt "keyboard-key-name" #~ msgid "Home" #~ msgstr "Home" #~ msgctxt "keyboard-key-name" #~ msgid "Hyper" #~ msgstr "Hyper" #~ msgctxt "keyboard-key-name" #~ msgid "Ins" #~ msgstr "Ins" #~ msgctxt "keyboard-key-name" #~ msgid "Insert" #~ msgstr "Insert" #~ msgctxt "keyboard-key-name" #~ msgid "Left" #~ msgstr "Стрелка влево" #~ msgctxt "keyboard-key-name" #~ msgid "Menu" #~ msgstr "Menu" #~ msgctxt "keyboard-key-name" #~ msgid "Meta" #~ msgstr "Meta" #~ msgctxt "keyboard-key-name" #~ msgid "NumLock" #~ msgstr "NumLock" #~ msgctxt "keyboard-key-name" #~ msgid "PageDown" #~ msgstr "PageDown" #~ msgctxt "keyboard-key-name" #~ msgid "PageUp" #~ msgstr "PageUp" #~ msgctxt "keyboard-key-name" #~ msgid "PgDown" #~ msgstr "PgDown" #~ msgctxt "keyboard-key-name" #~ msgid "PgUp" #~ msgstr "PgUp" #~ msgctxt "keyboard-key-name" #~ msgid "PauseBreak" #~ msgstr "PauseBreak" #~ msgctxt "keyboard-key-name" #~ msgid "PrintScreen" #~ msgstr "PrintScreen" #~ msgctxt "keyboard-key-name" #~ msgid "PrtScr" #~ msgstr "PrtScr" #~ msgctxt "keyboard-key-name" #~ msgid "Return" #~ msgstr "Return" #~ msgctxt "keyboard-key-name" #~ msgid "Right" #~ msgstr "Стрелка вправо" #~ msgctxt "keyboard-key-name" #~ msgid "ScrollLock" #~ msgstr "ScrollLock" #~ msgctxt "keyboard-key-name" #~ msgid "Shift" #~ msgstr "Shift" #~ msgctxt "keyboard-key-name" #~ msgid "Space" #~ msgstr "Пробел" #~ msgctxt "keyboard-key-name" #~ msgid "Super" #~ msgstr "Super" #~ msgctxt "keyboard-key-name" #~ msgid "SysReq" #~ msgstr "SysReq" #~ msgctxt "keyboard-key-name" #~ msgid "Tab" #~ msgstr "Tab" #~ msgctxt "keyboard-key-name" #~ msgid "Up" #~ msgstr "Стрелка вверх" #~ msgctxt "keyboard-key-name" #~ msgid "Win" #~ msgstr "Win" #~ msgctxt "keyboard-key-name" #~ msgid "F%1" #~ msgstr "F%1" #~ msgid "no error" #~ msgstr "нет ошибки" #~ msgid "requested family not supported for this host name" #~ msgstr "Для указанного имени сервера требуемое семейство не поддерживается" #~ msgid "temporary failure in name resolution" #~ msgstr "временный сбой разрешения имён" #~ msgid "non-recoverable failure in name resolution" #~ msgstr "фатальный сбой разрешения имён" #~ msgid "invalid flags" #~ msgstr "неверные флаги" #~ msgid "memory allocation failure" #~ msgstr "ошибка выделения памяти" #~ msgid "name or service not known" #~ msgstr "неизвестное имя или сервис" #~ msgid "requested family not supported" #~ msgstr "запрошенное семейство не поддерживается" #~ msgid "requested service not supported for this socket type" #~ msgstr "запрошенный сервис не поддерживается этим типом сокета" #~ msgid "requested socket type not supported" #~ msgstr "запрошенный тип сокета не поддерживается" #~ msgid "unknown error" #~ msgstr "неизвестная ошибка" #~ msgctxt "1: the i18n'ed system error code, from errno" #~ msgid "system error: %1" #~ msgstr "системная ошибка: %1" #~ msgid "request was canceled" #~ msgstr "запрос отменён" #~ msgctxt "1: the unknown socket address family number" #~ msgid "Unknown family %1" #~ msgstr "Неизвестная гарнитура %1" #~ msgctxt "Socket error code NoError" #~ msgid "no error" #~ msgstr "нет ошибки" #~ msgctxt "Socket error code LookupFailure" #~ msgid "name lookup has failed" #~ msgstr "ошибка разрешения имени" #~ msgctxt "Socket error code AddressInUse" #~ msgid "address already in use" #~ msgstr "адрес уже используется" #~ msgctxt "Socket error code AlreadyBound" #~ msgid "socket is already bound" #~ msgstr "сокет уже связан с адресом и портом" #~ msgctxt "Socket error code AlreadyCreated" #~ msgid "socket is already created" #~ msgstr "сокет уже создан" #~ msgctxt "Socket error code NotBound" #~ msgid "socket is not bound" #~ msgstr "сокет свободен" #~ msgctxt "Socket error code NotCreated" #~ msgid "socket has not been created" #~ msgstr "сокет не создан" #~ msgctxt "Socket error code WouldBlock" #~ msgid "operation would block" #~ msgstr "операция привела бы к блокировке" #~ msgctxt "Socket error code ConnectionRefused" #~ msgid "connection actively refused" #~ msgstr "соединение отвергнуто" #~ msgctxt "Socket error code ConnectionTimedOut" #~ msgid "connection timed out" #~ msgstr "время ожидания соединения истекло" #~ msgctxt "Socket error code InProgress" #~ msgid "operation is already in progress" #~ msgstr "операция уже выполняется" #~ msgctxt "Socket error code NetFailure" #~ msgid "network failure occurred" #~ msgstr "сбой сети" #~ msgctxt "Socket error code NotSupported" #~ msgid "operation is not supported" #~ msgstr "операция не поддерживается" #~ msgctxt "Socket error code Timeout" #~ msgid "timed operation timed out" #~ msgstr "истекло время ожидания операции" #~ msgctxt "Socket error code UnknownError" #~ msgid "an unknown/unexpected error has happened" #~ msgstr "неизвестная или непредвиденная ошибка" #~ msgctxt "Socket error code RemotelyDisconnected" #~ msgid "remote host closed connection" #~ msgstr "Удалённый узел закрыл соединение" #~ msgid "NEC SOCKS client" #~ msgstr "Клиент NEC SOCKS" #~ msgid "Dante SOCKS client" #~ msgstr "Клиент Dante SOCKS" #~ msgid "Specified socket path is invalid" #~ msgstr "Указан неверный путь к сокету" #~ msgid "The socket operation is not supported" #~ msgstr "Операция с сокетом не поддерживается" #~ msgid "Connection refused" #~ msgstr "Соединение отвергнуто" #~ msgid "Permission denied" #~ msgstr "Нет доступа" #~ msgid "Connection timed out" #~ msgstr "Время ожидания соединения истекло" #~ msgid "Unknown error" #~ msgstr "Неизвестная ошибка" #~ msgid "Could not set non-blocking mode" #~ msgstr "Не удалось установить неблокирующий режим" #~ msgid "Address is already in use" #~ msgstr "Адрес уже используется" #~ msgid "Path cannot be used" #~ msgstr "Невозможно использовать путь" #~ msgid "No such file or directory" #~ msgstr "Файл или папка не найдены" #~ msgid "Not a directory" #~ msgstr "Не папка" #~ msgid "Read-only filesystem" #~ msgstr "Файловая система доступна только для чтения" #~ msgid "Unknown socket error" #~ msgstr "Неизвестная ошибка сокета" #~ msgid "Operation not supported" #~ msgstr "Операция не поддерживается" #~ msgid "Timed out trying to connect to remote host" #~ msgstr "Истекло время ожидания ответа от удалённого узла" #~ msgctxt "SSL error" #~ msgid "No error" #~ msgstr "Нет ошибки" #~ msgctxt "SSL error" #~ msgid "The certificate authority's certificate is invalid" #~ msgstr "Неверный сертификат у удостоверяющего центра." #~ msgctxt "SSL error" #~ msgid "The certificate has expired" #~ msgstr "Срок действия сертификата истёк." #~ msgctxt "SSL error" #~ msgid "The certificate is invalid" #~ msgstr "Сертификат недействителен" #~ msgctxt "SSL error" #~ msgid "The certificate is not signed by any trusted certificate authority" #~ msgstr "" #~ "Сертификат не подписан ни одним из доверенных удостоверяющих центров" #~ msgctxt "SSL error" #~ msgid "The certificate has been revoked" #~ msgstr "Сертификат был отозван" #~ msgctxt "SSL error" #~ msgid "The certificate is unsuitable for this purpose" #~ msgstr "Сертификат не подходит для выбранной области применения" #~ msgctxt "SSL error" #~ msgid "" #~ "The root certificate authority's certificate is not trusted for this " #~ "purpose" #~ msgstr "" #~ "Сертификат корневого удостоверяющего центра не может быть доверенным для " #~ "этого применения" #~ msgctxt "SSL error" #~ msgid "" #~ "The certificate authority's certificate is marked to reject this " #~ "certificate's purpose" #~ msgstr "" #~ "Сертификат корневого удостоверяющего центра недействителен для этого " #~ "применения" #~ msgctxt "SSL error" #~ msgid "The peer did not present any certificate" #~ msgstr "Подключение без сертификата" #~ msgctxt "SSL error" #~ msgid "The certificate does not apply to the given host" #~ msgstr "Сертификат не применим к этому узлу" #~ msgctxt "SSL error" #~ msgid "The certificate cannot be verified for internal reasons" #~ msgstr "Сертификат не может быть проверен по внутренним причинам" #~ msgctxt "SSL error" #~ msgid "The certificate chain is too long" #~ msgstr "Цепочка сертификатов слишком длинная" #~ msgctxt "SSL error" #~ msgid "Unknown error" #~ msgstr "Неизвестная ошибка" #~ msgid "address family for nodename not supported" #~ msgstr "семейство адресов для не поддерживается для данного nodename" #~ msgid "invalid value for 'ai_flags'" #~ msgstr "неверное значение для «ai_flags»" #~ msgid "'ai_family' not supported" #~ msgstr "семейство «ai_family» не поддерживается" #~ msgid "no address associated with nodename" #~ msgstr "с данным узлом (nodename) не связан никакой адрес" #~ msgid "servname not supported for ai_socktype" #~ msgstr "servname не поддерживается для типа ai_socktype" #~ msgid "'ai_socktype' not supported" #~ msgstr "тип «ai_socktype» не поддерживается" #~ msgid "system error" #~ msgstr "системная ошибка" #~ msgid "Could not find mime type %2" #~ msgid_plural "" #~ "Could not find mime types:\n" #~ "%2" #~ msgstr[0] "Не удалось найти типы MIME %2" #~ msgstr[1] "Не удалось найти типы MIME %2" #~ msgstr[2] "Не удалось найти типы MIME %2" #~ msgstr[3] "Не удалось найти тип MIME %2" #~ msgid "" #~ "No mime types installed. Check that shared-mime-info is installed, and " #~ "that XDG_DATA_DIRS is not set, or includes /usr/share." #~ msgstr "" #~ "Не установлены типы MIME. Проверьте установку пакета shared-mime-info и " #~ "состояние переменной окружения XDG_DATA_DIRS. Она должна быть либо не " #~ "установлена, либо должна включать /usr/share." #~ msgid "No service matching the requirements was found" #~ msgstr "Служба, соответствующая требованиям, не найдена" # BUGME: ". " at the end is necessary, otherwise the next sentence goes without space or full stop. --aspotashev #~ msgid "" #~ "The service '%1' does not provide an interface '%2' with keyword '%3'" #~ msgstr "" #~ "Служба «%1» не предоставляет интерфейс «%2» с ключевыми словами «%3». " #~ msgctxt "dictionary variant" #~ msgid "40" #~ msgstr "40" #~ msgctxt "dictionary variant" #~ msgid "60" #~ msgstr "60" #~ msgctxt "dictionary variant" #~ msgid "80" #~ msgstr "80" #~ msgctxt "dictionary variant" #~ msgid "-ise suffixes" #~ msgstr "суффиксы -ise" #~ msgctxt "dictionary variant" #~ msgid "-ize suffixes" #~ msgstr "суффиксы -ize" #~ msgctxt "dictionary variant" #~ msgid "-ise suffixes and with accents" #~ msgstr "суффиксы -ise и буквы с акцентом" #~ msgctxt "dictionary variant" #~ msgid "-ise suffixes and without accents" #~ msgstr "суффиксы -ise и буквы без акцента" #~ msgctxt "dictionary variant" #~ msgid "-ize suffixes and with accents" #~ msgstr "суффиксы -ize и буквы с акцентом" #~ msgctxt "dictionary variant" #~ msgid "-ize suffixes and without accents" #~ msgstr "суффиксы -ize и буквы без акцента" #~ msgctxt "dictionary variant" #~ msgid "large" #~ msgstr "большой" #~ msgctxt "dictionary variant" #~ msgid "medium" #~ msgstr "средний" #~ msgctxt "dictionary variant" #~ msgid "small" #~ msgstr "малый" #~ msgctxt "dictionary variant" #~ msgid "variant 0" #~ msgstr "вариант 0" #~ msgctxt "dictionary variant" #~ msgid "variant 1" #~ msgstr "вариант 1" #~ msgctxt "dictionary variant" #~ msgid "variant 2" #~ msgstr "вариант 2" #~ msgctxt "dictionary variant" #~ msgid "without accents" #~ msgstr "буквы без акцента" #~ msgctxt "dictionary variant" #~ msgid "with accents" #~ msgstr "буквы с акцентом" #~ msgctxt "dictionary variant" #~ msgid "with ye" #~ msgstr "только с вариантами написания через «е»" #~ msgctxt "dictionary variant" #~ msgid "with yeyo" #~ msgstr "с вариантами написания через «е» и «ё»" #~ msgctxt "dictionary variant" #~ msgid "with yo" #~ msgstr "только с вариантами написания через «ё»" #~ msgctxt "dictionary variant" #~ msgid "extended" #~ msgstr "расширенный" #~ msgctxt "dictionary name. %1-language, %2-country and %3 variant name" #~ msgid "%1 (%2) [%3]" #~ msgstr "%1 (%2) [%3]" #~ msgctxt "dictionary name. %1-language and %2-country name" #~ msgid "%1 (%2)" #~ msgstr "%1 (%2)" #~ msgctxt "dictionary name. %1-language and %2-variant name" #~ msgid "%1 [%2]" #~ msgstr "%1 [%2]" #~ msgid "File %1 does not exist" #~ msgstr "Файл %1 не существует" #~ msgid "Cannot open %1 for reading" #~ msgstr "Не удалось открыть %1 для чтения" #~ msgid "Cannot create memory segment for file %1" #~ msgstr "Не удалось выделить область памяти для файла %1" #~ msgid "Could not read data from %1 into shm" #~ msgstr "Не удалось прочитать данные из %1 в shm" #~ msgid "Only 'ReadOnly' allowed" #~ msgstr "Допускается только для чтения (ReadOnly)" #~ msgid "Cannot seek past eof" #~ msgstr "Сдвиг после конца файла невозможен" #~ msgid "Library \"%1\" not found" #~ msgstr "Библиотека «%1» не найдена" #~ msgid "No service matching the requirements was found." #~ msgstr "Нет службы, соответствующей требованиям." #~ msgid "" #~ "The service provides no library, the Library key is missing in the ." #~ "desktop file." #~ msgstr "" #~ "Служба не предоставляет библиотеку, нет записи «Library» в файле .desktop." #~ msgid "The library does not export a factory for creating components." #~ msgstr "Библиотека не предоставляет механизм создания компонентов." #~ msgid "" #~ "The factory does not support creating components of the specified type." #~ msgstr "Фабрика не поддерживает создание компонентов указанного типа." #~ msgid "KLibLoader: Unknown error" #~ msgstr "Неизвестная ошибка KLibLoader" #~ msgid "The provided service is not valid" #~ msgstr "Указана недопустимая служба" #~ msgid "The service '%1' provides no library or the Library key is missing" #~ msgstr "Служба «%1» не предоставляет библиотеку или нет записи «Library»" #~ msgid "The plugin '%1' uses an incompatible KDE library (%2)." #~ msgstr "Расширение «%1» использует несовместимую библиотеку KDE (%2)." #~ msgid "KDE Test Program" #~ msgstr "Тестовая программа KDE" #~ msgid "KBuildSycoca" #~ msgstr "KBuildSycoca" #~ msgid "Rebuilds the system configuration cache." #~ msgstr "Повторное создание кэша системной конфигурации." #~ msgid "(c) 1999-2002 KDE Developers" #~ msgstr "© Разработчики KDE, 1999-2002" #~ msgid "David Faure" #~ msgstr "David Faure" #~ msgid "Do not signal applications to update" #~ msgstr "Не посылать сигнал приложениям для обновления" #~ msgid "Disable incremental update, re-read everything" #~ msgstr "Отключить инкрементное обновление, перечитать все" #~ msgid "Check file timestamps" #~ msgstr "Проверять время изменения файлов" #~ msgid "Disable checking files (dangerous)" #~ msgstr "Отключить проверку файлов (опасно)" #~ msgid "Create global database" #~ msgstr "Создать глобальную базу" #~ msgid "Perform menu generation test run only" #~ msgstr "Выполнить только тест генерации меню" #~ msgid "Track menu id for debug purposes" #~ msgstr "Отслеживать идентификатор меню для отладки" #~ msgid "KDE Daemon" #~ msgstr "Служба KDE" #~ msgid "KDE Daemon - triggers Sycoca database updates when needed" #~ msgstr "" #~ "Служба KDE - запускает обновление базы данных Sycoca по необходимости" #~ msgid "Check Sycoca database only once" #~ msgstr "Проверять базу данных Sycoca только один раз" #~ msgid "" #~ "The key sequence '%1' is ambiguous. Use 'Configure Shortcuts'\n" #~ "from the 'Settings' menu to solve the ambiguity.\n" #~ "No action will be triggered." #~ msgstr "" #~ "Конфликт действий на комбинации клавиш «%1». Используйте пункт \n" #~ "«Комбинации клавиш» меню «Настройка» чтобы исправить конфликт.\n" #~ "Не выполнено ни одно из конфликтующих действий." #~ msgid "Ambiguous shortcut detected" #~ msgstr "Конфликт действий" #~ msgctxt "Encodings menu" #~ msgid "Default" #~ msgstr "По умолчанию" #~ msgctxt "Encodings menu" #~ msgid "Autodetect" #~ msgstr "Автоматическое определение" #~ msgid "No Entries" #~ msgstr "Нет записей" #~ msgid "Clear List" #~ msgstr "Очистить список" #~ msgctxt "go back" #~ msgid "&Back" #~ msgstr "&Назад" #~ msgctxt "go forward" #~ msgid "&Forward" #~ msgstr "&Вперёд" #~ msgctxt "home page" #~ msgid "&Home" #~ msgstr "&Домой" #~ msgctxt "show help" #~ msgid "&Help" #~ msgstr "&Справка" #~ msgid "Show &Menubar" #~ msgstr "Показать &меню" #~ msgid "Show Menubar

    Shows the menubar again after it has been hidden

    " #~ msgstr "" #~ "Показать меню

    Показать меню снова после того, как оно было скрыто

    " #~ msgid "Show St&atusbar" #~ msgstr "Показать строку &состояния" # BUGME: whatsthis on "Hide Statusbar" should be about "Hide Statusbar", not "Show Statusbar" #~ msgid "" #~ "Show Statusbar

    Shows the statusbar, which is the bar at the bottom of " #~ "the window used for status information.

    " #~ msgstr "" #~ "Показать строку состояния

    Строка состояния — это полоса в нижней части " #~ "окна, в которой выводится информация о состоянии приложения.

    " #~ msgid "&New" #~ msgstr "Созд&ать" #~ msgid "Create new document" #~ msgstr "Создать новый документ" #~ msgid "&Open..." #~ msgstr "&Открыть..." #~ msgid "Open an existing document" #~ msgstr "Открыть существующий документ" #~ msgid "Open &Recent" #~ msgstr "По&следние файлы" #~ msgid "Open a document which was recently opened" #~ msgstr "Открыть документ, который уже был недавно открыт" #~ msgid "&Save" #~ msgstr "&Сохранить" #~ msgid "Save document" #~ msgstr "Сохранить документ" #~ msgid "Save &As..." #~ msgstr "Сохранить &как..." #~ msgid "Save document under a new name" #~ msgstr "Сохранить документ под новым именем" #~ msgid "Re&vert" #~ msgstr "&Восстановить" #~ msgid "Revert unsaved changes made to document" #~ msgstr "Восстановить несохранённые изменения, внесённые в документ" #~ msgid "&Close" #~ msgstr "&Закрыть" #~ msgid "Close document" #~ msgstr "Закрыть документ" #~ msgid "&Print..." #~ msgstr "Пе&чать..." #~ msgid "Print document" #~ msgstr "Печать документа" #~ msgid "Print Previe&w" #~ msgstr "Пред&варительный просмотр" #~ msgid "Show a print preview of document" #~ msgstr "Показать предварительный просмотр документа" #~ msgid "&Mail..." #~ msgstr "Отправить по &почте..." #~ msgid "Send document by mail" #~ msgstr "Отправить документ по электронной почте" #~ msgid "&Quit" #~ msgstr "В&ыход" #~ msgid "Quit application" #~ msgstr "Выйти из приложения" #~ msgid "Undo last action" #~ msgstr "Отменить последнее действие" #~ msgid "Re&do" #~ msgstr "&Повторить" #~ msgid "Redo last undone action" #~ msgstr "Повторить последнее отменённое действие" #~ msgid "Cu&t" #~ msgstr "Вы&резать" #~ msgid "Cut selection to clipboard" #~ msgstr "Вырезать выбранное в буфер обмена" #~ msgid "&Copy" #~ msgstr "&Копировать" #~ msgid "Copy selection to clipboard" #~ msgstr "Скопировать выбранное в буфер обмена" #~ msgid "&Paste" #~ msgstr "&Вставить" #~ msgid "Paste clipboard content" #~ msgstr "Вставить содержимое буфера обмена" #~ msgid "C&lear" #~ msgstr "О&чистить" #~ msgid "Select &All" #~ msgstr "Вы&делить все" #~ msgid "Dese&lect" #~ msgstr "С&нять выделение" #~ msgid "&Find..." #~ msgstr "&Найти..." #~ msgid "Find &Next" #~ msgstr "П&родолжить поиск" #~ msgid "Find Pre&vious" #~ msgstr "Найти пред&ыдущее" #~ msgid "&Replace..." #~ msgstr "&Заменить..." #~ msgid "&Actual Size" #~ msgstr "&Фактический размер" #~ msgid "View document at its actual size" #~ msgstr "Просмотр документа в его фактическом размере" #~ msgid "&Fit to Page" #~ msgstr "&Вместить страницу целиком" #~ msgid "Zoom to fit page in window" #~ msgstr "Изменить масштаб, чтобы вместить страницу целиком в окно" #~ msgid "Fit to Page &Width" #~ msgstr "По &ширине страницы" #~ msgid "Zoom to fit page width in window" #~ msgstr "Изменить масштаб, чтобы вместить всю ширину страницы" #~ msgid "Fit to Page &Height" #~ msgstr "По &высоте страницы" #~ msgid "Zoom to fit page height in window" #~ msgstr "Изменить масштаб, чтобы вместить всю высоту страницы" #~ msgid "Zoom &In" #~ msgstr "У&величить" #~ msgid "Zoom &Out" #~ msgstr "У&меньшить" #~ msgid "&Zoom..." #~ msgstr "&Масштаб..." #~ msgid "Select zoom level" #~ msgstr "Выбор масштаба" #~ msgid "&Redisplay" #~ msgstr "Обно&вить изображение" #~ msgid "Redisplay document" #~ msgstr "Обновить документ" #~ msgid "&Up" #~ msgstr "Ввер&х" #~ msgid "Go up" #~ msgstr "Перейти вверх" #~ msgid "&Previous Page" #~ msgstr "&Предыдущая страница" #~ msgid "Go to previous page" #~ msgstr "Перейти на предыдущую страницу" #~ msgid "&Next Page" #~ msgstr "&Следующая страница" #~ msgid "Go to next page" #~ msgstr "Перейти на следующую страницу" #~ msgid "&Go To..." #~ msgstr "&Перейти..." #~ msgid "&Go to Page..." #~ msgstr "Перейти на ст&раницу..." #~ msgid "&Go to Line..." #~ msgstr "&Перейти на строку..." #~ msgid "&First Page" #~ msgstr "Перв&ая страница" #~ msgid "Go to first page" #~ msgstr "Перейти на первую страницу" #~ msgid "&Last Page" #~ msgstr "Последня&я страница" #~ msgid "Go to last page" #~ msgstr "Перейти на последнюю страницу" #~ msgid "Go back in document" #~ msgstr "Назад по документу" #~ msgid "&Forward" #~ msgstr "&Вперёд" #~ msgid "Go forward in document" #~ msgstr "Вперёд по документу" #~ msgid "&Add Bookmark" #~ msgstr "Добавить &закладку" #~ msgid "&Edit Bookmarks..." #~ msgstr "&Изменить закладки..." #~ msgid "&Spelling..." #~ msgstr "&Проверка орфографии..." #~ msgid "Check spelling in document" #~ msgstr "Проверить орфографию в документе" #~ msgid "Show or hide menubar" #~ msgstr "Показать или скрыть меню" #~ msgid "Show &Toolbar" #~ msgstr "Показать панель &инструментов" #~ msgid "Show or hide toolbar" #~ msgstr "Показать или скрыть панель инструментов" #~ msgid "Show or hide statusbar" #~ msgstr "Показать или скрыть строку состояния" #~ msgid "F&ull Screen Mode" #~ msgstr "&Полноэкранный режим" #~ msgid "&Save Settings" #~ msgstr "&Сохранить параметры" #~ msgid "Configure S&hortcuts..." #~ msgstr "&Комбинации клавиш..." #~ msgid "&Configure %1..." #~ msgstr "&Настроить %1..." #~ msgid "Configure Tool&bars..." #~ msgstr "Панели &инструментов..." #~ msgid "Configure &Notifications..." #~ msgstr "Настроить &уведомления..." #~ msgid "%1 &Handbook" #~ msgstr "&Руководство пользователя %1" #~ msgid "What's &This?" #~ msgstr "Что &это?" #~ msgid "Tip of the &Day" #~ msgstr "Совет &дня" #~ msgid "&Report Bug..." #~ msgstr "Сооб&щить об ошибке..." #~ msgid "Switch Application &Language..." #~ msgstr "Сменить &язык интерфейса приложения..." #~ msgid "&About %1" #~ msgstr "&О программе %1" #~ msgid "About &KDE" #~ msgstr "О &KDE" #~ msgctxt "@action:inmenu" #~ msgid "Exit F&ull Screen Mode" #~ msgstr "&Выйти из полноэкранного режима" #~ msgctxt "@action:intoolbar" #~ msgid "Exit Full Screen" #~ msgstr "Выйти из полноэкранного режима" #~ msgctxt "@info:tooltip" #~ msgid "Exit full screen mode" #~ msgstr "Выйти из полноэкранного режима" #~ msgctxt "@action:inmenu" #~ msgid "F&ull Screen Mode" #~ msgstr "&Полноэкранный режим" #~ msgctxt "@action:intoolbar" #~ msgid "Full Screen" #~ msgstr "Полноэкранный режим" #~ msgctxt "@info:tooltip" #~ msgid "Display the window in full screen" #~ msgstr "Разворачивает окно на полный экран" #~ msgctxt "Custom color" #~ msgid "Custom..." #~ msgstr "Указать собственный..." #~ msgctxt "palette name" #~ msgid "* Recent Colors *" #~ msgstr "* Последние цвета *" #~ msgctxt "palette name" #~ msgid "* Custom Colors *" #~ msgstr "* Собственные цвета *" #~ msgctxt "palette name" #~ msgid "Forty Colors" #~ msgstr "Сорок основных цветов" #~ msgctxt "palette name" #~ msgid "Oxygen Colors" #~ msgstr "Цвета Oxygen" #~ msgctxt "palette name" #~ msgid "Rainbow Colors" #~ msgstr "Радужные цвета" #~ msgctxt "palette name" #~ msgid "Royal Colors" #~ msgstr "Королевские цвета" #~ msgctxt "palette name" #~ msgid "Web Colors" #~ msgstr "Цвета веб" #~ msgid "Named Colors" #~ msgstr "Именованные цвета" #~ msgctxt "" #~ "%1 is the number of paths, %2 is the list of paths (with newlines between " #~ "them)" #~ msgid "" #~ "Unable to read X11 RGB color strings. The following file location was " #~ "examined:\n" #~ "%2" #~ msgid_plural "" #~ "Unable to read X11 RGB color strings. The following file locations were " #~ "examined:\n" #~ "%2" #~ msgstr[0] "" #~ "Не удалось получить определения цветов X11 ни из одного из следующих " #~ "расположений:\n" #~ "%2" #~ msgstr[1] "" #~ "Не удалось получить определения цветов X11 ни из одного из следующих " #~ "расположений:\n" #~ "%2" #~ msgstr[2] "" #~ "Не удалось получить определения цветов X11 ни из одного из следующих " #~ "расположений:\n" #~ "%2" #~ msgstr[3] "" #~ "Не удалось получить определения цветов X11 из следующего расположения:\n" #~ "%2" #~ msgid "Select Color" #~ msgstr "Выбор цвета" #~ msgid "Hue:" #~ msgstr "Оттенок:" #~ msgctxt "The angular degree unit (for hue)" #~ msgid "°" #~ msgstr "°" #~ msgid "Saturation:" #~ msgstr "Насыщенность:" #~ msgctxt "This is the V of HSV" #~ msgid "Value:" #~ msgstr "Яркость:" #~ msgid "Red:" #~ msgstr "Красный:" #~ msgid "Green:" #~ msgstr "Зелёный:" #~ msgid "Blue:" #~ msgstr "Синий:" #~ msgid "Alpha:" #~ msgstr "Альфа-канал:" #~ msgid "&Add to Custom Colors" #~ msgstr "&Добавить в собственные цвета" #~ msgid "Name:" #~ msgstr "Название:" #~ msgid "HTML:" #~ msgstr "HTML:" #~ msgid "Default color" #~ msgstr "Цвет по умолчанию" #~ msgid "-default-" #~ msgstr "-по умолчанию-" #~ msgid "-unnamed-" #~ msgstr "-безымянный-" #~ msgid "" #~ "No information available.
    The supplied KAboutData object does " #~ "not exist.    " #~ msgstr "" #~ "К сожалению, информация отсутствует.
    Программа не предоставила " #~ "объект KAboutData.    " #~ msgid "" #~ "%1
    Version %2
     " #~ msgstr "" #~ "%1
    Версия %2
     " #~ msgctxt "" #~ "Program name, version and KDE platform version; do not translate " #~ "'Development Platform'" #~ msgid "" #~ "%1
    Version %2
    Using KDE " #~ "Development Platform %3" #~ msgstr "" #~ "%1
    Версия %2
    Использует " #~ "KDE %3" #~ msgid "License: %1" #~ msgstr "Лицензия: %1" #~ msgid "License Agreement" #~ msgstr "Лицензионное соглашение" #~ msgctxt "Action to send an email to a contributor" #~ msgid "Email contributor" #~ msgstr "Написать участнику по электронной почте" #~ msgid "Visit contributor's homepage" #~ msgstr "Посетить домашнюю страницу участника" #~ msgctxt "Action to send an email to a contributor" #~ msgid "" #~ "Email contributor\n" #~ "%1" #~ msgstr "" #~ "Написать участнику по электронной почте:\n" #~ "%1" #~ msgid "" #~ "Visit contributor's homepage\n" #~ "%1" #~ msgstr "" #~ "Посетить домашнюю страницу участника:\n" #~ "%1" #~ msgid "" #~ "Visit contributor's profile on %1\n" #~ "%2" #~ msgstr "" #~ "Посетить страницу профиля помощника на %1\n" #~ "%2" #~ msgid "" #~ "Visit contributor's page\n" #~ "%1" #~ msgstr "" #~ "Посетить страницу помощника\n" #~ "%1" #~ msgid "" #~ "Visit contributor's blog\n" #~ "%1" #~ msgstr "" #~ "Посетить блог участника:\n" #~ "%1" #~ msgctxt "@item Contributor name in about dialog." #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "A generic social network or homepage link of an unlisted type." #~ msgid "Other" #~ msgstr "Другое" #~ msgctxt "A type of link." #~ msgid "Blog" #~ msgstr "Блог" #~ msgctxt "A type of link." #~ msgid "Homepage" #~ msgstr "Домашняя страница" #~ msgid "About KDE" #~ msgstr "О KDE" #~ msgid "" #~ "KDE - Be Free!
    Platform Version %1" #~ msgstr "" #~ "KDE — будьте свободными!
    Версия " #~ "платформы — %1" #~ msgid "" #~ "KDE is a world-wide network of software engineers, artists, " #~ "writers, translators and facilitators who are committed to Free Software development. This community has created hundreds " #~ "of Free Software applications as part of the KDE Development Platform and " #~ "KDE Software Distribution.

    KDE is a cooperative enterprise in " #~ "which no single entity controls the efforts or products of KDE to the " #~ "exclusion of others. Everyone is welcome to join and contribute to KDE, " #~ "including you.

    Visit %2 for more " #~ "information about the KDE community and the software we produce." #~ msgstr "" #~ "KDE — международное сообщество программистов, дизайнеров, " #~ "переводчиков и других людей, так или иначе, посвящающих себя разработке " #~ "свободного программного обеспечения. Это сообщество " #~ "поддерживает Платформу KDE (KDE Development Platform) и Набор прикладного " #~ "ПО KDE (KDE Software Distribution).

    Не существует группы или " #~ "организации, держащей под исключительным контролем действия или продукты " #~ "KDE. Мы будем рады каждому, кто захочет внести свой вклад в развитие KDE." #~ "

    Для того чтобы больше узнать о проекте, зайдите на сайт %2." #~ msgid "" #~ "You do not have to be a software developer to be a member of the " #~ "KDE team. You can join the national teams that translate program " #~ "interfaces. You can provide graphics, themes, sounds, and improved " #~ "documentation. You decide!

    Visit %1 for " #~ "information on some projects in which you can participate.

    If " #~ "you need more information or documentation, then a visit to %2 will provide you with what you need." #~ msgstr "" #~ "Для того чтобы включиться в разработку KDE, не обязательно быть " #~ "программистом. Вы можете помочь в переводе KDE на родной язык, создавать " #~ "графику, стили, звуки, улучшать документацию — то есть тем, чем вы сами " #~ "хотите заниматься.

    Список проектов, в которых вы могли бы " #~ "принять участие, приведён на сайте %1. Вполне " #~ "возможно, какой-то из них вас заинтересует.

    Более подробные " #~ "сведения и документацию можно найти на сайте %2." #~ msgid "" #~ "KDE software is and will always be available free of charge, " #~ "however creating it is not free.

    To support development the " #~ "KDE community has formed the KDE e.V., a non-profit organization legally " #~ "founded in Germany. KDE e.V. represents the KDE community in legal and " #~ "financial matters. See %1 for information on KDE e.V." #~ "

    KDE benefits from many kinds of contributions, including " #~ "financial. We use the funds to reimburse members and others for expenses " #~ "they incur when contributing. Further funds are used for legal support " #~ "and organizing conferences and meetings.

    We would like to " #~ "encourage you to support our efforts with a financial donation, using one " #~ "of the ways described at %2.

    Thank you very " #~ "much in advance for your support." #~ msgstr "" #~ "Среда KDE распространяется бесплатно, но её создание требует затрат." #~ "

    Поэтому команда KDE основала Ассоциацию KDE, некоммерческую " #~ "организацию, которая зарегистрирована в Германии. Ассоциация KDE " #~ "представляет проект KDE в правовом и финансовом аспектах. Посетите %1 для получения более подробной информации об Ассоциации " #~ "KDE.

    Финансовая поддержка идёт на благо KDE. Большая часть " #~ "средств используется для возмещения расходов участников проекта, которые " #~ "они несут при разработке KDE. Остальные средства используются для " #~ "юридической поддержки и организации конференций и встреч. Вы можете " #~ "поддержать KDE финансовым пожертвованием, которое может быть внесено " #~ "одним из способов, описанных на странице %2.

    Заранее благодарим за поддержку!" #~ msgctxt "About KDE" #~ msgid "&About" #~ msgstr "О &среде KDE" #~ msgid "&Report Bugs or Wishes" #~ msgstr "&Сообщить об ошибках или пожеланиях" #~ msgid "&Join KDE" #~ msgstr "&Присоединиться к сообществу KDE" #~ msgid "&Support KDE" #~ msgstr "&Поддержать KDE" #~ msgid "Finish" #~ msgstr "Готово" #~ msgid "Submit Bug Report" #~ msgstr "Отправить отчёт об ошибке" #~ msgid "" #~ "Your email address. If incorrect, use the Configure Email button to " #~ "change it" #~ msgstr "" #~ "Ваш электронный адрес. Если он неверен, нажмите кнопку «Настройка " #~ "электронной почты» и измените его." #~ msgctxt "Email sender address" #~ msgid "From:" #~ msgstr "Отправитель: " #~ msgid "Configure Email..." #~ msgstr "Параметры электронной почты..." #~ msgid "The email address this bug report is sent to." #~ msgstr "Почтовый адрес для отправления сообщения об ошибке." #~ msgctxt "Email receiver address" #~ msgid "To:" #~ msgstr "Получатель:" #~ msgid "&Send" #~ msgstr "&Отправить" #~ msgid "Send bug report." #~ msgstr "Отправить сообщение об ошибке." #~ msgid "Send this bug report to %1." #~ msgstr "Отправить это сообщение об ошибке на %1." #~ msgid "" #~ "The application for which you wish to submit a bug report - if incorrect, " #~ "please use the Report Bug menu item of the correct application" #~ msgstr "" #~ "Приложение, содержащее описываемую ошибку. Если здесь указано не то " #~ "приложение, используйте пункт меню «Отправить сообщение об ошибке» " #~ "нужного приложения" #~ msgid "Application: " #~ msgstr "Приложение: " #~ msgid "" #~ "The version of this application - please make sure that no newer version " #~ "is available before sending a bug report" #~ msgstr "" #~ "Версия программы. Прежде чем отправлять сообщение об ошибке, проверьте, " #~ "не вышла ли более свежая версия." #~ msgid "Version:" #~ msgstr "Версия:" #~ msgid "no version set (programmer error)" #~ msgstr "нет данных о версии (ошибка программиста!)" #~ msgid "OS:" #~ msgstr "Операционная система:" #~ msgid "Compiler:" #~ msgstr "Компилятор:" #~ msgid "Se&verity" #~ msgstr "Степень &важности" #~ msgid "Critical" #~ msgstr "Критическая ошибка" #~ msgid "Grave" #~ msgstr "Опасная ошибка" #~ msgctxt "normal severity" #~ msgid "Normal" #~ msgstr "Обычная ошибка" #~ msgid "Wishlist" #~ msgstr "Пожелание" #~ msgid "Translation" #~ msgstr "Ошибка в переводе" #~ msgid "S&ubject: " #~ msgstr "&Тема: " #~ msgid "" #~ "Enter the text (in English if possible) that you wish to submit for the " #~ "bug report.\n" #~ "If you press \"Send\", a mail message will be sent to the maintainer of " #~ "this program.\n" #~ msgstr "" #~ "Введите текст (желательно по-английски), который описывает ошибку.\n" #~ "Если вы нажмёте кнопку «Отправить», сообщение будет отправлено к " #~ "ответственному за разработку этой программы.\n" #~ msgid "" #~ "To submit a bug report, click on the button below. This will open a " #~ "web browser window on http://bugs.kde." #~ "org where you will find a form to fill in. The information displayed " #~ "above will be transferred to that server." #~ msgstr "" #~ "Для того, чтобы отправить сообщение об ошибке, нажмите на кнопку " #~ "внизу. Откроется окно с адресом http://" #~ "bugs.kde.org, где можно будет заполнить форму. Информация будет " #~ "отправлена на сервер учёта ошибок." #~ msgid "&Launch Bug Report Wizard" #~ msgstr "&Запустить мастер сообщения об ошибке" #~ msgctxt "unknown program name" #~ msgid "unknown" #~ msgstr "неизвестная" #~ msgid "" #~ "You must specify both a subject and a description before the report can " #~ "be sent." #~ msgstr "Перед отправкой отчёта необходимо указать тему и описание ошибки." #~ msgid "" #~ "

    You chose the severity Critical. Please note that this severity " #~ "is intended only for bugs that:

    • break unrelated software on " #~ "the system (or the whole system)
    • cause serious data loss
    • introduce a security hole on the system where the affected package " #~ "is installed
    \n" #~ "

    Does the bug you are reporting cause any of the above damage? If it " #~ "does not, please select a lower severity. Thank you.

    " #~ msgstr "" #~ "

    Выбран уровень ошибки Критическая. Этот уровень подразумевает, " #~ "что ошибка:

    • может вызвать сбой в работе других программ или " #~ "системы в целом
    • привести к порче и утрате данных
    • нарушить " #~ "безопасность системы, если установлен данный пакет
    \n" #~ "

    Является ли ошибка, о которой вы хотите сообщить, настолько серьёзной? " #~ "Если нет, выберите другой, менее высокий уровень ошибки.

    " #~ msgid "" #~ "

    You chose the severity Grave. Please note that this severity is " #~ "intended only for bugs that:

    • make the package in question " #~ "unusable or mostly so
    • cause data loss
    • introduce a " #~ "security hole allowing access to the accounts of users who use the " #~ "affected package
    \n" #~ "

    Does the bug you are reporting cause any of the above damage? If it " #~ "does not, please select a lower severity. Thank you.

    " #~ msgstr "" #~ "

    Вы выбрали уровень ошибки Опасная. Этот уровень подразумевает, " #~ "что ошибка:

    • может вызвать неисправимый сбой в работе данного " #~ "пакета
    • привести к утрате данных
    • нарушить безопасность " #~ "системы и открыть доступ к файлам пользователей, установивших данный " #~ "пакет
    \n" #~ "

    Является ли ошибка, о которой вы хотите сообщить, настолько серьёзной? " #~ "Если нет, выберите другой, менее высокий уровень ошибки.

    " #~ msgid "" #~ "Unable to send the bug report.\n" #~ "Please submit a bug report manually....\n" #~ "See http://bugs.kde.org/ for instructions." #~ msgstr "" #~ "Не удалось отправить сообщение об ошибке.\n" #~ "Попробуйте отправить его вручную на сайте http://bugs.kde.org/" #~ msgid "Bug report sent, thank you for your input." #~ msgstr "Сообщение об ошибке отправлено, спасибо." #~ msgid "" #~ "Close and discard\n" #~ "edited message?" #~ msgstr "" #~ "Закрыть и отменить\n" #~ "введённое сообщение?" #~ msgid "Close Message" #~ msgstr "Закрыть сообщение" #~ msgid "Configure" #~ msgstr "Настройка" #~ msgid "Job" #~ msgstr "Задание" #~ msgid "Job Control" #~ msgstr "Управление заданиями" #~ msgid "Scheduled printing:" #~ msgstr "Отложенная печать:" #~ msgid "Billing information:" #~ msgstr "Стоимость печати:" #~ msgid "Job priority:" #~ msgstr "Приоритет:" #~ msgid "Job Options" #~ msgstr "Параметры задания" #~ msgid "Option" #~ msgstr "Параметр" #~ msgid "Value" #~ msgstr "Значение" #~ msgid "Print Immediately" #~ msgstr "Печатать немедленно" #~ msgid "Hold Indefinitely" #~ msgstr "Удерживать до следующих распоряжений" #~ msgid "Day (06:00 to 17:59)" #~ msgstr "Днём (06:00 — 17:59)" #~ msgid "Night (18:00 to 05:59)" #~ msgstr "Ночью (18:00 — 05:59)" #~ msgid "Second Shift (16:00 to 23:59)" #~ msgstr "Во вторую смену (16:00 - 23:59)" #~ msgid "Third Shift (00:00 to 07:59)" #~ msgstr "В третью смену (00:00 - 07:59)" #~ msgid "Weekend (Saturday to Sunday)" #~ msgstr "В выходные (суббота, воскресенье)" #~ msgid "Specific Time" #~ msgstr "В указанное время" #~ msgid "Pages" #~ msgstr "Страницы" #~ msgid "Pages Per Sheet" #~ msgstr "Страниц на лист" #~ msgid "1" #~ msgstr "1" #~ msgid "6" #~ msgstr "6" #~ msgid "2" #~ msgstr "2" #~ msgid "9" #~ msgstr "9" #~ msgid "4" #~ msgstr "4" #~ msgid "16" #~ msgstr "16" #~ msgid "Banner Pages" #~ msgstr "Печатать страницы-разделители" #~ msgctxt "Banner page at start" #~ msgid "Start" #~ msgstr "В начале" #~ msgctxt "Banner page at end" #~ msgid "End" #~ msgstr "В конце" #~ msgid "Page Label" #~ msgstr "Название страницы" #~ msgid "Page Border" #~ msgstr "Рамка" #~ msgid "Mirror Pages" #~ msgstr "Зеркальное отражение" #~ msgid "Mirror pages along vertical axis" #~ msgstr "Зеркально отражать по вертикали" #~ msgid "Left to Right, Top to Bottom" #~ msgstr "Слева направо, сверху вниз" #~ msgid "Left to Right, Bottom to Top" #~ msgstr "Слева направо, снизу вверх" #~ msgid "Right to Left, Bottom to Top" #~ msgstr "Справа налево, снизу вверх" #~ msgid "Right to Left, Top to Bottom" #~ msgstr "Справа налево, сверху вниз" #~ msgid "Bottom to Top, Left to Right" #~ msgstr "Снизу вверх, слева направо" #~ msgid "Bottom to Top, Right to Left" #~ msgstr "Снизу вверх, справа налево" #~ msgid "Top to Bottom, Left to Right" #~ msgstr "Сверху вниз, слева направо" #~ msgid "Top to Bottom, Right to Left" #~ msgstr "Сверху вниз, справа налево" #~ msgctxt "No border line" #~ msgid "None" #~ msgstr "Без рамки" #~ msgid "Single Line" #~ msgstr "Одна линия" #~ msgid "Single Thick Line" #~ msgstr "Одна толстая линия" #~ msgid "Double Line" #~ msgstr "Двойная линия" #~ msgid "Double Thick Line" #~ msgstr "Двойная толстая линия" #~ msgctxt "Banner page" #~ msgid "None" #~ msgstr "Нет" #~ msgctxt "Banner page" #~ msgid "Standard" #~ msgstr "Стандартная" #~ msgctxt "Banner page" #~ msgid "Unclassified" #~ msgstr "Не классифицируется" #~ msgctxt "Banner page" #~ msgid "Confidential" #~ msgstr "Конфиденциально" #~ msgctxt "Banner page" #~ msgid "Classified" #~ msgstr "Классифицируется" #~ msgctxt "Banner page" #~ msgid "Secret" #~ msgstr "Секретно" #~ msgctxt "Banner page" #~ msgid "Top Secret" #~ msgstr "Особо секретно" #~ msgid "All Pages" #~ msgstr "Все страницы" #~ msgid "Odd Pages" #~ msgstr "Нечётные страницы" #~ msgid "Even Pages" #~ msgstr "Чётные страницы" #~ msgid "Page Set" #~ msgstr "Набор страниц" #~ msgctxt "@title:window" #~ msgid "Print" #~ msgstr "Печать" #~ msgid "&Try" #~ msgstr "&Попробовать" #~ msgid "modified" #~ msgstr "изменён" #~ msgctxt "Document/application separator in titlebar" #~ msgid " – " #~ msgstr " — " #~ msgid "&Details" #~ msgstr "&Подробности" #~ msgid "Get help..." #~ msgstr "Справка..." #~ msgid "--- separator ---" #~ msgstr "--- разделитель ---" #~ msgid "Change Text" #~ msgstr "Изменить текст" #~ msgid "Icon te&xt:" #~ msgstr "&Текст кнопки:" #~ msgid "&Hide text when toolbar shows text alongside icons" #~ msgstr "&Скрывать текст при показе подписей сбоку от значков" #~ msgid "Configure Toolbars" #~ msgstr "Настройка панелей инструментов" #~ msgid "" #~ "Do you really want to reset all toolbars of this application to their " #~ "default? The changes will be applied immediately." #~ msgstr "" #~ "Восстановить панели инструментов по умолчанию? Изменения вступят в силу " #~ "немедленно." #~ msgid "Reset Toolbars" #~ msgstr "Восстановить панели инструментов" #~ msgid "Reset" #~ msgstr "Восстановить" #~ msgid "&Toolbar:" #~ msgstr "&Панель инструментов:" #~ msgid "A&vailable actions:" #~ msgstr "&Доступные действия:" #~ msgid "Filter" #~ msgstr "Фильтр" #~ msgid "Curr&ent actions:" #~ msgstr "&Текущие действия:" #~ msgid "Change &Icon..." #~ msgstr "Изменить &значок..." #~ msgid "Change Te&xt..." #~ msgstr "Изменить текст..." #~ msgctxt "@item:intable Action name in toolbar editor" #~ msgid "%1" #~ msgstr "%1" #~ msgid "" #~ "This element will be replaced with all the elements of an embedded " #~ "component." #~ msgstr "" #~ "Данный элемент будет полностью замещён элементами встроенного компонента." #~ msgid "" #~ msgstr "<Точка вставки>" #~ msgid "" #~ msgstr "<Точка вставки %1>" #~ msgid "" #~ "This is a dynamic list of actions. You can move it, but if you remove it " #~ "you will not be able to re-add it." #~ msgstr "" #~ "Это список действий. Вы можете перемещать его, однако при удалении " #~ "восстановить его будет невозможно." #~ msgid "ActionList: %1" #~ msgstr "Список действий: %1" #~ msgctxt "@label Action tooltip in toolbar editor, below the action list" #~ msgid "%1" #~ msgstr "%1" #~ msgid "Change Icon" #~ msgstr "Изменить значок" #~ msgid "Manage Link" #~ msgstr "Ссылка" #~ msgid "Link Text:" #~ msgstr "Текст ссылки:" #~ msgid "Link URL:" #~ msgstr "URL ссылки:" #~ msgctxt "@action:button filter-yes" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button filter-no" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button filter-continue" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button filter-cancel" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button post-filter" #~ msgid "." #~ msgstr "." #~ msgid "Details" #~ msgstr "Сведения" #~ msgid "Question" #~ msgstr "Вопрос" #~ msgid "Do not ask again" #~ msgstr "Не задавать больше этот вопрос" #~ msgid "Warning" #~ msgstr "Предупреждение" #~ msgid "Error" #~ msgstr "Ошибка" #~ msgid "Sorry" #~ msgstr "Ошибка" #~ msgid "Information" #~ msgstr "Сведения" #~ msgid "Do not show this message again" #~ msgstr "Не показывать больше это сообщение" #~ msgid "Password:" #~ msgstr "Пароль:" #~ msgid "Password" #~ msgstr "Пароль" #~ msgid "Supply a username and password below." #~ msgstr "Введите имя пользователя и пароль." #~ msgid "No password, use anonymous (or guest) login" #~ msgstr "Без пароля, анонимный или гостевой вход" #~ msgid "Use this password:" #~ msgstr "Указать пароль:" #~ msgid "Username:" #~ msgstr "Имя пользователя:" #~ msgid "Domain:" #~ msgstr "Домен:" #~ msgid "Remember password" #~ msgstr "Сохранить пароль" #~ msgid "Select Region of Image" #~ msgstr "Выбор области изображения" #~ msgid "Please click and drag on the image to select the region of interest:" #~ msgstr "" #~ "Нажмите кнопку мыши и перемещайте указатель, чтобы выбрать интересующую " #~ "область:" #~ msgid "Default:" #~ msgstr "По умолчанию:" #~ msgctxt "No shortcut defined" #~ msgid "None" #~ msgstr "Не определена" #~ msgid "Custom:" #~ msgstr "Другая:" #~ msgid "Shortcut Schemes" #~ msgstr "Схемы привязок" #~ msgid "Current scheme:" #~ msgstr "Текущая схема:" #~ msgid "New..." #~ msgstr "Создать..." #~ msgid "Delete" #~ msgstr "Удалить" #~ msgid "More Actions" #~ msgstr "Дополнительно" #~ msgid "Save as Scheme Defaults" #~ msgstr "Сохранить как схему по умолчанию" #~ msgid "Export Scheme..." #~ msgstr "Экспорт схемы..." #~ msgid "Name for New Scheme" #~ msgstr "Название новой схемы" #~ msgid "Name for new scheme:" #~ msgstr "Название новой схемы:" #~ msgid "New Scheme" #~ msgstr "Новая схема" #~ msgid "A scheme with this name already exists." #~ msgstr "Схема с таким названием уже существует" #~ msgid "" #~ "Do you really want to delete the scheme %1?\n" #~ "Note that this will not remove any system wide shortcut schemes." #~ msgstr "Удалить схему «%1»?" #~ msgid "Export to Location" #~ msgstr "Экспорт в папку" #~ msgid "Could not export shortcuts scheme because the location is invalid." #~ msgstr "Невозможно экспортировать схему в неправильно заданную папку." #~ msgid "" #~ "The current shortcut scheme is modified. Save before switching to the new " #~ "one?" #~ msgstr "" #~ "Текущая схема привязок была изменена. Сохранить изменения перед " #~ "переключением на другую схему." #~ msgid "Configure Shortcuts" #~ msgstr "Настройка комбинаций клавиш" #~ msgid "Print" #~ msgstr "Печать" #~ msgid "Reset to Defaults" #~ msgstr "По умолчанию" #~ msgid "" #~ "Search interactively for shortcut names (e.g. Copy) or combination of " #~ "keys (e.g. Ctrl+C) by typing them here." #~ msgstr "" #~ "Поиск по мере набора по именам комбинаций клавиш (например, Копировать) " #~ "или по самим комбинациям (например, Ctrl+C)." #~ msgid "" #~ "Here you can see a list of key bindings, i.e. associations between " #~ "actions (e.g. 'Copy') shown in the left column and keys or combination of " #~ "keys (e.g. Ctrl+V) shown in the right column." #~ msgstr "" #~ "Здесь показан список привязок комбинаций клавиш, то есть действий " #~ "(например, Копировать) из левого столбца, вызываемых при нажатии клавиш " #~ "или их сочетаний (например, Ctrl+V), указанных в правом столбце." #~ msgid "Action" #~ msgstr "Действие" #~ msgid "Shortcut" #~ msgstr "Комбинация клавиш" #~ msgid "Alternate" #~ msgstr "Дополнительная" #~ msgid "Global" #~ msgstr "Глобальная" #~ msgid "Global Alternate" #~ msgstr "Дополнительная глобальная" #~ msgid "Mouse Button Gesture" #~ msgstr "Кнопка росчерка мышью" #~ msgid "Mouse Shape Gesture" #~ msgstr "Фигура росчерка мышью" #~ msgid "Unknown" #~ msgstr "неизвестный" #~ msgid "Key Conflict" #~ msgstr "Конфликт клавиш" #~ msgid "" #~ "The '%1' shape gesture has already been allocated to the \"%2\" action.\n" #~ "Do you want to reassign it from that action to the current one?" #~ msgstr "" #~ "Фигура росчерка %1 уже связана с действием «%2».\n" #~ "Связать росчерк с текущим действием?" #~ msgid "Reassign" #~ msgstr "Связать с новым" #~ msgid "" #~ "The '%1' rocker gesture has already been allocated to the \"%2\" action.\n" #~ "Do you want to reassign it from that action to the current one?" #~ msgstr "" #~ "Зачёркивающий росчерк %1 уже связан с действием «%2».\n" #~ "Связать росчерк с текущим действием?" #~ msgctxt "header for an applications shortcut list" #~ msgid "Shortcuts for %1" #~ msgstr "Комбинации клавиш для %1" #~ msgid "Main:" #~ msgstr "Основная:" #~ msgid "Alternate:" #~ msgstr "Дополнительная:" #~ msgid "Global:" #~ msgstr "Глобальная:" #~ msgid "Action Name" #~ msgstr "Название действия" #~ msgid "Shortcuts" #~ msgstr "Комбинации клавиш" #~ msgid "Description" #~ msgstr "Описание" #~ msgctxt "@item:intable Action name in shortcuts configuration" #~ msgid "%1" #~ msgstr "%1" #~ msgid "Switch Application Language" #~ msgstr "Смена языка приложения" #~ msgid "" #~ "Please choose the language which should be used for this application:" #~ msgstr "" #~ "Выберите язык интерфейса, который должен использоваться в этом приложении:" #~ msgid "Add Fallback Language" #~ msgstr "Добавить резервный язык" #~ msgid "" #~ "Adds one more language which will be used if other translations do not " #~ "contain a proper translation." #~ msgstr "" #~ "Установить один или несколько языков, которые будут использоваться, если " #~ "нет перевода на основной язык." #~ msgid "" #~ "The language for this application has been changed. The change will take " #~ "effect the next time the application is started." #~ msgstr "" #~ "Язык интерфейса приложения изменён. Это изменение вступит в силу при " #~ "следующем запуске приложения." #~ msgid "Application Language Changed" #~ msgstr "Изменён язык приложения" #~ msgid "Primary language:" #~ msgstr "Основной язык:" #~ msgid "Fallback language:" #~ msgstr "Резервный язык:" #~ msgid "Remove" #~ msgstr "Удалить" #~ msgid "" #~ "This is the main application language which will be used first, before " #~ "any other languages." #~ msgstr "" #~ "Это основной язык интерфейса приложения, который будет использоваться " #~ "первым, перед всеми остальными языками." #~ msgid "" #~ "This is the language which will be used if any previous languages do not " #~ "contain a proper translation." #~ msgstr "" #~ "Это язык, который будет использоваться, если перевод на основной язык " #~ "отсутствует." #~ msgid "Tip of the Day" #~ msgstr "Совет дня" #~ msgid "Did you know...?\n" #~ msgstr "Знаете ли вы...?\n" #~ msgid "&Show tips on startup" #~ msgstr "&Показывать советы при запуске" #~ msgid "&Previous" #~ msgstr "&Предыдущее" #~ msgctxt "Opposite to Previous" #~ msgid "&Next" #~ msgstr "&Далее" #~ msgid "Find Next" #~ msgstr "Найти далее" #~ msgid "Find next occurrence of '%1'?" #~ msgstr "Найти следующее вхождение «%1»?" #~ msgid "1 match found." #~ msgid_plural "%1 matches found." #~ msgstr[0] "Найдено %1 совпадение." #~ msgstr[1] "Найдено %1 совпадения." #~ msgstr[2] "Найдено %1 совпадений." #~ msgstr[3] "Найдено %1 совпадение." #~ msgid "No matches found for '%1'." #~ msgstr "Не найдено совпадений для «%1»." #~ msgid "No matches found for '%1'." #~ msgstr "Нет совпадений для «%1»." #~ msgid "Beginning of document reached." #~ msgstr "Достигнуто начало документа." #~ msgid "End of document reached." #~ msgstr "Достигнут конец документа." #~ msgid "Continue from the end?" #~ msgstr "Продолжить с конца?" #~ msgid "Continue from the beginning?" #~ msgstr "Продолжить с начала?" #~ msgid "Find Text" #~ msgstr "Найти текст" #~ msgctxt "@title:group" #~ msgid "Find" #~ msgstr "Поиск" #~ msgid "&Text to find:" #~ msgstr "Искать &текст:" #~ msgid "Regular e&xpression" #~ msgstr "&Регулярное выражение" #~ msgid "&Edit..." #~ msgstr "&Изменить..." #~ msgid "Replace With" #~ msgstr "Заменить на" #~ msgid "Replace&ment text:" #~ msgstr "Текст для за&мены:" #~ msgid "Use p&laceholders" #~ msgstr "&Использовать заполнители" #~ msgid "Insert Place&holder" #~ msgstr "Вставить &заполнитель" #~ msgid "Options" #~ msgstr "Параметры" #~ msgid "C&ase sensitive" #~ msgstr "С &учётом регистра" #~ msgid "&Whole words only" #~ msgstr "&Только полные слова" #~ msgid "From c&ursor" #~ msgstr "От к&урсора" #~ msgid "Find &backwards" #~ msgstr "Ис&кать назад" #~ msgid "&Selected text" #~ msgstr "&Выделенный текст" #~ msgid "&Prompt on replace" #~ msgstr "&Спрашивать при замене" #~ msgid "Start replace" #~ msgstr "Начать замену" #~ msgid "" #~ "If you press the Replace button, the text you entered above is " #~ "searched for within the document and any occurrence is replaced with the " #~ "replacement text." #~ msgstr "" #~ "Если вы нажмёте копку Заменить, будет произведён поиск " #~ "введённого вами выражения, а затем замена каждого из найденных совпадений " #~ "на текст замены " #~ msgid "&Find" #~ msgstr "&Поиск" #~ msgid "Start searching" #~ msgstr "Начать поиск" #~ msgid "" #~ "If you press the Find button, the text you entered above is " #~ "searched for within the document." #~ msgstr "" #~ "Если вы нажмёте кнопку Найти, будет выполнен поиск введённого " #~ "вами текста по всему документу." #~ msgid "" #~ "Enter a pattern to search for, or select a previous pattern from the list." #~ msgstr "" #~ "Введите шаблон для поиска, или выберите предыдущий шаблон из списка." #~ msgid "If enabled, search for a regular expression." #~ msgstr "Если включено, искать регулярное выражение." #~ msgid "Click here to edit your regular expression using a graphical editor." #~ msgstr "" #~ "Нажмите, чтобы изменить ваше регулярное выражение при помощи графического " #~ "редактора." #~ msgid "Enter a replacement string, or select a previous one from the list." #~ msgstr "Введите строку для замены, или выберите предыдущую из списка." #~ msgid "" #~ "If enabled, any occurrence of \\N, where " #~ "N is an integer number, will be replaced with the " #~ "corresponding capture (\"parenthesized substring\") from the pattern." #~ "

    To include (a literal \\N in your replacement, put " #~ "an extra backslash in front of it, like \\\\N.

    " #~ msgstr "" #~ "Если установлен флажок, любое вхождение вида \\N, " #~ "где N — целое число, будет заменено N-ым захватом (компонентом найденной строки; компоненты обозначаются в регулярном " #~ "выражении круглыми скобками).

    Для того, чтобы последовательность " #~ "\\N не интерпретировалась (включалась в замены " #~ "буквально), поместите перед ней экранированную обратную косую черту: " #~ "\\\\N.

    " #~ msgid "Click for a menu of available captures." #~ msgstr "Нажмите для получения списка доступных захватов." #~ msgid "Require word boundaries in both ends of a match to succeed." #~ msgstr "Соответствие должно быть отдельным словом." #~ msgid "" #~ "Start searching at the current cursor location rather than at the top." #~ msgstr "Начать поиск от позиции курсора, а не с начала документа." #~ msgid "Only search within the current selection." #~ msgstr "Искать только в выделенном фрагменте." #~ msgid "" #~ "Perform a case sensitive search: entering the pattern 'Joe' will not " #~ "match 'joe' or 'JOE', only 'Joe'." #~ msgstr "" #~ "Искать с учётом регистра. В этом случае при поиске строки «Все» не будут " #~ "найдены слова «все» или «ВСЕ», только «Все»." #~ msgid "Search backwards." #~ msgstr "Искать назад." #~ msgid "Ask before replacing each match found." #~ msgstr "Спрашивать при каждой замене." #~ msgid "Any Character" #~ msgstr "Любой символ" #~ msgid "Start of Line" #~ msgstr "Начало строки" #~ msgid "End of Line" #~ msgstr "Конец строки" #~ msgid "Set of Characters" #~ msgstr "Набор символов" #~ msgid "Repeats, Zero or More Times" #~ msgstr "Повторы, ноль или более раз" #~ msgid "Repeats, One or More Times" #~ msgstr "Повторы, один или более раз" #~ msgid "Optional" #~ msgstr "Дополнительно" #~ msgid "Escape" #~ msgstr "Экранирующий символ" #~ msgid "TAB" #~ msgstr "Табуляция" #~ msgid "Newline" #~ msgstr "Перевод строки" #~ msgid "Carriage Return" #~ msgstr "Возврат каретки" #~ msgid "White Space" #~ msgstr "Пробельный символ" #~ msgid "Digit" #~ msgstr "Цифра" #~ msgid "Complete Match" #~ msgstr "Полное соответствие" #~ msgid "Captured Text (%1)" #~ msgstr "Захваченный текст (%1)" #~ msgid "You must enter some text to search for." #~ msgstr "Необходимо ввести текст для поиска." #~ msgid "Invalid regular expression." #~ msgstr "Неверное регулярное выражение." #~ msgid "Replace" #~ msgstr "Заменить" #~ msgctxt "@action:button Replace all occurrences" #~ msgid "&All" #~ msgstr "&Все" #~ msgid "&Skip" #~ msgstr "Пропу&стить" #~ msgid "Replace '%1' with '%2'?" #~ msgstr "Заменить «%1» на «%2»?" #~ msgid "No text was replaced." #~ msgstr "Замена текста не была произведена." #~ msgid "1 replacement done." #~ msgid_plural "%1 replacements done." #~ msgstr[0] "Сделана %1 замена." #~ msgstr[1] "Сделаны %1 замены." #~ msgstr[2] "Сделано %1 замен." #~ msgstr[3] "Сделана %1 замена." #~ msgid "Do you want to restart search from the end?" #~ msgstr "Продолжить поиск с конца?" #~ msgid "Do you want to restart search at the beginning?" #~ msgstr "Продолжить поиск с начала?" #~ msgctxt "@action:button Restart find & replace" #~ msgid "Restart" #~ msgstr "Повторить" #~ msgctxt "@action:button Stop find & replace" #~ msgid "Stop" #~ msgstr "Остановить" #~ msgid "" #~ "Your replacement string is referencing a capture greater than '\\%1', " #~ msgstr "Строка замены ссылается на захват, больший чем \\%1, " #~ msgid "but your pattern only defines 1 capture." #~ msgid_plural "but your pattern only defines %1 captures." #~ msgstr[0] "но шаблон определяет только %1 захват." #~ msgstr[1] "но шаблон определяет только %1 захвата." #~ msgstr[2] "но шаблон определяет только %1 захватов." #~ msgstr[3] "но шаблон определяет только %1 захват." #~ msgid "but your pattern defines no captures." #~ msgstr "но шаблон не определяет захватов." #~ msgid "" #~ "\n" #~ "Please correct." #~ msgstr "" #~ "\n" #~ "Исправьте, пожалуйста." #~ msgctxt "@item Font name" #~ msgid "Sans Serif" #~ msgstr "Sans Serif" #~ msgctxt "@item Font name" #~ msgid "Serif" #~ msgstr "Serif" #~ msgctxt "@item Font name" #~ msgid "Monospace" #~ msgstr "Monospace" #~ msgctxt "@item Font name" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@item Font name [foundry]" #~ msgid "%1 [%2]" #~ msgstr "%1 [%2]" #~ msgctxt "@info:whatsthis" #~ msgid "Here you can choose the font to be used." #~ msgstr "Здесь можно выбрать шрифт." #~ msgid "Requested Font" #~ msgstr "Запрошенный шрифт" #~ msgctxt "@option:check" #~ msgid "Font" #~ msgstr "Шрифт" #~ msgctxt "@info:whatsthis" #~ msgid "Enable this checkbox to change the font family settings." #~ msgstr "Поставьте флажок чтобы изменить гарнитуру шрифта." #~ msgctxt "@info:tooltip" #~ msgid "Change font family?" #~ msgstr "Изменить гарнитуру шрифта?" #~ msgctxt "@label" #~ msgid "Font:" #~ msgstr "Гарнитура:" #~ msgctxt "@option:check" #~ msgid "Font style" #~ msgstr "Начертание" #~ msgctxt "@info:whatsthis" #~ msgid "Enable this checkbox to change the font style settings." #~ msgstr "Поставьте флажок чтобы изменить начертание шрифта." #~ msgctxt "@info:tooltip" #~ msgid "Change font style?" #~ msgstr "Изменить начертание шрифта?" #~ msgid "Font style:" #~ msgstr "Начертание:" #~ msgctxt "@option:check" #~ msgid "Size" #~ msgstr "Размер" #~ msgctxt "@info:whatsthis" #~ msgid "Enable this checkbox to change the font size settings." #~ msgstr "Поставьте флажок чтобы изменить размер шрифта." #~ msgctxt "@info:tooltip" #~ msgid "Change font size?" #~ msgstr "Изменить размер шрифта?" #~ msgctxt "@label:listbox Font size" #~ msgid "Size:" #~ msgstr "Размер:" #~ msgctxt "@info:whatsthis" #~ msgid "Here you can choose the font family to be used." #~ msgstr "Здесь можно выбрать гарнитуру шрифта." #~ msgctxt "@info:whatsthis" #~ msgid "Here you can choose the font style to be used." #~ msgstr "Здесь можно выбрать начертание шрифта." #~ msgctxt "@item font" #~ msgid "Italic" #~ msgstr "Курсив" #~ msgctxt "@item font" #~ msgid "Oblique" #~ msgstr "Наклонный" #~ msgctxt "@item font" #~ msgid "Bold" #~ msgstr "Полужирный" #~ msgctxt "@item font" #~ msgid "Bold Italic" #~ msgstr "Полужирный курсив" #~ msgctxt "@item font size" #~ msgid "Relative" #~ msgstr "Относительный" #~ msgid "Font size
    fixed or relative
    to environment" #~ msgstr "" #~ "Размер шрифта
    фиксированный или относительный
    к " #~ "среде" #~ msgid "" #~ "Here you can switch between fixed font size and font size to be " #~ "calculated dynamically and adjusted to changing environment (e.g. widget " #~ "dimensions, paper size)." #~ msgstr "" #~ "Здесь можно переключиться между фиксированным размером шрифта и размером, " #~ "вычисляемым динамически и зависящим от изменяющегося окружения (размер " #~ "элементов окна, бумаги и т.д.)." #~ msgid "Here you can choose the font size to be used." #~ msgstr "Здесь можно выбрать размер шрифта." #~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog" #~ msgstr "" #~ "Широкая электрификация южных губерний даст мощный толчок подъёму " #~ "сельского хозяйства" #~ msgid "" #~ "This sample text illustrates the current settings. You may edit it to " #~ "test special characters." #~ msgstr "" #~ "Этот текст иллюстрирует текущие параметры. Измените его, чтобы проверить " #~ "корректность показа специальных символов." #~ msgid "Actual Font" #~ msgstr "Доступный шрифт" #~ msgctxt "@item Font style" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "short" #~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog" #~ msgstr "" #~ "Широкая электрификация южных губерний даст мощный толчок подъёму " #~ "сельского хозяйства" #~ msgctxt "Numeric IDs of scripts for font previews" #~ msgid "1" #~ msgstr "1" #~ msgid "Select Font" #~ msgstr "Выбор шрифта" #~ msgid "Choose..." #~ msgstr "Выбрать..." #~ msgid "Click to select a font" #~ msgstr "Нажмите, чтобы выбрать шрифт" #~ msgid "Preview of the selected font" #~ msgstr "Образец выбранного шрифта" #~ msgid "" #~ "This is a preview of the selected font. You can change it by clicking the " #~ "\"Choose...\" button." #~ msgstr "" #~ "Это образец выбранного шрифта. Его можно сменить, нажав кнопку " #~ "«Выбрать...»." #~ msgid "Preview of the \"%1\" font" #~ msgstr "Образец шрифта %1" #~ msgid "" #~ "This is a preview of the \"%1\" font. You can change it by clicking the " #~ "\"Choose...\" button." #~ msgstr "" #~ "Это образец шрифта %1. Вы можете сменить его, нажав кнопку «Выбрать...»." #~ msgid "Search" #~ msgstr "Поиск" #~ msgid "Stop" #~ msgstr "Остановить" #~ msgid " Stalled " #~ msgstr " Нет данных " #~ msgid " %1/s " #~ msgstr " %1/с " #~ msgctxt "%1 is the label, we add a ':' to it" #~ msgid "%1:" #~ msgstr "%1:" #~ msgid "%2 of %3 complete" #~ msgid_plural "%2 of %3 complete" #~ msgstr[0] "Выполнено %2 из %3" #~ msgstr[1] "Выполнено %2 из %3" #~ msgstr[2] "Выполнено %2 из %3" #~ msgstr[3] "Выполнено %2 из %3" #~ msgid "%2 / %1 folder" #~ msgid_plural "%2 / %1 folders" #~ msgstr[0] "%2 из %1 папки" #~ msgstr[1] "%2 из %1 папок" #~ msgstr[2] "%2 из %1 папок" #~ msgstr[3] "%2 из %1 папки" #~ msgid "%2 / %1 file" #~ msgid_plural "%2 / %1 files" #~ msgstr[0] "%2 из %1 файла" #~ msgstr[1] "%2 из %1 файлов" #~ msgstr[2] "%2 из %1 файлов" #~ msgstr[3] "%2 из %1 файла" #~ msgid "%1% of %2" #~ msgstr "%1% из %2" #~ msgid "%2% of 1 file" #~ msgid_plural "%2% of %1 files" #~ msgstr[0] "%2% %1 файла" #~ msgstr[1] "%2% %1 файлов" #~ msgstr[2] "%2% %1 файлов" #~ msgstr[3] "%2% %1 файла" #~ msgid "%1%" #~ msgstr "%1%" #~ msgid "Stalled" #~ msgstr "Нет данных" #~ msgid "%2/s (%3 remaining)" #~ msgid_plural "%2/s (%3 remaining)" #~ msgstr[0] "%2/с ( осталось %3 )" #~ msgstr[1] "%2/с ( осталось %3 )" #~ msgstr[2] "%2/с ( осталось %3 )" #~ msgstr[3] "%2/с ( осталось %3 )" #~ msgctxt "speed in bytes per second" #~ msgid "%1/s" #~ msgstr "%1/с" #~ msgid "%1/s (done)" #~ msgstr "%1/с (готово)" #~ msgid "&Resume" #~ msgstr "&Возобновить" #~ msgid "&Pause" #~ msgstr "&Приостановить" #~ msgctxt "The source url of a job" #~ msgid "Source:" #~ msgstr "Источник:" #~ msgctxt "The destination url of a job" #~ msgid "Destination:" #~ msgstr "Назначение:" #~ msgid "Click this to expand the dialog, to show details" #~ msgstr "" #~ "Нажмите эту кнопку, чтобы развернуть диалог для показа дополнительных " #~ "сведений" #~ msgid "&Keep this window open after transfer is complete" #~ msgstr "Не &закрывать окно после окончания передачи данных" #~ msgid "Open &File" #~ msgstr "&Открыть файл" #~ msgid "Open &Destination" #~ msgstr "Открыть папку &назначения" #~ msgid "Progress Dialog" #~ msgstr "Процесс выполнения" #~ msgid "%1 folder" #~ msgid_plural "%1 folders" #~ msgstr[0] "%1 папка" #~ msgstr[1] "%1 папки" #~ msgstr[2] "%1 папок" #~ msgstr[3] "%1 папка" #~ msgid "%1 file" #~ msgid_plural "%1 files" #~ msgstr[0] "%1 файл" #~ msgstr[1] "%1 файла" #~ msgstr[2] "%1 файлов" #~ msgstr[3] "%1 файл" #~ msgid "Click this to collapse the dialog, to hide details" #~ msgstr "Нажмите эту кнопку для сворачивания диалога" #~ msgid "The style '%1' was not found" #~ msgstr "Стиль «%1» не найден" #~ msgid "Do not run in the background." #~ msgstr "Не запускать в фоновом режиме." #~ msgid "Internally added if launched from Finder" #~ msgstr "Добавлено изнутри, если запущено из Finder" #~ msgid "Unknown Application" #~ msgstr "Неизвестное приложение" #~ msgid "&Minimize" #~ msgstr "&Свернуть" #~ msgid "&Restore" #~ msgstr "Восст&ановить" #~ msgid "Are you sure you want to quit %1?" #~ msgstr "Выйти из программы %1?" #~ msgid "Confirm Quit From System Tray" #~ msgstr "Подтверждение выхода из программы" #~ msgid "Minimize" #~ msgstr "Свернуть" #~ msgctxt "@title:window" #~ msgid "Dr. Klash' Accelerator Diagnosis" #~ msgstr "Проверка клавиш вызова от Dr. Klash" #~ msgctxt "@option:check" #~ msgid "Disable automatic checking" #~ msgstr "Отключить автоматическую проверку" #~ msgctxt "@action:button" #~ msgid "Close" #~ msgstr "Закрыть" #~ msgid "

    Accelerators changed

    " #~ msgstr "

    Акселераторы изменены

    " #~ msgid "

    Accelerators removed

    " #~ msgstr "

    Акселераторы удалены

    " #~ msgid "

    Accelerators added (just for your info)

    " #~ msgstr "

    Акселераторы добавлены

    " #~ msgctxt "left mouse button" #~ msgid "left button" #~ msgstr "левая кнопка" #~ msgctxt "middle mouse button" #~ msgid "middle button" #~ msgstr "средняя кнопка" #~ msgctxt "right mouse button" #~ msgid "right button" #~ msgstr "правая кнопка" #~ msgctxt "a nonexistent value of mouse button" #~ msgid "invalid button" #~ msgstr "недопустимая кнопка" #~ msgctxt "" #~ "a kind of mouse gesture: hold down one mouse button, then press another " #~ "button" #~ msgid "Hold %1, then push %2" #~ msgstr "Держать %1, затем нажать %2" #~ msgid "Conflict with Global Shortcut" #~ msgstr "Конфликт с глобальной комбинацией" #~ msgid "" #~ "The '%1' key combination has already been allocated to the global action " #~ "\"%2\" in %3.\n" #~ "Do you want to reassign it from that action to the current one?" #~ msgstr "" #~ "Комбинация клавиш %1 уже связана с глобальным действием «%2» в %3.\n" #~ "Связать комбинацию с текущим действием?" #~ msgid "" #~ "The '%1' key combination is registered by application %2 for action %3:" #~ msgstr "Клавиша «%1» уже назначена в приложении %2 на действие %3:" #~ msgid "In context '%1' for action '%2'\n" #~ msgstr "Контекст «%1» для действия «%2»\n" #~ msgid "" #~ "The '%1' key combination is registered by application %2.\n" #~ "%3" #~ msgstr "" #~ "Клавиша «%1» уже назначена в приложении %2.\n" #~ "%3" #~ msgid "Conflict With Registered Global Shortcut" #~ msgstr "Конфликт с глобальной комбинацией клавиш" #~ msgctxt "@action" #~ msgid "Open" #~ msgstr "Открыть" #~ msgctxt "@action" #~ msgid "New" #~ msgstr "Создать" #~ msgctxt "@action" #~ msgid "Close" #~ msgstr "Закрыть" #~ msgctxt "@action" #~ msgid "Save" #~ msgstr "Сохранить" #~ msgctxt "@action" #~ msgid "Print" #~ msgstr "Печать" #~ msgctxt "@action" #~ msgid "Quit" #~ msgstr "Выход" #~ msgctxt "@action" #~ msgid "Undo" #~ msgstr "Отменить действие" #~ msgctxt "@action" #~ msgid "Redo" #~ msgstr "Повторить отменённое действие" #~ msgctxt "@action" #~ msgid "Cut" #~ msgstr "Вырезать" #~ msgctxt "@action" #~ msgid "Copy" #~ msgstr "Копировать" #~ msgctxt "@action" #~ msgid "Paste" #~ msgstr "Вставить" #~ msgctxt "@action" #~ msgid "Paste Selection" #~ msgstr "Вставить выделение" #~ msgctxt "@action" #~ msgid "Select All" #~ msgstr "Выделить все" #~ msgctxt "@action" #~ msgid "Deselect" #~ msgstr "Снять выделение" #~ msgctxt "@action" #~ msgid "Delete Word Backwards" #~ msgstr "Удалить слово перед курсором" #~ msgctxt "@action" #~ msgid "Delete Word Forward" #~ msgstr "Удалить слово после курсора" #~ msgctxt "@action" #~ msgid "Find" #~ msgstr "Найти" #~ msgctxt "@action" #~ msgid "Find Next" #~ msgstr "Найти далее" #~ msgctxt "@action" #~ msgid "Find Prev" #~ msgstr "Найти предыдущее" #~ msgctxt "@action" #~ msgid "Replace" #~ msgstr "Заменить" #~ msgctxt "@action Go to main page" #~ msgid "Home" #~ msgstr "Основная страница" #~ msgctxt "@action Beginning of document" #~ msgid "Begin" #~ msgstr "Начало документа" #~ msgctxt "@action End of document" #~ msgid "End" #~ msgstr "Конец документа" #~ msgctxt "@action" #~ msgid "Prior" #~ msgstr "Предыдущий" #~ msgctxt "@action Opposite to Prior" #~ msgid "Next" #~ msgstr "Далее" #~ msgctxt "@action" #~ msgid "Up" #~ msgstr "Вверх" #~ msgctxt "@action" #~ msgid "Back" #~ msgstr "Назад" #~ msgctxt "@action" #~ msgid "Forward" #~ msgstr "Вперёд" #~ msgctxt "@action" #~ msgid "Reload" #~ msgstr "Открыть заново" #~ msgctxt "@action" #~ msgid "Beginning of Line" #~ msgstr "Начало строки" #~ msgctxt "@action" #~ msgid "End of Line" #~ msgstr "Конец строки" #~ msgctxt "@action" #~ msgid "Go to Line" #~ msgstr "Перейти к строке" #~ msgctxt "@action" #~ msgid "Backward Word" #~ msgstr "На слово назад" #~ msgctxt "@action" #~ msgid "Forward Word" #~ msgstr "На слово вперёд" #~ msgctxt "@action" #~ msgid "Add Bookmark" #~ msgstr "Добавить закладку" #~ msgctxt "@action" #~ msgid "Zoom In" #~ msgstr "Увеличить масштаб" #~ msgctxt "@action" #~ msgid "Zoom Out" #~ msgstr "Уменьшить масштаб" #~ msgctxt "@action" #~ msgid "Full Screen Mode" #~ msgstr "Полноэкранный режим" #~ msgctxt "@action" #~ msgid "Show Menu Bar" #~ msgstr "Показать меню" #~ msgctxt "@action" #~ msgid "Activate Next Tab" #~ msgstr "Перейти на следующую вкладку" #~ msgctxt "@action" #~ msgid "Activate Previous Tab" #~ msgstr "Перейти на предыдущую вкладку" #~ msgctxt "@action" #~ msgid "Help" #~ msgstr "Справка" #~ msgctxt "@action" #~ msgid "What's This" #~ msgstr "Что это?" #~ msgctxt "@action" #~ msgid "Text Completion" #~ msgstr "Завершение текста" #~ msgctxt "@action" #~ msgid "Previous Completion Match" #~ msgstr "Предыдущий вариант завершения" #~ msgctxt "@action" #~ msgid "Next Completion Match" #~ msgstr "Следующий вариант завершения" #~ msgctxt "@action" #~ msgid "Substring Completion" #~ msgstr "Завершение подстроки" #~ msgctxt "@action" #~ msgid "Previous Item in List" #~ msgstr "Предыдущий элемент в списке" #~ msgctxt "@action" #~ msgid "Next Item in List" #~ msgstr "Следующий элемент в списке" #~ msgctxt "@action" #~ msgid "Open Recent" #~ msgstr "Последние файлы" #~ msgctxt "@action" #~ msgid "Save As" #~ msgstr "Сохранить как" #~ msgctxt "@action" #~ msgid "Revert" #~ msgstr "Восстановить" #~ msgctxt "@action" #~ msgid "Print Preview" #~ msgstr "Предварительный просмотр" #~ msgctxt "@action" #~ msgid "Clear" #~ msgstr "Очистить" #~ msgctxt "@action" #~ msgid "Actual Size" #~ msgstr "Фактический размер" #~ msgctxt "@action" #~ msgid "Fit To Page" #~ msgstr "Вместить" #~ msgctxt "@action" #~ msgid "Fit To Width" #~ msgstr "Вместить по ширине" #~ msgctxt "@action" #~ msgid "Fit To Height" #~ msgstr "Вместить по высоте" #~ msgctxt "@action" #~ msgid "Zoom" #~ msgstr "Масштаб" #~ msgctxt "@action" #~ msgid "Goto" #~ msgstr "Перейти" #~ msgctxt "@action" #~ msgid "Goto Page" #~ msgstr "Перейти на страницу" #~ msgctxt "@action" #~ msgid "Document Back" #~ msgstr "Назад" #~ msgctxt "@action" #~ msgid "Document Forward" #~ msgstr "Вперёд" #~ msgctxt "@action" #~ msgid "Edit Bookmarks" #~ msgstr "Изменить закладки" #~ msgctxt "@action" #~ msgid "Spelling" #~ msgstr "Проверка орфографии" #~ msgctxt "@action" #~ msgid "Show Toolbar" #~ msgstr "Показать панель инструментов" #~ msgctxt "@action" #~ msgid "Show Statusbar" #~ msgstr "Показать строку состояния" #~ msgctxt "@action" #~ msgid "Save Options" #~ msgstr "Сохранить параметры" #~ msgctxt "@action" #~ msgid "Key Bindings" #~ msgstr "Комбинации клавиш" #~ msgctxt "@action" #~ msgid "Preferences" #~ msgstr "Настроить" #~ msgctxt "@action" #~ msgid "Configure Toolbars" #~ msgstr "Настроить панели инструментов" #~ msgctxt "@action" #~ msgid "Configure Notifications" #~ msgstr "Настроить уведомления" #~ msgctxt "@action" #~ msgid "Tip Of Day" #~ msgstr "Совет дня" #~ msgctxt "@action" #~ msgid "Report Bug" #~ msgstr "Сообщить об ошибке" #~ msgctxt "@action" #~ msgid "Switch Application Language" #~ msgstr "Сменить язык интерфейса приложения" #~ msgctxt "@action" #~ msgid "About Application" #~ msgstr "О приложении" #~ msgctxt "@action" #~ msgid "About KDE" #~ msgstr "О KDE" #~ msgid "Spell Checking Configuration" #~ msgstr "Настройка проверки орфографии" #~ msgid "Enable &background spellchecking" #~ msgstr "Включить &фоновую проверку орфографии" #~ msgid "&Automatic spell checking enabled by default" #~ msgstr "&По умолчанию использовать проверку орфографии на лету" #~ msgid "Skip all &uppercase words" #~ msgstr "Пропускать &слова в верхнем регистре" #~ msgid "S&kip run-together words" #~ msgstr "Пропускать слова, &написанные слитно" #~ msgid "Default language:" #~ msgstr "Язык по умолчанию:" #~ msgid "Ignored Words" #~ msgstr "Игнорируемые слова" #~ msgctxt "@title:window" #~ msgid "Check Spelling" #~ msgstr "Проверить орфографию" #~ msgctxt "@action:button" #~ msgid "&Finished" #~ msgstr "&Готово" #~ msgctxt "progress label" #~ msgid "Spell checking in progress..." #~ msgstr "Выполняется проверка орфографии..." #~ msgid "Spell check stopped." #~ msgstr "Проверка орфографии остановлена" #~ msgid "Spell check canceled." #~ msgstr "Проверка орфографии отменена." #~ msgid "Spell check complete." #~ msgstr "Проверка орфографии завершена." #~ msgid "Autocorrect" #~ msgstr "Автокоррекция" #~ msgid "" #~ "You reached the end of the list\n" #~ "of matching items.\n" #~ msgstr "" #~ "Достигнут конец списка\n" #~ "совпадающих элементов.\n" #~ msgid "" #~ "The completion is ambiguous, more than one\n" #~ "match is available.\n" #~ msgstr "" #~ "Завершение неоднозначно, существует более\n" #~ "одного варианта.\n" #~ msgid "There is no matching item available.\n" #~ msgstr "Нет совпадающих элементов.\n" #~ msgid "Backspace" #~ msgstr "Backspace" #~ msgid "SysReq" #~ msgstr "SysReq" #~ msgid "CapsLock" #~ msgstr "CapsLock" #~ msgid "NumLock" #~ msgstr "NumLock" #~ msgid "ScrollLock" #~ msgstr "ScrollLock" #~ msgid "PageUp" #~ msgstr "PageUp" #~ msgid "PageDown" #~ msgstr "PageDown" #~ msgid "Again" #~ msgstr "Снова" #~ msgid "Props" #~ msgstr "Свойства" #~ msgid "Undo" #~ msgstr "Отменить" #~ msgid "Front" #~ msgstr "Фронт" #~ msgid "Copy" #~ msgstr "Копировать" #~ msgid "Open" #~ msgstr "Открыть" #~ msgid "Paste" #~ msgstr "Вставить" #~ msgid "Find" #~ msgstr "Найти" #~ msgid "Cut" #~ msgstr "Вырезать" #~ msgid "&OK" #~ msgstr "&ОК" #~ msgid "&Cancel" #~ msgstr "О&тмена" #~ msgid "&Yes" #~ msgstr "&Да" #~ msgid "Yes" #~ msgstr "Да" #~ msgid "&No" #~ msgstr "&Нет" #~ msgid "No" #~ msgstr "Нет" #~ msgid "&Discard" #~ msgstr "От&клонить" #~ msgid "Discard changes" #~ msgstr "Сбросить изменения" #~ msgid "" #~ "Pressing this button will discard all recent changes made in this dialog." #~ msgstr "Нажатие этой кнопки сбросит все изменения в текущем диалоге." #~ msgid "Save data" #~ msgstr "Сохранить данные" #~ msgid "&Do Not Save" #~ msgstr "&Не сохранять" #~ msgid "Do not save data" #~ msgstr "Не сохранять данные" #~ msgid "Save file with another name" #~ msgstr "Сохранить файл под другим именем" #~ msgid "&Apply" #~ msgstr "&Применить" #~ msgid "Apply changes" #~ msgstr "Применить изменения" #~ msgid "" #~ "When you click Apply, the settings will be handed over to the " #~ "program, but the dialog will not be closed.\n" #~ "Use this to try different settings." #~ msgstr "" #~ "При нажатии кнопки Применить параметры будут переданы в программу, " #~ "но окно параметров не будет закрыто.\n" #~ "Благодаря этому вы можете попробовать различные варианты настройки." #~ msgid "Administrator &Mode..." #~ msgstr "&Режим администратора..." #~ msgid "Enter Administrator Mode" #~ msgstr "Вход с правами администратора" #~ msgid "" #~ "When you click Administrator Mode you will be prompted for the " #~ "administrator (root) password in order to make changes which require root " #~ "privileges." #~ msgstr "" #~ "При нажатии кнопки Режим администратора будет запрошен пароль " #~ "администратора (root), поскольку действия нужно будет выполнять с правами " #~ "этого пользователя." #~ msgid "Clear input" #~ msgstr "Очистить ввод" #~ msgid "Clear the input in the edit field" #~ msgstr "Очистить ввод в строке редактирования" #~ msgid "Show help" #~ msgstr "Показать справку" #~ msgid "Close the current window or document" #~ msgstr "Закрыть текущее окно или документ" #~ msgid "&Close Window" #~ msgstr "&Закрыть окно" #~ msgid "Close the current window." #~ msgstr "Закрыть текущее окно" #~ msgid "&Close Document" #~ msgstr "&Закрыть документ" #~ msgid "Close the current document." #~ msgstr "Закрыть текущий документ." #~ msgid "&Defaults" #~ msgstr "По &умолчанию" #~ msgid "Reset all items to their default values" #~ msgstr "Восстановить значения по умолчанию" #~ msgid "Go back one step" #~ msgstr "Вернуться на шаг назад" #~ msgid "Go forward one step" #~ msgstr "Перейти на шаг вперёд" #~ msgid "Opens the print dialog to print the current document" #~ msgstr "Открывает диалог печати для печати текущего документа" #~ msgid "C&ontinue" #~ msgstr "Пр&одолжить" #~ msgid "Continue operation" #~ msgstr "Продолжить действие" #~ msgid "&Delete" #~ msgstr "&Удалить" #~ msgid "Delete item(s)" #~ msgstr "Удалить элементы" #~ msgid "Open file" #~ msgstr "Открыть файл" #~ msgid "&Reset" #~ msgstr "Сб&рос" #~ msgid "Reset configuration" #~ msgstr "Сбросить конфигурацию" #~ msgctxt "Verb" #~ msgid "&Insert" #~ msgstr "&Вставить" #~ msgid "Confi&gure..." #~ msgstr "&Настроить..." #~ msgid "Add" #~ msgstr "Добавить" #~ msgid "Test" #~ msgstr "Проверить" #~ msgid "Properties" #~ msgstr "Свойства" #~ msgid "&Overwrite" #~ msgstr "&Заменить" #~ msgid "Redo" #~ msgstr "Повторить" #~ msgid "&Available:" #~ msgstr "&Доступные:" #~ msgid "&Selected:" #~ msgstr "&Выбранные:" #~ msgctxt "KCharSelect section name" #~ msgid "European Alphabets" #~ msgstr "Европейские" #~ msgctxt "KCharSelect section name" #~ msgid "African Scripts" #~ msgstr "Африканские" #~ msgctxt "KCharSelect section name" #~ msgid "Middle Eastern Scripts" #~ msgstr "Ближневосточные" #~ msgctxt "KCharSelect section name" #~ msgid "South Asian Scripts" #~ msgstr "Южной Азии" #~ msgctxt "KCharSelect section name" #~ msgid "Philippine Scripts" #~ msgstr "Филиппинские" #~ msgctxt "KCharSelect section name" #~ msgid "South East Asian Scripts" #~ msgstr "Юго-Восточной Азии" #~ msgctxt "KCharSelect section name" #~ msgid "East Asian Scripts" #~ msgstr "Восточно-Азиатские" #~ msgctxt "KCharSelect section name" #~ msgid "Central Asian Scripts" #~ msgstr "Центрально-Азиатские" #~ msgctxt "KCharSelect section name" #~ msgid "Other Scripts" #~ msgstr "Другие" #~ msgctxt "KCharSelect section name" #~ msgid "Symbols" #~ msgstr "Символы" #~ msgctxt "KCharSelect section name" #~ msgid "Mathematical Symbols" #~ msgstr "Математические символы" #~ msgctxt "KCharSelect section name" #~ msgid "Phonetic Symbols" #~ msgstr "Фонетические символы" #~ msgctxt "KCharSelect section name" #~ msgid "Combining Diacritical Marks" #~ msgstr "Диакритические знаки" #~ msgctxt "KCharSelect section name" #~ msgid "Other" #~ msgstr "Другие" #~ msgctxt "KCharselect unicode block name" #~ msgid "Basic Latin" #~ msgstr "Основная латиница" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin-1 Supplement" #~ msgstr "Дополнение латиницы 1" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-A" #~ msgstr "Расширенная латиница-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-B" #~ msgstr "Расширенная латиница-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "IPA Extensions" #~ msgstr "Расширенный набор IPA" #~ msgctxt "KCharselect unicode block name" #~ msgid "Spacing Modifier Letters" #~ msgstr "Модификаторы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Diacritical Marks" #~ msgstr "Диакритические знаки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Greek and Coptic" #~ msgstr "Греческий и коптский алфавиты" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic" #~ msgstr "Кириллица" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic Supplement" #~ msgstr "Дополнительные символы кириллицы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Armenian" #~ msgstr "Армянский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hebrew" #~ msgstr "Иврит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic" #~ msgstr "Арабское письмо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Syriac" #~ msgstr "Сирийский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic Supplement" #~ msgstr "Дополнительные символы арабского письма" #~ msgctxt "KCharselect unicode block name" #~ msgid "Thaana" #~ msgstr "Тана" #~ msgctxt "KCharselect unicode block name" #~ msgid "NKo" #~ msgstr "Нко" #~ msgctxt "KCharselect unicode block name" #~ msgid "Samaritan" #~ msgstr "Самаритянская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Mandaic" #~ msgstr "Мандейская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Devanagari" #~ msgstr "Деванагари" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bengali" #~ msgstr "Бенгальская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Gurmukhi" #~ msgstr "Гурмукхи" #~ msgctxt "KCharselect unicode block name" #~ msgid "Gujarati" #~ msgstr "Гуджарати" #~ msgctxt "KCharselect unicode block name" #~ msgid "Oriya" #~ msgstr "Ория" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tamil" #~ msgstr "Тамильская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Telugu" #~ msgstr "Телугу" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kannada" #~ msgstr "Каннада" #~ msgctxt "KCharselect unicode block name" #~ msgid "Malayalam" #~ msgstr "Малаялам" #~ msgctxt "KCharselect unicode block name" #~ msgid "Sinhala" #~ msgstr "Сингальская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Thai" #~ msgstr "Тайская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Lao" #~ msgstr "Лаосская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tibetan" #~ msgstr "Тибетская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Myanmar" #~ msgstr "Мьянманская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Georgian" #~ msgstr "Грузинский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Jamo" #~ msgstr "Хангыль" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic" #~ msgstr "Эфиопская слоговая письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic Supplement" #~ msgstr "Дополнительные символы эфиопской письменности" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cherokee" #~ msgstr "Письменность чероки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Unified Canadian Aboriginal Syllabics" #~ msgstr "Канадское слоговое письмо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ogham" #~ msgstr "Огам" #~ msgctxt "KCharselect unicode block name" #~ msgid "Runic" #~ msgstr "Руническая письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tagalog" #~ msgstr "Тагальская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hanunoo" #~ msgstr "Хануноо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Buhid" #~ msgstr "Бухид" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tagbanwa" #~ msgstr "Тагбанва" #~ msgctxt "KCharselect unicode block name" #~ msgid "Khmer" #~ msgstr "Кхмерская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Mongolian" #~ msgstr "Старомонгольская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Unified Canadian Aboriginal Syllabics Extended" #~ msgstr "Расширенное канадское слоговое письмо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Limbu" #~ msgstr "Письменность лимбу" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tai Le" #~ msgstr "Письменность тай лэ" #~ msgctxt "KCharselect unicode block name" #~ msgid "New Tai Lue" #~ msgstr "Новый алфавит тай лы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Khmer Symbols" #~ msgstr "Кхмерские символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Buginese" #~ msgstr "Бугийская письменность" # http://en.wikipedia.org/wiki/Tai_Tham_script --aspotashev # http://ru.wikipedia.org/wiki/Ланна --aspotashev # http://www.omniglot.com/writing/lanna.htm --aspotashev #~ msgctxt "KCharselect unicode block name" #~ msgid "Tai Tham" #~ msgstr "Письменность Ланна" #~ msgctxt "KCharselect unicode block name" #~ msgid "Balinese" #~ msgstr "Балийская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Sundanese" #~ msgstr "Сунданская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Batak" #~ msgstr "Батакская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Lepcha" #~ msgstr "Лепча" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ol Chiki" #~ msgstr "Алфавит сантали" #~ msgctxt "KCharselect unicode block name" #~ msgid "Vedic Extensions" #~ msgstr "Расширение для ведийского санскрита" #~ msgctxt "KCharselect unicode block name" #~ msgid "Phonetic Extensions" #~ msgstr "Фонетические расширения" #~ msgctxt "KCharselect unicode block name" #~ msgid "Phonetic Extensions Supplement" #~ msgstr "Дополнительные фонетические расширения" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Diacritical Marks Supplement" #~ msgstr "Дополнительные комбинируемые диакритические знаки для символов" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended Additional" #~ msgstr "Дополнительная расширенная латиница" #~ msgctxt "KCharselect unicode block name" #~ msgid "Greek Extended" #~ msgstr "Расширенный набор символов греческого алфавита" #~ msgctxt "KCharselect unicode block name" #~ msgid "General Punctuation" #~ msgstr "Знаки пунктуации" #~ msgctxt "KCharselect unicode block name" #~ msgid "Superscripts and Subscripts" #~ msgstr "Надстрочные и подстрочные знаки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Currency Symbols" #~ msgstr "Символы валют" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Diacritical Marks for Symbols" #~ msgstr "Комбинируемые диакритические знаки для символов" #~ msgctxt "KCharselect unicode block name" #~ msgid "Letterlike Symbols" #~ msgstr "Буквообразные символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Number Forms" #~ msgstr "Числовые формы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arrows" #~ msgstr "Стрелки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Mathematical Operators" #~ msgstr "Математические операторы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Technical" #~ msgstr "Разнообразные технические символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Control Pictures" #~ msgstr "Значки управляющих кодов" #~ msgctxt "KCharselect unicode block name" #~ msgid "Optical Character Recognition" #~ msgstr "Символы оптического распознавания" #~ msgctxt "KCharselect unicode block name" #~ msgid "Enclosed Alphanumerics" #~ msgstr "Вложенные буквы и цифры" #~ msgctxt "KCharselect unicode block name" #~ msgid "Box Drawing" #~ msgstr "Символы рисования рамок" #~ msgctxt "KCharselect unicode block name" #~ msgid "Block Elements" #~ msgstr "Символы заполнения" #~ msgctxt "KCharselect unicode block name" #~ msgid "Geometric Shapes" #~ msgstr "Геометрические фигуры" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Symbols" #~ msgstr "Разнообразные символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Dingbats" #~ msgstr "Знаки орнамента" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Mathematical Symbols-A" #~ msgstr "Разнообразные математические символы-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Arrows-A" #~ msgstr "Дополнительные стрелки-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Braille Patterns" #~ msgstr "Азбука Брайля" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Arrows-B" #~ msgstr "Дополнительные стрелки-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Mathematical Symbols-B" #~ msgstr "Разнообразные математические символы-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Mathematical Operators" #~ msgstr "Дополнительные математические операторы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Symbols and Arrows" #~ msgstr "Разнообразные символы и стрелки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Glagolitic" #~ msgstr "Глаголица" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-C" #~ msgstr "Расширенная латиница-C" #~ msgctxt "KCharselect unicode block name" #~ msgid "Coptic" #~ msgstr "Коптский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Georgian Supplement" #~ msgstr "Дополнительные символы грузинского алфавита" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tifinagh" #~ msgstr "Тифинаг" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic Extended" #~ msgstr "Расширенный набор символов эфиопского письма" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic Extended-A" #~ msgstr "Кириллица (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Punctuation" #~ msgstr "Дополнительные знаки пунктуации" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Radicals Supplement" #~ msgstr "Дополнительные иероглифические ключи ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kangxi Radicals" #~ msgstr "Иероглифические ключи словаря Канси" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ideographic Description Characters" #~ msgstr "Символы описания иероглифов" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Symbols and Punctuation" #~ msgstr "Символы и пунктуация ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hiragana" #~ msgstr "Хирагана" #~ msgctxt "KCharselect unicode block name" #~ msgid "Katakana" #~ msgstr "Катакана" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bopomofo" #~ msgstr "Бопомофо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Compatibility Jamo" #~ msgstr "Чамо, комбинируемое с хангылем" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kanbun" #~ msgstr "Канбун" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bopomofo Extended" #~ msgstr "Расширенный набор символов бопомофо" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Strokes" #~ msgstr "Черты ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Katakana Phonetic Extensions" #~ msgstr "Фонетические расширения катаканы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Enclosed CJK Letters and Months" #~ msgstr "Вложенные буквы и месяцы ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Compatibility" #~ msgstr "Знаки совместимости ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Unified Ideographs Extension A" #~ msgstr "Унифицированные иероглифы ККЯ (расширение А)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Yijing Hexagram Symbols" #~ msgstr "Гексаграммы Ицзин" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Unified Ideographs" #~ msgstr "Унифицированные иероглифы ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Yi Syllables" #~ msgstr "Слоги письма и" #~ msgctxt "KCharselect unicode block name" #~ msgid "Yi Radicals" #~ msgstr "Иероглифические ключи письма и" #~ msgctxt "KCharselect unicode block name" #~ msgid "Lisu" #~ msgstr "Письменность лису" #~ msgctxt "KCharselect unicode block name" #~ msgid "Vai" #~ msgstr "Письменность ваи" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic Extended-B" #~ msgstr "Кириллица (расширение B)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bamum" #~ msgstr "Письменность бамум" #~ msgctxt "KCharselect unicode block name" #~ msgid "Modifier Tone Letters" #~ msgstr "Символы изменения тона" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-D" #~ msgstr "Расширенная латиница-D" #~ msgctxt "KCharselect unicode block name" #~ msgid "Syloti Nagri" #~ msgstr "Силоти Нагри" #~ msgctxt "KCharselect unicode block name" #~ msgid "Common Indic Number Forms" #~ msgstr "Индийские числовые знаки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Phags-pa" #~ msgstr "Квадратное письмо Пагба-ламы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Saurashtra" #~ msgstr "Письменность саураштра" #~ msgctxt "KCharselect unicode block name" #~ msgid "Devanagari Extended" #~ msgstr "Деванагари (расширение)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kayah Li" #~ msgstr "Письменность кайя" #~ msgctxt "KCharselect unicode block name" #~ msgid "Rejang" #~ msgstr "Письменность реджанг" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Jamo Extended-A" #~ msgstr "Хангыль (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Javanese" #~ msgstr "Яванская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cham" #~ msgstr "Чамская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Myanmar Extended-A" #~ msgstr "Мьянманская письменность (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tai Viet" #~ msgstr "Письменность Тай Вьет" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic Extended-A" #~ msgstr "Эфиопская письменность (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Meetei Mayek" #~ msgstr "Письменность манипури" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Syllables" #~ msgstr "Слоги хангыля" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Jamo Extended-B" #~ msgstr "Хангыль (расширение B)" #~ msgctxt "KCharselect unicode block name" #~ msgid "High Surrogates" #~ msgstr "Верхняя часть суррогатных пар" #~ msgctxt "KCharselect unicode block name" #~ msgid "High Private Use Surrogates" #~ msgstr "Верхняя часть суррогатных пар для частного использования" #~ msgctxt "KCharselect unicode block name" #~ msgid "Low Surrogates" #~ msgstr "Нижняя часть суррогатных пар" #~ msgctxt "KCharselect unicode block name" #~ msgid "Private Use Area" #~ msgstr "Область для частного использования" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Compatibility Ideographs" #~ msgstr "Совместимые иероглифы ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Alphabetic Presentation Forms" #~ msgstr "Алфавитные формы представления" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic Presentation Forms-A" #~ msgstr "Формы представления арабских букв-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Variation Selectors" #~ msgstr "Селекторы вариантов начертания" #~ msgctxt "KCharselect unicode block name" #~ msgid "Vertical Forms" #~ msgstr "Вертикальные формы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Half Marks" #~ msgstr "Комбинируемые половинки символов" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Compatibility Forms" #~ msgstr "Формы совместимости ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Small Form Variants" #~ msgstr "Варианты малого размера" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic Presentation Forms-B" #~ msgstr "Формы представления арабских букв-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "Halfwidth and Fullwidth Forms" #~ msgstr "Полуширинные и полноширинные формы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Specials" #~ msgstr "Специальные символы" #~ msgid "Enter a search term or character here" #~ msgstr "Введите критерий поиска или символ" #~ msgctxt "Goes to previous character" #~ msgid "Previous in History" #~ msgstr "Предыдущий символ в списке" #~ msgid "Previous Character in History" #~ msgstr "Предыдущий символ в списке" #~ msgctxt "Goes to next character" #~ msgid "Next in History" #~ msgstr "Следующий символ в списке" #~ msgid "Next Character in History" #~ msgstr "Следующий символ в списке" #~ msgid "Select a category" #~ msgstr "Выбор группы" #~ msgid "Select a block to be displayed" #~ msgstr "Выбор блока" #~ msgid "Set font" #~ msgstr "Задать шрифт" #~ msgid "Set font size" #~ msgstr "Задать размер шрифта" #~ msgid "Character:" #~ msgstr "Символ:" #~ msgid "Name: " #~ msgstr "Имя: " #~ msgid "Annotations and Cross References" #~ msgstr "Аннотации и перекрёстные ссылки" #~ msgid "Alias names:" #~ msgstr "Другие представления:" #~ msgid "Notes:" #~ msgstr "Примечания:" #~ msgid "See also:" #~ msgstr "См. также:" #~ msgid "Equivalents:" #~ msgstr "Эквиваленты:" #~ msgid "Approximate equivalents:" #~ msgstr "Приблизительные эквиваленты:" #~ msgid "CJK Ideograph Information" #~ msgstr "Сведение об иероглифе CJK" #~ msgid "Definition in English: " #~ msgstr "Определение на английском: " #~ msgid "Mandarin Pronunciation: " #~ msgstr "Произношение на мандаринском наречии: " #~ msgid "Cantonese Pronunciation: " #~ msgstr "Произношение на кантонском наречии: " #~ msgid "Japanese On Pronunciation: " #~ msgstr "Произношение на онъёми: " #~ msgid "Japanese Kun Pronunciation: " #~ msgstr "Произношение на кунъёми: " #~ msgid "Tang Pronunciation: " #~ msgstr "Произношение Танг: " #~ msgid "Korean Pronunciation: " #~ msgstr "Произношение на корейском: " #~ msgid "General Character Properties" #~ msgstr "Общие сведения о символе" #~ msgid "Block: " #~ msgstr "Блок: " #~ msgid "Unicode category: " #~ msgstr "Категория Юникода: " #~ msgid "Various Useful Representations" #~ msgstr "Полезные представления" #~ msgid "UTF-8:" #~ msgstr "UTF-8:" #~ msgid "UTF-16: " #~ msgstr "UTF-16: " #~ msgid "C octal escaped UTF-8: " #~ msgstr "Восьмеричный код в UTF-8 на языке C: " #~ msgid "XML decimal entity:" #~ msgstr "Десятичное представление в XML:" #~ msgid "Unicode code point:" #~ msgstr "Код Юникода: " #~ msgctxt "Character" #~ msgid "In decimal:" #~ msgstr "В десятичном виде:" #~ msgid "" #~ msgstr "<заменитель в верхнем регистре>" #~ msgid "" #~ msgstr "<пользовательский заменитель в верхнем регистре>" #~ msgid "" #~ msgstr "<заменитель в нижнем регистре>" #~ msgid "" #~ msgstr "<пользовательский символ>" #~ msgid "" #~ msgstr "<не присвоен>" #~ msgid "Non-printable" #~ msgstr "Непечатный" #~ msgid "Other, Control" #~ msgstr "разное, управляющий" #~ msgid "Other, Format" #~ msgstr "разное, форматирующий" #~ msgid "Other, Not Assigned" #~ msgstr "разное, не присвоенный" #~ msgid "Other, Private Use" #~ msgstr "разное, пользовательский" #~ msgid "Other, Surrogate" #~ msgstr "разное, заменитель" #~ msgid "Letter, Lowercase" #~ msgstr "буква в нижнем регистре" #~ msgid "Letter, Modifier" #~ msgstr "буква, модификатор" #~ msgid "Letter, Other" #~ msgstr "буква, разное" #~ msgid "Letter, Titlecase" #~ msgstr "буква, для заголовков" #~ msgid "Letter, Uppercase" #~ msgstr "буква (верхний регистр)" #~ msgid "Mark, Spacing Combining" #~ msgstr "отметка, промежуток" #~ msgid "Mark, Enclosing" #~ msgstr "отметка, символ в скобках" #~ msgid "Mark, Non-Spacing" #~ msgstr "отметка, без промежутков" #~ msgid "Number, Decimal Digit" #~ msgstr "число, десятичная цифра" #~ msgid "Number, Letter" #~ msgstr "число, буква" #~ msgid "Number, Other" #~ msgstr "число, разное" #~ msgid "Punctuation, Connector" #~ msgstr "знак пунктуации, соединитель" #~ msgid "Punctuation, Dash" #~ msgstr "знак пунктуации, тире" #~ msgid "Punctuation, Close" #~ msgstr "закрывающий знак пунктуации" #~ msgid "Punctuation, Final Quote" #~ msgstr "знак пунктуации, закрывающая кавычка" #~ msgid "Punctuation, Initial Quote" #~ msgstr "знак пунктуации, открывающая кавычка" #~ msgid "Punctuation, Other" #~ msgstr "знак пунктуации, разное" #~ msgid "Punctuation, Open" #~ msgstr "открывающий знак пунктуации" #~ msgid "Symbol, Currency" #~ msgstr "символ валюты" #~ msgid "Symbol, Modifier" #~ msgstr "символ, модификатор" #~ msgid "Symbol, Math" #~ msgstr "математический символ" #~ msgid "Symbol, Other" #~ msgstr "символ, разное" #~ msgid "Separator, Line" #~ msgstr "разделитель строки" #~ msgid "Separator, Paragraph" #~ msgstr "разделитель абзаца" #~ msgid "Separator, Space" #~ msgstr "пробел" #~ msgid "You will be asked to authenticate before saving" #~ msgstr "Перед сохранением настроек нужно будет подтвердить вход в систему" #~ msgid "You are not allowed to save the configuration" #~ msgstr "У вас нет прав на изменение этих настроек" #~ msgctxt "@option next year" #~ msgid "Next Year" #~ msgstr "Следующий год" #~ msgctxt "@option today" #~ msgid "Today" #~ msgstr "Сегодня" #~ msgctxt "@option yesterday" #~ msgid "Yesterday" #~ msgstr "Вчера" #~ msgctxt "@option do not specify a date" #~ msgid "No Date" #~ msgstr "Нет даты" #~ msgctxt "@info" #~ msgid "The date you entered is invalid" #~ msgstr "Введена недопустимая дата" #~ msgctxt "@info" #~ msgid "Date cannot be earlier than %1" #~ msgstr "Дата не может быть раньше %1" #~ msgctxt "@info" #~ msgid "Date cannot be later than %1" #~ msgstr "Дата не может быть позднее %1" #~ msgid "Week %1" #~ msgstr "Неделя %1" #~ msgid "Previous year" #~ msgstr "Предыдущий год" #~ msgid "Next month" #~ msgstr "Следующий месяц" #~ msgid "Previous month" #~ msgstr "Предыдущий месяц" #~ msgid "Select a week" #~ msgstr "Выберите неделю" #~ msgid "Select a month" #~ msgstr "Выберите месяц" #~ msgid "Select a year" #~ msgstr "Выберите год" #~ msgid "Select the current day" #~ msgstr "Выбрать текущий день" #~ msgctxt "UTC time zone" #~ msgid "UTC" #~ msgstr "UTC" #~ msgctxt "No specific time zone" #~ msgid "Floating" #~ msgstr "Не определён" #~ msgctxt "@info" #~ msgid "" #~ "The entered date and time is before the minimum allowed date and time." #~ msgstr "" #~ "Введённые дата и время раньше минимальных допустимых даты и времени." #~ msgctxt "@info" #~ msgid "" #~ "The entered date and time is after the maximum allowed date and time." #~ msgstr "" #~ "Введённые дата и время позже максимальных допустимых даты и времени." #~ msgid "&Add" #~ msgstr "Доб&авить" #~ msgid "&Remove" #~ msgstr "&Удалить" #~ msgid "Move &Up" #~ msgstr "Переместить вв&ерх" #~ msgid "Move &Down" #~ msgstr "Переместить &вниз" #~ msgid "&Help" #~ msgstr "&Справка" #~ msgid "Clear &History" #~ msgstr "Очистить &хронологию" #~ msgid "No further items in the history." #~ msgstr "Нет больше элементов в списке." # [https://bugs.kde.org/show_bug.cgi?id=254400] BUGME: В названии действия не удаляется акселератор. Пока что будем делать это вручную (Transcript) # --aspotashev #~ msgid "Shortcut '%1' in Application %2 for action %3\n" #~ msgstr "Комбинация клавиш «%1» в приложении %2 для действия «%3»\n" #~ msgctxt "" #~ "%1 is the number of conflicts (hidden), %2 is the key sequence of the " #~ "shortcut that is problematic" #~ msgid "The shortcut '%2' conflicts with the following key combination:\n" #~ msgid_plural "" #~ "The shortcut '%2' conflicts with the following key combinations:\n" #~ msgstr[0] "" #~ "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" #~ msgstr[1] "" #~ "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" #~ msgstr[2] "" #~ "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" #~ msgstr[3] "" #~ "Комбинация клавиш «%2» конфликтует со следующей комбинацией клавиш:\n" #~ msgctxt "%1 is the number of shortcuts with which there is a conflict" #~ msgid "Conflict with Registered Global Shortcut" #~ msgid_plural "Conflict with Registered Global Shortcuts" #~ msgstr[0] "Конфликт с глобальными комбинациями клавиш" #~ msgstr[1] "Конфликт с глобальными комбинациями клавиш" #~ msgstr[2] "Конфликт с глобальными комбинациями клавиш" #~ msgstr[3] "Конфликт с глобальной комбинацией клавиш" #~ msgctxt "%1 is the number of conflicts" #~ msgid "Shortcut Conflict" #~ msgid_plural "Shortcut Conflicts" #~ msgstr[0] "Конфликты комбинаций клавиш" #~ msgstr[1] "Конфликты комбинаций клавиш" #~ msgstr[2] "Конфликты комбинаций клавиш" #~ msgstr[3] "Конфликт комбинаций клавиш" #~ msgid "Shortcut '%1' for action '%2'\n" #~ msgstr "Комбинация клавиш «%1» для действия «%2»\n" #~ msgctxt "%1 is the number of ambigious shortcut clashes (hidden)" #~ msgid "" #~ "The \"%2\" shortcut is ambiguous with the following shortcut.\n" #~ "Do you want to assign an empty shortcut to this action?\n" #~ "%3" #~ msgid_plural "" #~ "The \"%2\" shortcut is ambiguous with the following shortcuts.\n" #~ "Do you want to assign an empty shortcut to these actions?\n" #~ "%3" #~ msgstr[0] "" #~ "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями " #~ "клавиш.\n" #~ "Отменить назначение комбинации клавиш для указанных действий?\n" #~ "\n" #~ "%3" #~ msgstr[1] "" #~ "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями " #~ "клавиш.\n" #~ "Отменить назначение комбинации клавиш для указанных действий?\n" #~ "\n" #~ "%3" #~ msgstr[2] "" #~ "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями " #~ "клавиш.\n" #~ "Отменить назначение комбинации клавиш для указанных действий?\n" #~ "\n" #~ "%3" #~ msgstr[3] "" #~ "Комбинация клавиш «%2» конфликтует с приведённой ниже комбинацией " #~ "клавиш.\n" #~ "Отменить назначение комбинации клавиш для указанного действия?\n" #~ "\n" #~ "%3" #~ msgid "Shortcut conflict" #~ msgstr "Конфликт комбинации клавиш" #~ msgid "" #~ "The '%1' key combination is already used by the %2 action." #~ "
    Please select a different one.    " #~ msgstr "" #~ "Комбинация клавиш %1 уже связана с действием %2.
    Выберите " #~ "уникальную комбинацию клавиш.    " #~ msgid "" #~ "Click on the button, then enter the shortcut like you would in the " #~ "program.\n" #~ "Example for Ctrl+a: hold the Ctrl key and press a." #~ msgstr "" #~ "Нажмите на кнопке и введите комбинацию клавиш.\n" #~ "Например, для комбинации клавиш Ctrl+A зажмите клавишу Ctrl и нажмите A." #~ msgid "Reserved Shortcut" #~ msgstr "Зарезервированная комбинация клавиш" #~ msgid "" #~ "The F12 key is reserved on Windows, so cannot be used for a global " #~ "shortcut.\n" #~ "Please choose another one." #~ msgstr "" #~ "В Windows клавиша F12 зарезервирована, поэтому её нельзя использовать в " #~ "глобальных комбинациях клавиш.\n" #~ "Выберите другую комбинацию клавиш." #~ msgid "Conflict with Standard Application Shortcut" #~ msgstr "Конфликт со стандартной клавишей приложения" #~ msgid "" #~ "The '%1' key combination is also used for the standard action \"%2\" that " #~ "some applications use.\n" #~ "Do you really want to use it as a global shortcut as well?" #~ msgstr "" #~ "Комбинация клавиш %1 уже связана со стандартным действием «%2», " #~ "используемым во многих программах.\n" #~ "Вы действительно хотите использовать эту комбинацию как глобальную?" #~ msgctxt "What the user inputs now will be taken as the new shortcut" #~ msgid "Input" #~ msgstr "Сейчас" #~ msgid "The key you just pressed is not supported by Qt." #~ msgstr "Нажатая клавиша не поддерживается в Qt." #~ msgid "Unsupported Key" #~ msgstr "Клавиша не поддерживается" #~ msgid "without name" #~ msgstr "без имени" #~ msgctxt "Italic placeholder text in line edits: 0 no, 1 yes" #~ msgid "1" #~ msgstr "1" #~ msgctxt "@action:button Clear current text in the line edit" #~ msgid "Clear text" #~ msgstr "Очистить текст" #~ msgctxt "@title:menu" #~ msgid "Text Completion" #~ msgstr "Дополнение текста" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "None" #~ msgstr "Нет" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Manual" #~ msgstr "Вручную" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Automatic" #~ msgstr "Автоматически" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Dropdown List" #~ msgstr "Из выпадающего списка" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Short Automatic" #~ msgstr "Полуавтоматически" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Dropdown List && Automatic" #~ msgstr "Из выпадающего списка и автоматически" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Default" #~ msgstr "По умолчанию" #~ msgid "Image Operations" #~ msgstr "Операции с изображением" #~ msgid "&Rotate Clockwise" #~ msgstr "&Повернуть по часовой стрелке" #~ msgid "Rotate &Counterclockwise" #~ msgstr "П&овернуть против часовой стрелки" #~ msgctxt "@action" #~ msgid "Text &Color..." #~ msgstr "&Цвет текста..." #~ msgctxt "@label stroke color" #~ msgid "Color" #~ msgstr "Цвет" #~ msgctxt "@action" #~ msgid "Text &Highlight..." #~ msgstr "Подсветка текста..." #~ msgctxt "@action" #~ msgid "&Font" #~ msgstr "&Шрифт" #~ msgctxt "@action" #~ msgid "Font &Size" #~ msgstr "&Размер шрифта" #~ msgctxt "@action boldify selected text" #~ msgid "&Bold" #~ msgstr "Полу&жирный" #~ msgctxt "@action italicize selected text" #~ msgid "&Italic" #~ msgstr "&Курсив" #~ msgctxt "@action underline selected text" #~ msgid "&Underline" #~ msgstr "&Подчёркнутый" #~ msgctxt "@action" #~ msgid "&Strike Out" #~ msgstr "П&еречёркнутый" #~ msgctxt "@action" #~ msgid "Align &Left" #~ msgstr "По &левому краю" #~ msgctxt "@label left justify" #~ msgid "Left" #~ msgstr "По левому краю" #~ msgctxt "@action" #~ msgid "Align &Center" #~ msgstr "По &центру" #~ msgctxt "@label center justify" #~ msgid "Center" #~ msgstr "По центру" #~ msgctxt "@action" #~ msgid "Align &Right" #~ msgstr "По &правому краю" #~ msgctxt "@label right justify" #~ msgid "Right" #~ msgstr "По правому краю" #~ msgctxt "@action" #~ msgid "&Justify" #~ msgstr "По &ширине" #~ msgctxt "@label justify fill" #~ msgid "Justify" #~ msgstr "По ширине" #~ msgctxt "@action" #~ msgid "Left-to-Right" #~ msgstr "Письмо слева направо" #~ msgctxt "@label left-to-right" #~ msgid "Left-to-Right" #~ msgstr "Слева направо" #~ msgctxt "@action" #~ msgid "Right-to-Left" #~ msgstr "Письмо справа налево" #~ msgctxt "@label right-to-left" #~ msgid "Right-to-Left" #~ msgstr "Справа налево" #~ msgctxt "@title:menu" #~ msgid "List Style" #~ msgstr "Стиль списка" #~ msgctxt "@item:inmenu no list style" #~ msgid "None" #~ msgstr "Нет" #~ msgctxt "@item:inmenu disc list style" #~ msgid "Disc" #~ msgstr "Диски" #~ msgctxt "@item:inmenu circle list style" #~ msgid "Circle" #~ msgstr "Кружки" #~ msgctxt "@item:inmenu square list style" #~ msgid "Square" #~ msgstr "Квадраты" #~ msgctxt "@item:inmenu numbered lists" #~ msgid "123" #~ msgstr "123" #~ msgctxt "@item:inmenu lowercase abc lists" #~ msgid "abc" #~ msgstr "abc" #~ msgctxt "@item:inmenu uppercase abc lists" #~ msgid "ABC" #~ msgstr "ABC" #~ msgctxt "@item:inmenu lower case roman numerals" #~ msgid "i ii iii" #~ msgstr "i ii iii" #~ msgctxt "@item:inmenu upper case roman numerals" #~ msgid "I II III" #~ msgstr "I II III" #~ msgctxt "@action" #~ msgid "Increase Indent" #~ msgstr "Увеличить отступ" #~ msgctxt "@action" #~ msgid "Decrease Indent" #~ msgstr "Уменьшить отступ" #~ msgctxt "@action" #~ msgid "Insert Rule Line" #~ msgstr "Вставить горизонтальную линию" #~ msgctxt "@action" #~ msgid "Link" #~ msgstr "Ссылка" #~ msgctxt "@action" #~ msgid "Format Painter" #~ msgstr "Преобразовать в текст с форматированием" #~ msgctxt "@action" #~ msgid "To Plain Text" #~ msgstr "Преобразовать в обычный текст" #~ msgctxt "@action" #~ msgid "Subscript" #~ msgstr "Нижний индекс" #~ msgctxt "@action" #~ msgid "Superscript" #~ msgstr "Верхний индекс" #~ msgid "&Copy Full Text" #~ msgstr "&Копировать весь текст" #~ msgid "Nothing to spell check." #~ msgstr "Нечего проверять." #~ msgid "Speak Text" #~ msgstr "Зачитать текст" #~ msgid "Starting Jovie Text-to-Speech Service Failed" #~ msgstr "Не удалось запустить службу синтеза речи Jovie" #~ msgid "No suggestions for %1" #~ msgstr "Нет вариантов для %1" #~ msgid "Ignore" #~ msgstr "Пропустить" #~ msgid "Add to Dictionary" #~ msgstr "Добавить в словарь" #~ msgctxt "@info" #~ msgid "The time you entered is invalid" #~ msgstr "Введено недопустимое время" #~ msgctxt "@info" #~ msgid "Time cannot be earlier than %1" #~ msgstr "Время не может быть раньше %1" #~ msgctxt "@info" #~ msgid "Time cannot be later than %1" #~ msgstr "Время не может быть позднее %1" #~ msgctxt "Define an area in the time zone, like a town area" #~ msgid "Area" #~ msgstr "Регион" #~ msgctxt "Time zone" #~ msgid "Region" #~ msgstr "Область" #~ msgid "Comment" #~ msgstr "Комментарий" # "Подпись кнопки"? (на данный момент она одна, 22 марта 2011 г.) --aspotashev #~ msgctxt "@title:menu" #~ msgid "Show Text" #~ msgstr "Подписи кнопок" #~ msgctxt "@title:menu" #~ msgid "Toolbar Settings" #~ msgstr "Меню панели инструментов" #~ msgctxt "Toolbar orientation" #~ msgid "Orientation" #~ msgstr "Ориентация" #~ msgctxt "toolbar position string" #~ msgid "Top" #~ msgstr "Вверху" #~ msgctxt "toolbar position string" #~ msgid "Left" #~ msgstr "Слева" #~ msgctxt "toolbar position string" #~ msgid "Right" #~ msgstr "Справа" #~ msgctxt "toolbar position string" #~ msgid "Bottom" #~ msgstr "Внизу" #~ msgid "Text Position" #~ msgstr "Положение текста" #~ msgid "Icons Only" #~ msgstr "Только значки" #~ msgid "Text Only" #~ msgstr "Только подписи" #~ msgid "Text Alongside Icons" #~ msgstr "Подписи сбоку от значков" #~ msgid "Text Under Icons" #~ msgstr "Подписи под значками" #~ msgid "Icon Size" #~ msgstr "Размер значков" #~ msgctxt "@item:inmenu Icon size" #~ msgid "Default" #~ msgstr "По умолчанию" #~ msgid "Small (%1x%2)" #~ msgstr "Малые (%1x%2)" #~ msgid "Medium (%1x%2)" #~ msgstr "Средние (%1x%2)" #~ msgid "Large (%1x%2)" #~ msgstr "Большие (%1x%2)" #~ msgid "Huge (%1x%2)" #~ msgstr "Очень большие (%1x%2)" #~ msgid "Lock Toolbar Positions" #~ msgstr "Заблокировать панели инструментов" #~ msgctxt "@action:intoolbar Text label of toolbar button" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@info:tooltip Tooltip of toolbar button" #~ msgid "%1" #~ msgstr "%1" #~ msgid "Desktop %1" #~ msgstr "Рабочий стол %1" #~ msgid "Add to Toolbar" #~ msgstr "Добавить на панель инструментов" #~ msgid "Configure Shortcut..." #~ msgstr "Настроить комбинацию клавиш..." #~ msgid "Toolbars Shown" #~ msgstr "Видимые панели инструментов" #~ msgid "No text" #~ msgstr "Нет текста" #~ msgid "&File" #~ msgstr "&Файл" #~ msgid "&Game" #~ msgstr "&Игра" #~ msgid "&Edit" #~ msgstr "&Правка" #~ msgctxt "@title:menu Game move" #~ msgid "&Move" #~ msgstr "&Ход" #~ msgid "&View" #~ msgstr "&Вид" #~ msgid "&Go" #~ msgstr "Пере&ход" #~ msgid "&Bookmarks" #~ msgstr "&Закладки" #~ msgid "&Tools" #~ msgstr "С&ервис" #~ msgid "&Settings" #~ msgstr "&Настройка" #~ msgid "Main Toolbar" #~ msgstr "Основная панель инструментов" #~ msgid "Builds Qt widget plugins from an ini style description file." #~ msgstr "Создаёт расширения виджетов Qt из файла описания стилей." #~ msgid "Input file" #~ msgstr "Файл ввода" #~ msgid "Output file" #~ msgstr "Файл вывода" #~ msgid "Name of the plugin class to generate" #~ msgstr "Имя создаваемого класса расширения" #~ msgid "Default widget group name to display in designer" #~ msgstr "Имя группы виджетов по умолчанию для показа в дизайнере" #~ msgid "makekdewidgets" #~ msgstr "makekdewidgets" #~ msgid "(C) 2004-2005 Ian Reinhart Geiser" #~ msgstr "© Ian Reinhart Geiser, 2004-2005" #~ msgid "Ian Reinhart Geiser" #~ msgstr "Ian Reinhart Geiser" #~ msgid "Daniel Molkentin" #~ msgstr "Daniel Molkentin" #~ msgid "Call Stack" #~ msgstr "Стек вызовов" #~ msgid "Call" #~ msgstr "Вызов" #~ msgid "Line" #~ msgstr "Строка" #~ msgid "Console" #~ msgstr "Консоль" #~ msgid "Enter" #~ msgstr "Enter" #~ msgid "" #~ "Unable to find the Kate editor component;\n" #~ "please check your KDE installation." #~ msgstr "" #~ "Не удалось найти компонент текстового редактора Kate.\n" #~ "Проверьте правильность установки KDE." #~ msgid "Breakpoint" #~ msgstr "Точка останова" #~ msgid "JavaScript Debugger" #~ msgstr "Отладчик JavaScript" #~ msgid "&Break at Next Statement" #~ msgstr "П&рерывание на следующем операторе" #~ msgid "Break at Next" #~ msgstr "Прервать на следующем операторе" #~ msgid "Continue" #~ msgstr "Продолжить" #~ msgid "Step Over" #~ msgstr "Перейти на следующую строку" #~ msgid "Step Into" #~ msgstr "Войти в функцию" #~ msgid "Step Out" #~ msgstr "Выполнить функцию" #~ msgid "Reindent Sources" #~ msgstr "Выровнять отступы" #~ msgid "Report Exceptions" #~ msgstr "Сообщить об ошибке" #~ msgid "&Debug" #~ msgstr "&Отладка" #~ msgid "Close source" #~ msgstr "Закрыть исходный код" #~ msgid "Ready" #~ msgstr "Готово" #~ msgid "Parse error at %1 line %2" #~ msgstr "Ошибка разбора %1 в строке %2" #~ msgid "" #~ "An error occurred while attempting to run a script on this page.\n" #~ "\n" #~ "%1 line %2:\n" #~ "%3" #~ msgstr "" #~ "Произошла ошибка при попытке выполнить скрипт на этой странице.\n" #~ "\n" #~ "%1 строка %2:\n" #~ "%3" #~ msgid "" #~ "Do not know where to evaluate the expression. Please pause a script or " #~ "open a source file." #~ msgstr "" #~ "Неизвестно, в чём выполнять выражение. Остановите выполнение скрипта или " #~ "откройте файл с исходным кодом." #~ msgid "Evaluation threw an exception %1" #~ msgstr "Появление исключения %1 при выполнении" #~ msgid "JavaScript Error" #~ msgstr "Ошибка JavaScript" #~ msgid "&Do not show this message again" #~ msgstr "&Не выводить больше это сообщение" #~ msgid "Local Variables" #~ msgstr "Локальные переменные" #~ msgid "Reference" #~ msgstr "Ссылка" #~ msgid "Loaded Scripts" #~ msgstr "Загруженные скрипты" #~ msgid "" #~ "A script on this page is causing KHTML to freeze. If it continues to run, " #~ "other applications may become less responsive.\n" #~ "Do you want to stop the script?" #~ msgstr "" #~ "Сценарий на этой странице привёл к зависанию KHTML. Если он продолжит " #~ "работать, другие приложения будут отзываться медленнее.\n" #~ "Прервать работу сценария?" #~ msgid "JavaScript" #~ msgstr "JavaScript" #~ msgid "&Stop Script" #~ msgstr "&Остановить сценарий" #~ msgid "Confirmation: JavaScript Popup" #~ msgstr "Подтверждение: Всплывающее окно Javascript" #~ msgid "" #~ "This site is submitting a form which will open up a new browser window " #~ "via JavaScript.\n" #~ "Do you want to allow the form to be submitted?" #~ msgstr "" #~ "Этот сайт пытается отправить форму, что приведёт к открытию нового окна " #~ "браузера с помощью JavaScript.\n" #~ "Разрешить?" #~ msgid "" #~ "This site is submitting a form which will open

    %1

    in a new " #~ "browser window via JavaScript.
    Do you want to allow the form to be " #~ "submitted?    " #~ msgstr "" #~ " Этот сайт пытается отправить форму, что приведёт к открытию

    %1 в новом окне браузера с помощью JavaScript.
    Разрешить?" #~ msgid "Allow" #~ msgstr "Разрешить" #~ msgid "Do Not Allow" #~ msgstr "Запретить" #~ msgid "" #~ "This site is requesting to open up a new browser window via JavaScript.\n" #~ "Do you want to allow this?" #~ msgstr "" #~ "Этот сайт пытается открыть новое окно с использованием Javascript.\n" #~ "Разрешить открыть окно?" #~ msgid "" #~ "This site is requesting to open

    %1

    in a new browser window via " #~ "JavaScript.
    Do you want to allow this?    " #~ msgstr "" #~ "Этот сайт пытается открыть

    %1

    в новом окне браузера с помощью " #~ "JavaScript.
    Разрешить?    " #~ msgid "Close window?" #~ msgstr "Закрыть окно?" #~ msgid "Confirmation Required" #~ msgstr "Требуется подтверждение" #~ msgid "" #~ "Do you want a bookmark pointing to the location \"%1\" to be added to " #~ "your collection?" #~ msgstr "Добавить закладку на адрес «%1» в вашу коллекцию?" #~ msgid "" #~ "Do you want a bookmark pointing to the location \"%1\" titled \"%2\" to " #~ "be added to your collection?" #~ msgstr "Добавить закладку на адрес «%1» с заголовком «%2» в вашу коллекцию?" #~ msgid "JavaScript Attempted Bookmark Insert" #~ msgstr "JavaScript пытается добавить закладку" #~ msgid "Insert" #~ msgstr "Вставить" #~ msgid "Disallow" #~ msgstr "Запретить" #~ msgid "" #~ "The following files will not be uploaded because they could not be " #~ "found.\n" #~ "Do you want to continue?" #~ msgstr "" #~ "Указанные файлы не могут быть загружены, поскольку они не найдены.\n" #~ "Продолжить?" #~ msgid "Submit Confirmation" #~ msgstr "Подтверждение отправки" #~ msgid "&Submit Anyway" #~ msgstr "&Отправить" #~ msgid "" #~ "You are about to transfer the following files from your local computer to " #~ "the Internet.\n" #~ "Do you really want to continue?" #~ msgstr "" #~ "Была запрошена передача следующих файлов с этого компьютера в Интернет.\n" #~ "Продолжить?" #~ msgid "Send Confirmation" #~ msgstr "Подтверждение передачи" #~ msgid "&Send File" #~ msgid_plural "&Send Files" #~ msgstr[0] "&Отправить файлы" #~ msgstr[1] "&Отправить файлы" #~ msgstr[2] "&Отправить файлы" #~ msgstr[3] "&Отправить файл" #~ msgid "Key Generator" #~ msgstr "Генератор ключа" #~ msgid "" #~ "No plugin found for '%1'.\n" #~ "Do you want to download one from %2?" #~ msgstr "" #~ "Не обнаружено расширение для «%1».\n" #~ "Загрузить его с адреса %2?" #~ msgid "Missing Plugin" #~ msgstr "Отсутствует расширение" #~ msgid "Download" #~ msgstr "Загрузить" #~ msgid "Do Not Download" #~ msgstr "Не загружать" #~ msgid "This is a searchable index. Enter search keywords: " #~ msgstr "Это индекс с возможностью поиска. Введите ключевые слова: " #~ msgid "Document Information" #~ msgstr "Сведения о документе" #~ msgctxt "@title:group Document information" #~ msgid "General" #~ msgstr "Главное" #~ msgid "URL:" #~ msgstr "Ссылка:" #~ msgid "Title:" #~ msgstr "Заголовок:" #~ msgid "Last modified:" #~ msgstr "Последнее изменение:" #~ msgid "Document encoding:" #~ msgstr "Кодировка документа:" #~ msgid "Rendering mode:" #~ msgstr "Режим показа HTML:" #~ msgid "HTTP Headers" #~ msgstr "Заголовки HTTP" #~ msgid "Property" #~ msgstr "Параметр" #~ msgid "Initializing Applet \"%1\"..." #~ msgstr "Открывается аплет «%1»..." #~ msgid "Starting Applet \"%1\"..." #~ msgstr "Запускается аплет «%1»..." #~ msgid "Applet \"%1\" started" #~ msgstr "Аплет «%1» запущен" #~ msgid "Applet \"%1\" stopped" #~ msgstr "Аплет «%1» остановлен" #~ msgid "Loading Applet" #~ msgstr "Загрузка аплета" #~ msgid "Error: java executable not found" #~ msgstr "Ошибка: не найдена программа java" #~ msgid "Signed by (validation: %1)" #~ msgstr "Подписано (подлинность: %1)" #~ msgid "Certificate (validation: %1)" #~ msgstr "Сертификат (подлинность: %1) " #~ msgid "Security Alert" #~ msgstr "Извещение системы безопасности" #~ msgid "Do you grant Java applet with certificate(s):" #~ msgstr "Запускать аплеты Java с сертификатами:" #~ msgid "the following permission" #~ msgstr "следующие права" #~ msgid "&Reject All" #~ msgstr "&Отклонить все" #~ msgid "&Grant All" #~ msgstr "&Принять все" #~ msgid "Applet Parameters" #~ msgstr "Параметры аплета" #~ msgid "Parameter" #~ msgstr "Параметр" #~ msgid "Class" #~ msgstr "Класс" #~ msgid "Base URL" #~ msgstr "Базовый URL" #~ msgid "Archives" #~ msgstr "Архивы" #~ msgid "KDE Java Applet Plugin" #~ msgstr "Поддержка аплетов Java для среды KDE" #~ msgid "HTML Toolbar" #~ msgstr "Панель инструментов HTML" #~ msgid "&Copy Text" #~ msgstr "&Копировать текст" #~ msgid "Open '%1'" #~ msgstr "Открыть %1" #~ msgid "&Copy Email Address" #~ msgstr "Скопировать &адрес электронной почты" #~ msgid "&Save Link As..." #~ msgstr "Сохранить сс&ылку как..." #~ msgid "&Copy Link Address" #~ msgstr "С&копировать адрес ссылки" #~ msgctxt "@title:menu HTML frame/iframe" #~ msgid "Frame" #~ msgstr "Фрейм" #~ msgid "Open in New &Window" #~ msgstr "Открыть в &новом окне" #~ msgid "Open in &This Window" #~ msgstr "Открыть в &текущем окне" #~ msgid "Open in &New Tab" #~ msgstr "Открыть в новой &вкладке" #~ msgid "Reload Frame" #~ msgstr "Обновить фрейм" #~ msgid "Print Frame..." #~ msgstr "Печать фрейма..." #~ msgid "Save &Frame As..." #~ msgstr "Сохранить &фрейм как..." #~ msgid "View Frame Source" #~ msgstr "Просмотреть исходный текст фрейма" #~ msgid "View Frame Information" #~ msgstr "Сведения о фрейме" #~ msgid "Block IFrame..." #~ msgstr "Заблокировать IFrame..." #~ msgid "Save Image As..." #~ msgstr "Сохранить изображение как..." #~ msgid "Send Image..." #~ msgstr "Отправить изображение..." #~ msgid "Copy Image" #~ msgstr "Скопировать изображение" #~ msgid "Copy Image Location" #~ msgstr "Скопировать ссылку на изображение" #~ msgid "View Image (%1)" #~ msgstr "Просмотр изображения (%1)" #~ msgid "Block Image..." #~ msgstr "Заблокировать изображение..." #~ msgid "Block Images From %1" #~ msgstr "Заблокировать изображения от %1" #~ msgid "Stop Animations" #~ msgstr "Остановить анимацию" #~ msgid "Search for '%1' with %2" #~ msgstr "Поиск «%1» в %2" #~ msgid "Search for '%1' with" #~ msgstr "Поиск «%1» в" #~ msgid "Save Link As" #~ msgstr "Сохранить конечный документ как" #~ msgid "Save Image As" #~ msgstr "Сохранить изображение как" #~ msgid "Add URL to Filter" #~ msgstr "Добавление адреса в фильтр" #~ msgid "Enter the URL:" #~ msgstr "Введите адрес:" #~ msgid "" #~ "A file named \"%1\" already exists. Are you sure you want to overwrite it?" #~ msgstr "Файл с именем «%1» уже существует. Заменить его?" #~ msgid "Overwrite File?" #~ msgstr "Заменить файл?" #~ msgid "Overwrite" #~ msgstr "Заменить" #~ msgid "The Download Manager (%1) could not be found in your $PATH " #~ msgstr "Не удалось найти программу менеджера загрузки (%1) в $PATH." #~ msgid "" #~ "Try to reinstall it \n" #~ "\n" #~ "The integration with Konqueror will be disabled." #~ msgstr "" #~ "Попробуйте переустановить программу.\n" #~ "\n" #~ "Интеграция с Konqueror будет выключена." #~ msgid "Default Font Size (100%)" #~ msgstr "Размер шрифта по умолчанию (100%)" #~ msgid "KHTML" #~ msgstr "KHTML" #~ msgid "Embeddable HTML component" #~ msgstr "Встраиваемый компонент для показа HTML" #~ msgid "Lars Knoll" #~ msgstr "Lars Knoll" #~ msgid "Antti Koivisto" #~ msgstr "Antti Koivisto" #~ msgid "Dirk Mueller" #~ msgstr "Dirk Mueller" #~ msgid "Peter Kelly" #~ msgstr "Peter Kelly" #~ msgid "Torben Weis" #~ msgstr "Torben Weis" #~ msgid "Martin Jones" #~ msgstr "Martin Jones" #~ msgid "Simon Hausmann" #~ msgstr "Simon Hausmann" #~ msgid "Tobias Anton" #~ msgstr "Tobias Anton" #~ msgid "View Do&cument Source" #~ msgstr "Просмотреть исходный текст до&кумента" #~ msgid "View Document Information" #~ msgstr "Просмотреть сведения о документе" #~ msgid "Save &Background Image As..." #~ msgstr "Сохранить фоновое &изображение как..." #~ msgid "SSL" #~ msgstr "SSL" #~ msgid "Print Rendering Tree to STDOUT" #~ msgstr "Вывести дерево прорисовки на STDOUT" #~ msgid "Print DOM Tree to STDOUT" #~ msgstr "Вывести дерево DOM на STDOUT" #~ msgid "Print frame tree to STDOUT" #~ msgstr "Вывести дерево фреймов на STDOUT" #~ msgid "Stop Animated Images" #~ msgstr "Остановить анимацию рисунков" #~ msgid "Set &Encoding" #~ msgstr "&Кодировка..." #~ msgid "Use S&tylesheet" #~ msgstr "Использовать таблицу &стилей" #~ msgid "Enlarge Font" #~ msgstr "Увеличить шрифт" #~ msgid "" #~ "Enlarge Font

    Make the font in this window bigger. Click " #~ "and hold down the mouse button for a menu with all available font sizes." #~ msgstr "" #~ "Увеличить шрифт

    Увеличить шрифт в этом окне. Нажмите и " #~ "удерживайте кнопку мыши для показа меню с доступными размерами шрифта." #~ msgid "Shrink Font" #~ msgstr "Уменьшить шрифт" #~ msgid "" #~ "Shrink Font

    Make the font in this window smaller. Click " #~ "and hold down the mouse button for a menu with all available font sizes." #~ msgstr "" #~ "Уменьшить шрифт

    Уменьшить шрифт в этом окне. Нажмите и " #~ "удерживайте кнопку мыши для показа меню с доступными размерами шрифта." #~ msgid "" #~ "Find text

    Shows a dialog that allows you to find text on " #~ "the displayed page.    " #~ msgstr "" #~ "Найти текст

    Диалог поиска текста на текущей странице.    " #~ msgid "" #~ "Find next

    Find the next occurrence of the text that you " #~ "have found using the Find Text function.    " #~ msgstr "" #~ "Найти далее

    Поиск следующего вхождения текста, указанного " #~ "в поле Найти текст.    " #~ msgid "" #~ "Find previous

    Find the previous occurrence of the text " #~ "that you have found using the Find Text function.    " #~ msgstr "" #~ "Найти предыдущее

    Поиск предыдущего вхождения текста, " #~ "указанного в поле Найти текст.    " #~ msgid "Find Text as You Type" #~ msgstr "Поиск текста по мере набора" #~ msgid "" #~ "This shortcut shows the find bar, for finding text in the displayed page. " #~ "It cancels the effect of \"Find Links as You Type\", which sets the " #~ "\"Find links only\" option." #~ msgstr "" #~ "Эта комбинация клавиш вызывает панель для поиска текста на текущей " #~ "странице. Это отключит функцию поиска ссылок по набору." #~ msgid "Find Links as You Type" #~ msgstr "Поиск ссылок по мере набора" #~ msgid "" #~ "This shortcut shows the find bar, and sets the option \"Find links only\"." #~ msgstr "" #~ "Эта комбинация клавиш вызывает панель для поиска ссылок на текущей " #~ "странице." #~ msgid "" #~ "Print Frame

    Some pages have several frames. To print only " #~ "a single frame, click on it and then use this function.    " #~ msgstr "" #~ "Печать фрейма

    Некоторые страницы могут содержать несколько " #~ "фреймов. Чтобы напечатать только один фрейм, нажмите на нем и используйте " #~ "эту функцию.    " #~ msgid "Toggle Caret Mode" #~ msgstr "Переключи&ть режим вставки/замены" #~ msgid "The fake user-agent '%1' is in use." #~ msgstr "Используется подложный идентификатор браузера «%1»." #~ msgid "This web page contains coding errors." #~ msgstr "Эта веб-страница содержит ошибки кодирования." #~ msgid "&Hide Errors" #~ msgstr "&Скрыть ошибки" #~ msgid "&Disable Error Reporting" #~ msgstr "&Запретить сообщения об ошибках" #~ msgid "Error: %1: %2" #~ msgstr "Ошибка: %1: %2" #~ msgid "Error: node %1: %2" #~ msgstr "Ошибка: узел %1: %2" #~ msgid "Display Images on Page" #~ msgstr "Показать изображения на странице" #~ msgid "Error: %1 - %2" #~ msgstr "Ошибка: %1 — %2" #~ msgid "The requested operation could not be completed" #~ msgstr "Не удалось завершить запрошенную операцию" #~ msgid "Technical Reason: " #~ msgstr "Техническая причина: " #~ msgid "Details of the Request:" #~ msgstr "Подробности запроса:" #~ msgid "URL: %1" #~ msgstr "Адрес URL: %1" #~ msgid "Protocol: %1" #~ msgstr "Протокол: %1" #~ msgid "Date and Time: %1" #~ msgstr "Дата и время: %1" #~ msgid "Additional Information: %1" #~ msgstr "Дополнительная информация: %1" #~ msgid "Description:" #~ msgstr "Описание:" #~ msgid "Possible Causes:" #~ msgstr "Возможные причины:" #~ msgid "Possible Solutions:" #~ msgstr "Возможные решения:" #~ msgid "Page loaded." #~ msgstr "Страница загружена." #~ msgid "%1 Image of %2 loaded." #~ msgid_plural "%1 Images of %2 loaded." #~ msgstr[0] "Загружено изображений: %1 из %2" #~ msgstr[1] "Загружено изображений: %1 из %2" #~ msgstr[2] "Загружено изображений: %1 из %2" #~ msgstr[3] "Загружено изображений: %1 из %2" #~ msgid "Automatic Detection" #~ msgstr "Автоматическое определение" #~ msgid " (In new window)" #~ msgstr " (В новом окне)" #~ msgid "Symbolic Link" #~ msgstr "Символическая ссылка" #~ msgid "%1 (Link)" #~ msgstr "%1 (Ссылка)" #~ msgid "%2 (%1 byte)" #~ msgid_plural "%2 (%1 bytes)" #~ msgstr[0] "%2 (%1 байт)" #~ msgstr[1] "%2 (%1 байта)" #~ msgstr[2] "%2 (%1 байт)" #~ msgstr[3] "%2 (%1 байт)" #~ msgid "%2 (%1 K)" #~ msgstr "%2 (%1 К)" #~ msgid " (In other frame)" #~ msgstr " (В другом фрейме)" #~ msgid "Email to: " #~ msgstr "Написать письмо: " #~ msgid " - Subject: " #~ msgstr " - Тема: " #~ msgid " - CC: " #~ msgstr " - Копия: " #~ msgid " - BCC: " #~ msgstr " - Скрытая копия: " #~ msgid "Save As" #~ msgstr "Сохранить как" #~ msgid "" #~ "This untrusted page links to
    %1.
    Do you want to " #~ "follow the link?    " #~ msgstr "" #~ "Данная непроверенная страница содержит ссылку
    %1.
    Перейти по ссылке?    " #~ msgid "Follow" #~ msgstr "Перейти" #~ msgid "Frame Information" #~ msgstr "Сведения о фрейме" #~ msgid " [Properties]" #~ msgstr " [свойства]" #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" #~ msgid "Quirks" #~ msgstr "Режим совместимости" #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" #~ msgid "Almost standards" #~ msgstr "Почти соответствующий стандартам" #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" #~ msgid "Strict" #~ msgstr "Строгое соответствие стандартам" #~ msgid "Save Background Image As" #~ msgstr "Сохранить фоновое изображение..." #~ msgid "The peer SSL certificate chain appears to be corrupt." #~ msgstr "Похоже, цепочка сертификатов повреждена." #~ msgid "Save Frame As" #~ msgstr "Сохранить фрейм..." #~ msgid "&Find in Frame..." #~ msgstr "&Поиск во фрейме..." #~ msgid "" #~ "Warning: This is a secure form but it is attempting to send your data " #~ "back unencrypted.\n" #~ "A third party may be able to intercept and view this information.\n" #~ "Are you sure you wish to continue?" #~ msgstr "" #~ "Внимание: это защищённая форма, но она пытается вернуть ваши данные назад " #~ "в незашифрованном виде.\n" #~ "Третья сторона может перехватить и просмотреть эту информацию.\n" #~ "Продолжить?" #~ msgid "Network Transmission" #~ msgstr "Передача по сети" #~ msgid "&Send Unencrypted" #~ msgstr "&Отправить незашифрованным" #~ msgid "" #~ "Warning: Your data is about to be transmitted across the network " #~ "unencrypted.\n" #~ "Are you sure you wish to continue?" #~ msgstr "" #~ "Внимание: ваши данные будут передаваться по сети в незащищённом виде.\n" #~ "Продолжить?" #~ msgid "" #~ "This site is attempting to submit form data via email.\n" #~ "Do you want to continue?" #~ msgstr "" #~ "Попытка передачи данных формы на сайт по электронной почте.\n" #~ "Действительно хотите продолжить?" #~ msgid "&Send Email" #~ msgstr "&Отправить" #~ msgid "" #~ "The form will be submitted to
    %1
    on your local " #~ "filesystem.
    Do you want to submit the form?    " #~ msgstr "" #~ "Форма будет передана файлу
    %1
    на локальной " #~ "файловой системе.
    Отправить данные формы?    " #~ msgid "" #~ "This site attempted to attach a file from your computer in the form " #~ "submission. The attachment was removed for your protection." #~ msgstr "" #~ "Попытка присоединения локального файла к данным формы для отправки на " #~ "сайт. Ради вашей безопасности приложенный файл был удалён." #~ msgid "(%1/s)" #~ msgstr "(%1/с)" #~ msgid "Security Warning" #~ msgstr "Предупреждение системы безопасности" #~ msgid "Access by untrusted page to
    %1
    denied.    " #~ msgstr "" #~ "Доступ с ненадёжной страницы на
    %1
    запрещён.    " #~ msgid "The wallet '%1' is open and being used for form data and passwords." #~ msgstr "Бумажник «%1» открыт и используется для ввода данных и паролей." #~ msgid "&Close Wallet" #~ msgstr "&Закрыть бумажник" #~ msgid "&Allow storing passwords for this site" #~ msgstr "&Позволить сохранять пароли для этого сайта" #~ msgid "Remove password for form %1" #~ msgstr "Удалить пароль для формы %1" #~ msgid "JavaScript &Debugger" #~ msgstr "Отла&дчик JavaScript" #~ msgid "This page was prevented from opening a new window via JavaScript." #~ msgstr "Сайт пытается открыть новое окно с использованием Javascript." #~ msgid "Popup Window Blocked" #~ msgstr "Заблокировано всплывающее окно" #~ msgid "" #~ "This page has attempted to open a popup window but was blocked.\n" #~ "You can click on this icon in the status bar to control this behavior\n" #~ "or to open the popup." #~ msgstr "" #~ "Заблокировано всплывающее окно, которое пыталась открыть страница.\n" #~ "Этой функцией можно управлять, щёлкая на строке состояния,\n" #~ "чтобы разрешить или запретить всплывающее окно." #~ msgid "&Show Blocked Popup Window" #~ msgid_plural "&Show %1 Blocked Popup Windows" #~ msgstr[0] "По&казать %1 заблокированное всплывающее окно" #~ msgstr[1] "По&казать %1 заблокированных всплывающих окна" #~ msgstr[2] "По&казать %1 заблокированных всплывающих окон" #~ msgstr[3] "По&казать %1 заблокированное всплывающее окно" #~ msgid "Show Blocked Window Passive Popup &Notification" #~ msgstr "&Уведомлять о заблокированных всплывающих окнах" #~ msgid "&Configure JavaScript New Window Policies..." #~ msgstr "&Настроить правила для новых окон JavaScript..." #~ msgid "" #~ "

    'Print images'

    If this checkbox is enabled, " #~ "images contained in the HTML page will be printed. Printing may take " #~ "longer and use more ink or toner.

    If this checkbox is disabled, " #~ "only the text of the HTML page will be printed, without the included " #~ "images. Printing will be faster and use less ink or toner.

    " #~ msgstr "" #~ "

    Печатать изображения

    Если этот флажок " #~ "установлен, изображения на веб-странице будут распечатаны вместе с " #~ "текстом. Однако печататься страница с ними будет больше и будет " #~ "использовано больше чернил или тонера.

    Если флажок выключен, будет " #~ "распечатан только текст веб-страницы. В этом случае печать закончиться " #~ "быстрее и вы потратите меньше чернил или тонера.

    " #~ msgid "" #~ "

    'Print header'

    If this checkbox is enabled, " #~ "the printout of the HTML document will contain a header line at the top " #~ "of each page. This header contains the current date, the location URL of " #~ "the printed page and the page number.

    If this checkbox is disabled, " #~ "the printout of the HTML document will not contain such a header line. " #~ msgstr "" #~ "

    Печатать заголовок

    Если этот флажок " #~ "установлен, на каждой странице распечатки документа в формате HTML будет " #~ "заголовок, содержащий текущую дату, адрес (URL) этой страницы и номер " #~ "страницы.

    " #~ msgid "" #~ "

    'Printerfriendly mode'

    If this checkbox is " #~ "enabled, the printout of the HTML document will be black and white only, " #~ "and all colored background will be converted into white. Printout will be " #~ "faster and use less ink or toner.

    If this checkbox is disabled, the " #~ "printout of the HTML document will happen in the original color settings " #~ "as you see in your application. This may result in areas of full-page " #~ "color (or grayscale, if you use a black+white printer). Printout will " #~ "possibly happen more slowly and will probably use more toner or ink.

    " #~ "    " #~ msgstr "" #~ "

    Экономный режим

    Если этот параметр включён, " #~ "распечатка документа в формате HTML будет только черно-белой, любой " #~ "цветной фон будет преобразован в белый. Печать будет быстрее и будет " #~ "использоваться меньше чернил или тонера.

    Если этот параметр " #~ "выключен, распечатка документа в формате HTML будет иметь такие же цвета, " #~ "как вы видите в приложении. Результатом может быть полностью цветная " #~ "страница (или с градациями серого, если принтер черно-белый). Печать " #~ "будет идти медленнее и использовать намного больше тонера или чернил.

    " #~ "    " #~ msgid "HTML Settings" #~ msgstr "Настройка HTML" #~ msgid "Printer friendly mode (black text, no background)" #~ msgstr "Экономный режим (чёрный текст, без фона)" #~ msgid "Print images" #~ msgstr "Печатать изображения" #~ msgid "Print header" #~ msgstr "Печатать заголовок" #~ msgid "Filter error" #~ msgstr "Ошибка фильтра" #~ msgid "Inactive" #~ msgstr "Неактивный" #~ msgid "%1 (%2 - %3x%4 Pixels)" #~ msgstr "%1 (%2 - %3x%4 пиксел)" #~ msgid "%1 - %2x%3 Pixels" #~ msgstr "%1 - %2x%3 пиксел" #~ msgid "%1 (%2x%3 Pixels)" #~ msgstr "%1 (%2x%3 пиксел)" #~ msgid "Image - %1x%2 Pixels" #~ msgstr "Изображение - %1x%2 пикселов" #~ msgid "Done." #~ msgstr "Готово." #~ msgid "Access Keys activated" #~ msgstr "Включено использование ключей доступа" #~ msgid "JavaScript Errors" #~ msgstr "Ошибки JavaScript" #~ msgid "" #~ "This dialog provides you with notification and details of scripting " #~ "errors that occur on web pages. In many cases it is due to an error in " #~ "the web site as designed by its author. In other cases it is the result " #~ "of a programming error in Konqueror. If you suspect the former, please " #~ "contact the webmaster of the site in question. Conversely if you suspect " #~ "an error in Konqueror, please file a bug report at http://bugs.kde.org/. " #~ "A test case which illustrates the problem will be appreciated." #~ msgstr "" #~ "В этом диалоге показаны ошибки скриптов на веб-страницах. Чаще всего они " #~ "обусловлены ошибками при создании веб-страниц, но иногда - ошибками в " #~ "Konqueror. В первом случае известите об ошибке веб-мастера сайта, если " #~ "же это всё-таки ошибка в Konqueror, отправьте сообщение об ошибке на " #~ "http://bugs.kde.org/. Пример, иллюстрирующий ошибку, поможет её " #~ "устранить." #~ msgid "KMultiPart" #~ msgstr "KMultiPart" #~ msgid "Embeddable component for multipart/mixed" #~ msgstr "Встраиваемый компонент для multipart/mixed" #~ msgid "Copyright 2001-2011, David Faure faure@kde.org" #~ msgstr "© David Faure faure@kde.org, 2001-2011" #~ msgid "No handler found for %1." #~ msgstr "Не найден обработчик для %1." #~ msgid "Play" #~ msgstr "Воспроизвести" #~ msgid "Pause" #~ msgstr "Пауза" #~ msgid "New Web Shortcut" #~ msgstr "Новое веб-сокращение" #~ msgid "%1 is already assigned to %2" #~ msgstr "%1 уже назначено для %2" #~ msgid "Search &provider name:" #~ msgstr "&Название поисковой системы:" #~ msgid "New search provider" #~ msgstr "Новая поисковая система" #~ msgid "UR&I shortcuts:" #~ msgstr "&Сокращения:" #~ msgid "Create Web Shortcut" #~ msgstr "Создать веб-сокращение" #~ msgid "Directory containing tests, basedir and output directories." #~ msgstr "" #~ "Каталог, содержащий тесты, базовый каталог и каталоги для сохранения " #~ "выводимых данных." #~ msgid "Do not suppress debug output" #~ msgstr "Показывать вывод отладки" #~ msgid "Regenerate baseline (instead of checking)" #~ msgstr "Восстановить исходный (вместо проверки)" #~ msgid "Do not show the window while running tests" #~ msgstr "Не показывать окно при выполнении тестов" #~ msgid "Only run a single test. Multiple options allowed." #~ msgstr "Запустить один тест. Можно указать несколько таких параметров." #~ msgid "Only run .js tests" #~ msgstr "Запустить только тесты .js" #~ msgid "Only run .html tests" #~ msgstr "Запустить только тесты .html" #~ msgid "Do not use Xvfb" #~ msgstr "Не использовать Xvfb" #~ msgid "Put output in <directory> instead of <base_dir>/output" #~ msgstr "" #~ "Сохранить вывод в <каталог> вместо файла <базовый_каталог>/" #~ "output" #~ msgid "" #~ "Use <directory> as reference instead of <base_dir>/baseline" #~ msgstr "" #~ "Использовать <каталог> в качестве каталога эталонных результатов " #~ "вместо <базовый_каталог>/baseline" #~ msgid "" #~ "Directory containing tests, basedir and output directories. Only regarded " #~ "if -b is not specified." #~ msgstr "" #~ "Каталог, содержащий тесты, базовый каталог и каталоги для сохранения " #~ "выводимых данных. Используется, если не указан параметр -b." #~ msgid "" #~ "Relative path to testcase, or directory of testcases to be run " #~ "(equivalent to -t)." #~ msgstr "Относительный путь к тестам или каталог с тестами (эквивалент -t)." #~ msgid "TestRegression" #~ msgstr "TestRegression" #~ msgid "Regression tester for khtml" #~ msgstr "Проверка регрессии в khtml" #~ msgid "KHTML Regression Testing Utility" #~ msgstr "Программа проверки KHTML на регрессию" #~ msgid "0" #~ msgstr "0" #~ msgid "Regression testing output" #~ msgstr "Вывод проверки на регрессию" #~ msgid "Pause/Continue regression testing process" #~ msgstr "Пауза или продолжение проверки на регрессию" #~ msgid "" #~ "You may select a file where the log content is stored, before the " #~ "regression testing is started." #~ msgstr "Перед началом проверки можно выбрать файл для сохранения протокола." #~ msgid "Output to File..." #~ msgstr "Сохранить результат проверки в файл..." #~ msgid "Regression Testing Status" #~ msgstr "Состояние проверки" #~ msgid "View HTML Output" #~ msgstr "Просмотреть вывод в HTML" #~ msgid "Settings" #~ msgstr "Настройка" #~ msgid "Tests" #~ msgstr "Тесты" #~ msgid "Only Run JS Tests" #~ msgstr "Запустить только проверку JS" #~ msgid "Only Run HTML Tests" #~ msgstr "Запустить только проверку HTML" #~ msgid "Do Not Suppress Debug Output" #~ msgstr "Показывать вывод отладки" #~ msgid "Run Tests..." #~ msgstr "Запустить проверку..." #~ msgid "Run Single Test..." #~ msgstr "Запустить отдельный тест..." #~ msgid "Specify tests Directory..." #~ msgstr "Укажите каталог с тестами..." #~ msgid "Specify khtml Directory..." #~ msgstr "Укажите каталог khtml..." #~ msgid "Specify Output Directory..." #~ msgstr "Укажите каталог вывода..." #~ msgid "TestRegressionGui" #~ msgstr "TestRegressionGui" #~ msgid "GUI for the khtml regression tester" #~ msgstr "Графический интерфейс для поиска регрессии в khtml" #~ msgid "Available Tests: 0" #~ msgstr "Доступных тестов: 0" #~ msgid "Please choose a valid 'khtmltests/regression/' directory." #~ msgstr "Укажите правильный каталог «khtmltests/regression/»." #~ msgid "Please choose a valid 'khtml/' build directory." #~ msgstr "Укажите правильный каталог «khtml/»." #~ msgid "Available Tests: %1 (ignored: %2)" #~ msgstr "Доступных тестов: %1 (игнорировано: %2)" #~ msgid "Cannot find testregression executable." #~ msgstr "Не удалось найти программу testregression." #~ msgid "Run test..." #~ msgstr "Запустить тест..." #~ msgid "Add to ignores..." #~ msgstr "Игнорировать тест..." #~ msgid "Remove from ignores..." #~ msgstr "Вернуть тест из игнорируемых..." #~ msgid "URL to open" #~ msgstr "Открываемый URL" #~ msgid "Testkhtml" #~ msgstr "Testkhtml" #~ msgid "a basic web browser using the KHTML library" #~ msgstr "простой веб-браузер на базе движка KHTML" #~ msgid "Find &links only" #~ msgstr "Искать только &ссылки" #~ msgid "Not found" #~ msgstr "Не найдено" #~ msgid "No more matches for this search direction." #~ msgstr "Не найдено вхождений в выбранном направлении" #~ msgid "F&ind:" #~ msgstr "&Искать:" #~ msgid "&Next" #~ msgstr "&Следующее" #~ msgid "Opt&ions" #~ msgstr "&Параметры" #~ msgid "Do you want to store this password?" #~ msgstr "Сохранить пароль?" #~ msgid "Do you want to store this password for %1?" #~ msgstr "Сохранить пароль для %1?" #~ msgid "&Store" #~ msgstr "&Сохранить" #~ msgid "Ne&ver store for this site" #~ msgstr "&Никогда для этого сайта" #~ msgid "Do ¬ store this time" #~ msgstr "В другой &раз" #~ msgid "Basic Page Style" #~ msgstr "Основной стиль страницы" #~ msgid "the document is not in the correct file format" #~ msgstr "документ содержит данные некорректного формата" #~ msgid "fatal parsing error: %1 in line %2, column %3" #~ msgstr "критическая ошибка обработки: %1 в строке %2, позиция %3" #~ msgid "XML parsing error" #~ msgstr "ошибка при разборе XML" #~ msgid "" #~ "Unable to start new process.\n" #~ "The system may have reached the maximum number of open files possible or " #~ "the maximum number of open files that you are allowed to use has been " #~ "reached." #~ msgstr "" #~ "Не удалось запустить процесс.\n" #~ "Возможно, превышен предел количества открытых файлов в системе или для " #~ "пользователя." #~ msgid "" #~ "Unable to create new process.\n" #~ "The system may have reached the maximum number of processes possible or " #~ "the maximum number of processes that you are allowed to use has been " #~ "reached." #~ msgstr "" #~ "Не удалось создать процесс.\n" #~ "Возможно, превышен предел количества запущенных процессов в системе или " #~ "для пользователя." #~ msgid "Could not find '%1' executable." #~ msgstr "Не удалось найти исполняемый файл «%1»." #~ msgid "" #~ "Could not open library '%1'.\n" #~ "%2" #~ msgstr "" #~ "Не удалось открыть библиотеку «%1».\n" #~ "%2" #~ msgid "" #~ "Could not find 'kdemain' in '%1'.\n" #~ "%2" #~ msgstr "" #~ "Не удалось найти «kdemain» в «%1».\n" #~ "%2" #~ msgid "KDEInit could not launch '%1'" #~ msgstr "KDEInit не может запустить «%1»" #~ msgid "Could not find service '%1'." #~ msgstr "Не удалось найти службу «%1»." #~ msgid "Service '%1' must be executable to run." #~ msgstr "Служба «%1» должна быть сделана выполняемой для запуска." #~ msgid "Service '%1' is malformatted." #~ msgstr "Служба «%1» имеет неверный формат." #~ msgid "Launching %1" #~ msgstr "Запускается %1" #~ msgid "Unknown protocol '%1'.\n" #~ msgstr "Неизвестный протокол «%1».\n" #~ msgid "Error loading '%1'.\n" #~ msgstr "Ошибка загрузки «%1»:\n" #~ msgid "" #~ "klauncher: This program is not supposed to be started manually.\n" #~ "klauncher: It is started automatically by kdeinit4.\n" #~ msgstr "" #~ "klauncher: программа не должна запускаться вручную.\n" #~ "klauncher: запускается автоматически из kdeinit4.\n" #~ msgid "Evaluation error" #~ msgstr "Ошибка вычисления" #~ msgid "Range error" #~ msgstr "Ошибка границ" #~ msgid "Reference error" #~ msgstr "Ошибка ссылки" #~ msgid "Syntax error" #~ msgstr "Синтаксическая ошибка" #~ msgid "Type error" #~ msgstr "Ошибка типа" #~ msgid "URI error" #~ msgstr "Ошибка URI" #~ msgid "JS Calculator" #~ msgstr "Калькулятор JS" #~ msgctxt "addition" #~ msgid "+" #~ msgstr "+" #~ msgid "AC" #~ msgstr "Сброс" #~ msgctxt "subtraction" #~ msgid "-" #~ msgstr "-" #~ msgctxt "evaluation" #~ msgid "=" #~ msgstr "=" #~ msgid "CL" #~ msgstr "CL" #~ msgid "5" #~ msgstr "5" #~ msgid "3" #~ msgstr "3" #~ msgid "7" #~ msgstr "7" #~ msgid "8" #~ msgstr "8" #~ msgid "MainWindow" #~ msgstr "MainWindow" #~ msgid "

    KJSEmbed Documentation Viewer

    " #~ msgstr "

    Просмотр документации по KJSEmbed

    " #~ msgid "Execute" #~ msgstr "Выполнить" #~ msgid "File" #~ msgstr "Файл" #~ msgid "Open Script" #~ msgstr "Открыть скрипт" #~ msgid "Open a script..." #~ msgstr "Открытие скрипта..." #~ msgid "Ctrl+O" #~ msgstr "Ctrl+O" #~ msgid "Close Script" #~ msgstr "Закрыть скрипт" #~ msgid "Close script..." #~ msgstr "Закрытие скрипта..." #~ msgid "Quit" #~ msgstr "Выход" #~ msgid "Quit application..." #~ msgstr "Выход из приложения..." #~ msgid "Run" #~ msgstr "Запустить" #~ msgid "Run script..." #~ msgstr "Запуск скрипта..." #~ msgid "Run To..." #~ msgstr "Выполнение до позиции..." #~ msgid "Run to breakpoint..." #~ msgstr "Выполнение до точки останова..." #~ msgid "Step" #~ msgstr "Перейти на следующую строку" #~ msgid "Step to next line..." #~ msgstr "Продолжение выполнения до следующей строки..." #~ msgid "Step execution..." #~ msgstr "Остановка выполнения..." #~ msgid "KJSCmd" #~ msgstr "KJSCmd" #~ msgid "Utility for running KJSEmbed scripts \n" #~ msgstr "Программа для запуска скриптов KJSEmbed \n" #~ msgid "(C) 2005-2006 The KJSEmbed Authors" #~ msgstr "© Разработчики KJSEmbed, 2005-2006" #~ msgid "Execute script without gui support" #~ msgstr "Выполнить скрипт без графического интерфейса" #~ msgid "start interactive kjs interpreter" #~ msgstr "запустить интерактивный интерпретатор kjs" #~ msgid "start without KDE KApplication support." #~ msgstr "запустить без поддержки KDE KApplication." #~ msgid "Script to execute" #~ msgstr "Имя выполняемого скрипта" #~ msgid "Error encountered while processing include '%1' line %2: %3" #~ msgstr "Ошибка при выполнении include «%1» на строке %2: %3" #~ msgid "include only takes 1 argument, not %1." #~ msgstr "директива include требует один аргумент, а не %1." #~ msgid "File %1 not found." #~ msgstr "Файл %1 не найден." #~ msgid "library only takes 1 argument, not %1." #~ msgstr "библиотека требует один аргумент, а не %1." #~ msgid "Alert" #~ msgstr "Тревога" #~ msgid "Confirm" #~ msgstr "Подтверждение" #~ msgid "Bad event handler: Object %1 Identifier %2 Method %3 Type: %4." #~ msgstr "" #~ "Неверный обработчик событий: объект %1, идентификатор %2, метод %3, тип " #~ "%4." #~ msgid "Exception calling '%1' function from %2:%3:%4" #~ msgstr "Возникло исключение при вызове функции «%1» из %2:%3:%4" #~ msgid "Could not open file '%1'" #~ msgstr "Не удалось открыть файл «%1»" #~ msgid "Could not create temporary file." #~ msgstr "Не удалось создать временный файл." #~ msgid "%1 is not a function and cannot be called." #~ msgstr "%1 не является функцией и не может быть вызвано." #~ msgid "%1 is not an Object type" #~ msgstr "%1 не является объектом" #~ msgid "Action takes 2 args." #~ msgstr "Действие требует 2 аргумента." #~ msgid "ActionGroup takes 2 args." #~ msgstr "ActionGroup требует 2 аргумента." #~ msgid "Must supply a valid parent." #~ msgstr "Необходимо указать правильный родительский объект." #~ msgid "There was an error reading the file '%1'" #~ msgstr "Ошибка чтения из файла «%1»" #~ msgid "Could not read file '%1'" #~ msgstr "Не удалось открыть файл «%1»" #~ msgid "Must supply a filename." #~ msgstr "Необходимо указать имя файла." #~ msgid "'%1' is not a valid QLayout." #~ msgstr "«%1» не является правильным объектом QLayout." #~ msgid "Must supply a layout name." #~ msgstr "Необходимо указать имя компоновки." #~ msgid "Wrong object type." #~ msgstr "Неверное имя объекта." #~ msgid "First argument must be a QObject." #~ msgstr "Первый аргумент должен быть объектом QObject." #~ msgid "Incorrect number of arguments." #~ msgstr "Неверное количество аргументов." #~ msgid "The slot asked for %1 argument" #~ msgid_plural "The slot asked for %1 arguments" #~ msgstr[0] "Слот требует %1 аргумент" #~ msgstr[1] "Слот требует %1 аргумента" #~ msgstr[2] "Слот требует %1 аргументов" #~ msgstr[3] "Слот требует %1 аргумент" #~ msgid "but there is only %1 available" #~ msgid_plural "but there are only %1 available" #~ msgstr[0] "но есть только %1 аргумент" #~ msgstr[1] "но есть только %1 аргумента" #~ msgstr[2] "но есть только %1 аргументов" #~ msgstr[3] "но есть только %1 аргумент" #~ msgctxt "" #~ "%1 is 'the slot asked for foo arguments', %2 is 'but there are only bar " #~ "available'" #~ msgid "%1, %2." #~ msgstr "%1, %2." #~ msgid "Failure to cast to %1 value from Type %2 (%3)" #~ msgstr "Не удалось преобразовать значение от типа %2 к типу %1 (%3)" #~ msgid "No such method '%1'." #~ msgstr "Нет метода «%1»." #~ msgid "Call to method '%1' failed, unable to get argument %2: %3" #~ msgstr "Ошибка вызова метода «%1»: не удалось получить аргумент %2: %3" #~ msgid "Call to '%1' failed." #~ msgstr "Ошибка вызова «%1»." #~ msgid "Could not construct value" #~ msgstr "Не удалось запустить конструктор значения" #~ msgid "Not enough arguments." #~ msgstr "Недостаточно аргументов." #~ msgid "Failed to create Action." #~ msgstr "Не удалось создать Action." #~ msgid "Failed to create ActionGroup." #~ msgstr "Не удалось создать ActionGroup." #~ msgid "No classname specified" #~ msgstr "Не указано имя класса" #~ msgid "Failed to create Layout." #~ msgstr "Не удалось создать Layout." #~ msgid "No classname specified." #~ msgstr "Имя класса не указано." #~ msgid "Failed to create Widget." #~ msgstr "Не удалось создать Widget." #~ msgid "Could not open file '%1': %2" #~ msgstr "Не удалось открыть файл «%1»: %2" #~ msgid "Failed to load file '%1'" #~ msgstr "Ошибка открытия файла «%1»" #~ msgid "'%1' is not a valid QWidget." #~ msgstr "«%1» не является правильным объектом QWidget." #~ msgid "Must supply a widget name." #~ msgstr "Необходимо указать имя виджета." #~ msgid "Bad slot handler: Object %1 Identifier %2 Method %3 Signature: %4." #~ msgstr "" #~ "Неверный обработчик слота: объект %1, идентификатор %2, метод %3, " #~ "сигнатура %4." #~ msgid "Exception calling '%1' slot from %2:%3:%4" #~ msgstr "Возникло исключение при вызове слота «%1» из %2:%3:%4" #~ msgid "loading %1" #~ msgstr "Загрузка %1" #~ msgctxt "describes the feed of the latest posted entries" #~ msgid "Latest" #~ msgstr "Самые последние" #~ msgid "Highest Rated" #~ msgstr "С наивысшим рейтингом" #~ msgid "Most Downloads" #~ msgstr "Самые популярные" #~ msgid "" #~ "Cannot start gpg and retrieve the available keys. Make sure " #~ "that gpg is installed, otherwise verification of downloaded " #~ "resources will not be possible." #~ msgstr "" #~ "Не удалось запустить программу gpg и получить все доступные " #~ "ключи. Проверьте, что программа gpg установлена, иначе проверка " #~ "достоверности скачиваемых материалов будет невозможна." #~ msgid "" #~ "Enter passphrase for key 0x%1, belonging to
    %2<" #~ "%3>
    :    " #~ msgstr "" #~ "Введите ключевую фразу для ключа 0x%1, принадлежащего
    " #~ "%2<%3>
    :    " #~ msgid "" #~ "Cannot start gpg and check the validity of the file. Make sure " #~ "that gpg is installed, otherwise verification of downloaded " #~ "resources will not be possible." #~ msgstr "" #~ "Не удалось запустить программу gpg и проверить целостность " #~ "файла. Проверьте, что программа gpg установлена, иначе проверка " #~ "достоверности скачиваемых материалов будет невозможна." #~ msgid "Select Signing Key" #~ msgstr "Выберите ключ для подписи" #~ msgid "Key used for signing:" #~ msgstr "Ключ, использовавшийся для подписи:" #~ msgid "" #~ "Cannot start gpg and sign the file. Make sure that gpg " #~ "is installed, otherwise signing of the resources will not be possible." #~ msgstr "" #~ "Не удалось запустить программу gpg и подписать файл. " #~ "Проверьте, что программа gpg установлена, иначе подписывание " #~ "материалов будет невозможно." #~ msgid "Get Hot New Stuff" #~ msgstr "Загрузка материалов из Интернета" #~ msgctxt "Program name followed by 'Add On Installer'" #~ msgid "%1 Add-On Installer" #~ msgstr "Программа установки дополнений для %1" #~ msgid "Add Rating" #~ msgstr "Повысить рейтинг" #~ msgid "Add Comment" #~ msgstr "Добавить комментарий" #~ msgid "View Comments" #~ msgstr "Просмотреть комментарии" #~ msgid "Re: %1" #~ msgstr "Re: %1" #~ msgid "Timeout. Check Internet connection." #~ msgstr "Время ожидания истекло. Проверьте подключение к Интернету." #~ msgid "Entries failed to load" #~ msgstr "Ошибка загрузки" #~ msgid "Server: %1" #~ msgstr "Сервер: %1" #~ msgid "
    Provider: %1" #~ msgstr "
    Поставщик: %1" #~ msgid "
    Version: %1" #~ msgstr "
    Версия: %1" #~ msgid "Provider information" #~ msgstr "Сведения о поставщике" #~ msgid "Could not install %1" #~ msgstr "Не удалось установить %1" #~ msgid "Get Hot New Stuff!" #~ msgstr "Загрузка материалов из Интернета" #~ msgid "There was an error loading data providers." #~ msgstr "При загрузке списка поставщиков произошла ошибка." #~ msgid "A protocol fault has occurred. The request has failed." #~ msgstr "Ошибка протокола. Запрос не выполнен." #~ msgid "Desktop Exchange Service" #~ msgstr "Служба доставки материалов" #~ msgid "A network error has occurred. The request has failed." #~ msgstr "Ошибка сети. Запрос не выполнен." #~ msgid "&Source:" #~ msgstr "&Источник:" #~ msgid "?" #~ msgstr "?" #~ msgid "&Order by:" #~ msgstr "&Выше ставить:" #~ msgid "Enter search phrase here" #~ msgstr "Введите текст для поиска" #~ msgid "Collaborate" #~ msgstr "Совместная работа" #~ msgid "Rating: " #~ msgstr "Рейтинг: " #~ msgid "Downloads: " #~ msgstr "Загрузок: " #~ msgid "Install" #~ msgstr "Установить" #~ msgid "Uninstall" #~ msgstr "Удалить" #~ msgid "

    No Downloads

    " #~ msgstr "

    Не было загрузок

    " #~ msgid "

    Downloads: %1

    \n" #~ msgstr "

    Загрузок: %1

    \n" #~ msgid "Update" #~ msgstr "Обновить материал" #~ msgid "Rating: %1" #~ msgstr "Рейтинг: %1" #~ msgid "No Preview" #~ msgstr "Миниатюра отсутствует" #~ msgid "Loading Preview" #~ msgstr "Загрузка миниатюры..." #~ msgid "Comments" #~ msgstr "Комментарии" #~ msgid "Changelog" #~ msgstr "История изменений" #~ msgid "Switch version" #~ msgstr "Изменить версию" #~ msgid "Contact author" #~ msgstr "Связаться с автором" #~ msgid "Collaboration" #~ msgstr "Совместная работа" #~ msgid "Translate" #~ msgstr "Перевести" #~ msgid "Subscribe" #~ msgstr "Подписаться на изменения" #~ msgid "Report bad entry" #~ msgstr "Сообщить об ошибке" #~ msgid "Send Mail" #~ msgstr "Отправить письмо" #~ msgid "Contact on Jabber" #~ msgstr "Связаться через Jabber" #~ msgid "Provider: %1" #~ msgstr "Поставщик: %1" #~ msgid "Version: %1" #~ msgstr "Версия: %1" #~ msgid "The removal request was successfully registered." #~ msgstr "Запрос на удаление зарегистрирован." #~ msgid "Removal of entry" #~ msgstr "Удаление записи" #~ msgid "The removal request failed." #~ msgstr "Ошибка обработки запроса на удаление." #~ msgid "The subscription was successfully completed." #~ msgstr "Вы подписаны на изменения." #~ msgid "Subscription to entry" #~ msgstr "Подписка на изменения" #~ msgid "The subscription request failed." #~ msgstr "Ошибка подписки." #~ msgid "The rating was submitted successfully." #~ msgstr "Запрос на повышение рейтинга принят." #~ msgid "Rating for entry" #~ msgstr "Рейтинг" #~ msgid "The rating could not be submitted." #~ msgstr "Ошибка обработки запроса на повышение рейтинга." #~ msgid "The comment was submitted successfully." #~ msgstr "Комментарий принят." #~ msgid "Comment on entry" #~ msgstr "Комментарий" #~ msgid "The comment could not be submitted." #~ msgstr "Ошибка обработки запроса с комментарием." #~ msgid "KNewStuff contributions" #~ msgstr "Помощь в улучшении" #~ msgid "This operation requires authentication." #~ msgstr "Операция требует аутентификации." #~ msgid "Version %1" #~ msgstr "Версия %1" #~ msgid "Leave a comment" #~ msgstr "Оставить комментарий" #~ msgid "User comments" #~ msgstr "Комментарии пользователей" #~ msgid "Rate this entry" #~ msgstr "Рейтинг материала" #~ msgid "Translate this entry" #~ msgstr "Перевести этот элемент" #~ msgid "Payload" #~ msgstr "Нагрузка" #~ msgid "Download New Stuff..." #~ msgstr "Загрузить материалы..." #~ msgid "Hot New Stuff Providers" #~ msgstr "Поставщики материалов" #~ msgid "Please select one of the providers listed below:" #~ msgstr "Выберите поставщика из списка:" #~ msgid "No provider selected." #~ msgstr "Поставщик не выбран." #~ msgid "Share Hot New Stuff" #~ msgstr "Публикация материалов" #~ msgctxt "Program name followed by 'Add On Uploader'" #~ msgid "%1 Add-On Uploader" #~ msgstr "Программа публикации дополнений для %1" #~ msgid "Please put in a name." #~ msgstr "Введите имя." #~ msgid "Old upload information found, fill out fields?" #~ msgstr "Обнаружены параметры прежней публикации. Использовать их?" #~ msgid "Fill Out" #~ msgstr "Да" #~ msgid "Do Not Fill Out" #~ msgstr "Нет" #~ msgid "Author:" #~ msgstr "Автор:" #~ msgid "Email address:" #~ msgstr "Адрес электронной почты:" #~ msgid "License:" #~ msgstr "Лицензия:" #~ msgid "GPL" #~ msgstr "GPL" #~ msgid "LGPL" #~ msgstr "LGPL" #~ msgid "BSD" #~ msgstr "BSD" #~ msgid "Preview URL:" #~ msgstr "URL миниатюры:" #~ msgid "Language:" #~ msgstr "Язык:" #~ msgid "In which language did you describe the above?" #~ msgstr "На каком языке описано указанное выше?" #~ msgid "Please describe your upload." #~ msgstr "Опишите загружаемые материалы." #~ msgid "Summary:" #~ msgstr "Сводка:" #~ msgid "Please give some information about yourself." #~ msgstr "Укажите информацию о себе." #~ msgctxt "" #~ "the price of a download item, parameter 1 is the currency, 2 is the price" #~ msgid "" #~ "This item costs %1 %2.\n" #~ "Do you want to buy it?" #~ msgstr "" #~ "Стоимость обозначенного составляет %1 %2.\n" #~ "Хотите купить?" #~ msgid "" #~ "Your account balance is too low:\n" #~ "Your balance: %1\n" #~ "Price: %2" #~ msgstr "" #~ "Недостаточно средств на счёте.\n" #~ "Остаток на счёте: %1\n" #~ "Цена: %2" #~ msgctxt "voting for an item (good/bad)" #~ msgid "Your vote was recorded." #~ msgstr "Ваш голос учтён." #~ msgid "You are now a fan." #~ msgstr "Теперь вы фанат этого дополнения." #~ msgid "Network error. (%1)" #~ msgstr "Сетевая ошибка (%1)." #~ msgid "Too many requests to server. Please try again in a few minutes." #~ msgstr "" #~ "Слишком много обращений на сервер. Повторите попытку через несколько " #~ "минут." #~ msgid "Unknown Open Collaboration Service API error. (%1)" #~ msgstr "Неизвестная ошибка Open Collaboration Service (%1)." #~ msgid "Initializing" #~ msgstr "Инициализация" #~ msgid "Configuration file not found: \"%1\"" #~ msgstr "Файл конфигурации не найден: «%1»" #~ msgid "Configuration file is invalid: \"%1\"" #~ msgstr "Неверный файл конфигурации: «%1»" #~ msgid "Loading provider information" #~ msgstr "Загрузка информации о сервере" #~ msgid "Could not load get hot new stuff providers from file: %1" #~ msgstr "Не удалось загрузить список поставщиков из файла: %1" #~ msgid "Error initializing provider." #~ msgstr "Ошибка инициализации поставщика." #~ msgid "Loading data" #~ msgstr "Загрузка данных" #~ msgid "Loading data from provider" #~ msgstr "Загрузка данных от поставщика" #~ msgid "Loading of providers from file: %1 failed" #~ msgstr "Ошибка загрузки поставщиков из файла: %1" #~ msgid "Loading one preview" #~ msgid_plural "Loading %1 previews" #~ msgstr[0] "Загрузка %1 миниатюры..." #~ msgstr[1] "Загрузка %1 миниатюр..." #~ msgstr[2] "Загрузка %1 миниатюр..." #~ msgstr[3] "Загрузка %1 миниатюры..." #~ msgid "Installing" #~ msgstr "Установка" #~ msgid "Download of item failed: no download URL for \"%1\"." #~ msgstr "Ошибка загрузки: не указан адрес URL для «%1»." #~ msgid "Download of \"%1\" failed, error: %2" #~ msgstr "Ошибка загрузки «%1»: %2" #~ msgid "" #~ "The downloaded file is a html file. This indicates a link to a website " #~ "instead of the actual download. Would you like to open the site with a " #~ "browser instead?" #~ msgstr "" #~ "Вы пытаетесь загрузить файл HTML. Это означает, что ссылка указывает на " #~ "веб-страницу, а не на файл. Открыть ссылку в браузере?" #~ msgid "Possibly bad download link" #~ msgstr "Возможно, неверная ссылка" #~ msgid "Downloaded file was a HTML file. Opened in browser." #~ msgstr "Попытка загрузки файла HTML. Ссылка будет открыта в браузере." #~ msgid "Could not install \"%1\": file not found." #~ msgstr "Не удалось установить «%1»: файл не найден" # BUGME: quotes are not translatable #~ msgid "Overwrite existing file?" #~ msgstr "Заменить существующий файл?" # [https://bugs.kde.org/show_bug.cgi?id=265438] BUGME: colon in caption #~ msgid "Download File" #~ msgstr "Загрузка файла" #~ msgid "Icons view mode" #~ msgstr "Значки" #~ msgid "Details view mode" #~ msgstr "Список" #~ msgid "All Providers" #~ msgstr "Все поставщики материалов" #~ msgid "All Categories" #~ msgstr "Все категории" #~ msgid "Provider:" #~ msgstr "Поставщик:" #~ msgid "Category:" #~ msgstr "Категория:" #~ msgid "Newest" #~ msgstr "Новые" #~ msgid "Rating" #~ msgstr "Высоко оценённые" #~ msgid "Most downloads" #~ msgstr "Самые популярные" #~ msgid "Installed" #~ msgstr "Установленные" #~ msgid "Order by:" #~ msgstr "Выше ставить:" #~ msgid "Search:" #~ msgstr "Поиск:" #~ msgid "Homepage" #~ msgstr "Домашняя страница" #~ msgid "Become a Fan" #~ msgstr "Стать фанатом" #~ msgid "Details for %1" #~ msgstr "Сведения о %1" #~ msgid "Changelog:" #~ msgstr "История изменений:" #~ msgctxt "A link to the description of this Get Hot New Stuff item" #~ msgid "Homepage" #~ msgstr "Веб-сайт" #~ msgctxt "" #~ "A link to make a donation for a Get Hot New Stuff item (opens a web " #~ "browser)" #~ msgid "Make a donation" #~ msgstr "Сделать пожертвование" # BUGME: wrong usage of plurals ("no entries" for n=1) #~ msgctxt "A link to the knowledgebase (like a forum) (opens a web browser)" #~ msgid "Knowledgebase (no entries)" #~ msgid_plural "Knowledgebase (%1 entries)" #~ msgstr[0] "База знаний (%1 вхождение)" #~ msgstr[1] "База знаний (%1 вхождения)" #~ msgstr[2] "База знаний (%1 вхождений)" #~ msgstr[3] "База знаний (нет вхождений)" #~ msgctxt "Tooltip for a link in a dialog" #~ msgid "Opens in a browser window" #~ msgstr "Открыть в браузере" #~ msgid "Rating: %1%" #~ msgstr "Рейтинг: %1%" #~ msgctxt "Show the author of this item in a list" #~ msgid "By %1" #~ msgstr "Автор: %1" #~ msgctxt "fan as in supporter" #~ msgid "1 fan" #~ msgid_plural "%1 fans" #~ msgstr[0] "%1 фанат" #~ msgstr[1] "%1 фаната" #~ msgstr[2] "%1 фанатов" #~ msgstr[3] "%1 фанат" #~ msgid "1 download" #~ msgid_plural "%1 downloads" #~ msgstr[0] "%1 загрузка" #~ msgstr[1] "%1 загрузки" #~ msgstr[2] "%1 загрузок" #~ msgstr[3] "%1 загрузка" #~ msgid "Updating" #~ msgstr "Обновление" #~ msgid "Install Again" #~ msgstr "Установить заново" #~ msgid "Fetching license data from server..." #~ msgstr "Получение лицензии с сервера..." #~ msgid "Fetching content data from server..." #~ msgstr "Получение данных с сервера..." #~ msgid "Register a new account" #~ msgstr "Зарегистрировать новую учётную запись" #~ msgid "Checking login..." #~ msgstr "Попытка входа..." #~ msgid "Fetching your previously updated content..." #~ msgstr "Получение ранее обновлённого содержимого..." #~ msgid "Could not verify login, please try again." #~ msgstr "Не удалось проверить данные регистрации. Попробуйте позже." #~ msgid "Fetching your previously updated content finished." #~ msgstr "Получение ранее обновлённого содержимого завершено." #~ msgid "Fetching content data from server finished." #~ msgstr "Получение содержимого с сервера завершено." #~ msgctxt "" #~ "A link to the website where the get hot new stuff upload can be seen" #~ msgid "Visit website" #~ msgstr "Посетить веб-сайт" #~ msgid "File not found: %1" #~ msgstr "Файл %1 не найден." #~ msgid "Upload Failed" #~ msgstr "Не удалось загрузить файл на сервер" #~ msgid "" #~ "The server does not recognize the category %2 to which you are trying to " #~ "upload." #~ msgid_plural "" #~ "The server does not recognize any of the categories to which you are " #~ "trying to upload: %2" #~ msgstr[0] "" #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " #~ "загрузку." #~ msgstr[1] "" #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " #~ "загрузку." #~ msgstr[2] "" #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " #~ "загрузку." #~ msgstr[3] "" #~ "Сервер не поддерживает категорию (%2), в которую вы хотите выполнить " #~ "загрузку." #~ msgid "The selected category \"%1\" is invalid." #~ msgstr "Выбрана недопустимая категория «%1»." #~ msgid "Select preview image" #~ msgstr "Выбор изображения для миниатюры" #~ msgid "There was a network error." #~ msgstr "Произошла ошибка сети." #~ msgid "Uploading Failed" #~ msgstr "Не удалось загрузить файл на сервер" #~ msgid "Authentication error." #~ msgstr "Ошибка аутентификации." #~ msgid "Upload failed: %1" #~ msgstr "Загрузка на сервер не удалась: %1" #~ msgid "File to upload:" #~ msgstr "Файл для публикации:" #~ msgid "New Upload" #~ msgstr "Новый материал" #~ msgid "Name of the file as it will appear on the website" #~ msgstr "Имя, под которым файл будет показан на сайте" #~ msgid "" #~ "This should clearly describe the file content. It can be the same text as " #~ "the title of the kvtml file." #~ msgstr "Имя должно ясно описывать содержимое файла." #~ msgid "Preview Images" #~ msgstr "Миниатюры" #~ msgid "Select Preview..." #~ msgstr "Выбрать..." #~ msgid "Set a price for this item" #~ msgstr "Установить цену" #~ msgid "Price" #~ msgstr "Цена" #~ msgid "Price:" #~ msgstr "Цена:" #~ msgid "Reason for price:" #~ msgstr "Обоснование цены:" #~ msgid "Fetch content link from server" #~ msgstr "Получение от сервера ссылки на материалы" #~ msgid "Create content on server" #~ msgstr "Создание материалов на сервере" #~ msgid "Upload content" #~ msgstr "Загрузка материалов на сервер" #~ msgid "Upload first preview" #~ msgstr "Загрузка первой миниатюры на сервер" #~ msgid "Note: You can edit, update and delete your content on the website." #~ msgstr "" #~ "Примечание: вы можете редактировать, обновлять и удалять свои материалы " #~ "на веб-сайте." #~ msgid "Upload second preview" #~ msgstr "Загрузка второй миниатюры на сервер" #~ msgid "Upload third preview" #~ msgstr "Загрузка третьей миниатюры на сервер" #~ msgid "" #~ "I ensure that this content does not violate any existing copyright, law " #~ "or trademark. I agree for my IP address to be logged. (Distributing " #~ "content without the permission of the copyright holder is illegal.)" #~ msgstr "" #~ "Я подтверждаю, что эти материалы не нарушают авторских прав, законов или " #~ "прав на торговые марки. Я разрешаю записать мой IP-адрес. " #~ "(Распространение материалов без разрешения правообладателя незаконно.)" #~ msgid "Start Upload" #~ msgstr "Начать загрузку" #~ msgid "Play a &sound" #~ msgstr "Воспроизвести &звук" #~ msgid "Select the sound to play" #~ msgstr "Выберите звуковой файл" #~ msgid "Show a message in a &popup" #~ msgstr "Показать &сообщение во всплывающем окне" #~ msgid "Log to a file" #~ msgstr "&Сохранять в файле журнала" #~ msgid "Mark &taskbar entry" #~ msgstr "Выдели&ть программу в панели задач" #~ msgid "Run &command" #~ msgstr "Выполнить &программу" #~ msgid "Select the command to run" #~ msgstr "Выберите программу" #~ msgid "Sp&eech" #~ msgstr "З&ачитать" #~ msgid "" #~ "Specifies how Jovie should speak the event when received. If you " #~ "select \"Speak custom text\", enter the text in the box. You may use the " #~ "following substitution strings in the text:
    %e
    Name of the " #~ "event
    %a
    Application that sent the event
    %m
    The message sent by the application
    " #~ msgstr "" #~ "Что произносить при возникновении события. В случае выбора варианта " #~ "«Зачитать указанный мною текст», введите текст в соответствующее поле. " #~ "Возможно использование следующих обозначений:
    %e
    категория " #~ "события
    %a
    приложение-источник события
    %m
    сообщение, переданное приложением
    " #~ msgid "Speak Event Message" #~ msgstr "Зачитать содержание события" #~ msgid "Speak Event Name" #~ msgstr "Зачитать название события" #~ msgid "Speak Custom Text" #~ msgstr "Зачитать указанный мною текст" #~ msgid "Configure Notifications" #~ msgstr "Настройка уведомлений" #~ msgctxt "State of the notified event" #~ msgid "State" #~ msgstr "Состояние" #~ msgctxt "Title of the notified event" #~ msgid "Title" #~ msgstr "Заголовок" #~ msgctxt "Description of the notified event" #~ msgid "Description" #~ msgstr "Описание" #~ msgid "Do you want to search the Internet for %1?" #~ msgstr "Выполнить поиск %1 в Интернете?" #~ msgid "Internet Search" #~ msgstr "Поиск в Интернет" #~ msgid "&Search" #~ msgstr "&Поиск" #~ msgctxt "@label Type of file" #~ msgid "Type: %1" #~ msgstr "Тип: %1" #~ msgctxt "@label:checkbox" #~ msgid "Remember action for files of this type" #~ msgstr "В будущем поступать с файлами этого типа так же" #~ msgctxt "@label:button" #~ msgid "&Open with %1" #~ msgstr "&Открыть в программе «%1»" #~ msgctxt "@action:inmenu" #~ msgid "Open &with %1" #~ msgstr "Открыть &в программе «%1»" #~ msgctxt "@info" #~ msgid "Open '%1'?" #~ msgstr "Открыть «%1»?" #~ msgctxt "@label:button" #~ msgid "&Open with..." #~ msgstr "&Открыть с помощью..." #~ msgctxt "@label:button" #~ msgid "&Open with" #~ msgstr "&Открыть с помощью..." #~ msgctxt "@label:button" #~ msgid "&Open" #~ msgstr "&Открыть" #~ msgctxt "@label File name" #~ msgid "Name: %1" #~ msgstr "Имя файла: %1" #~ msgctxt "@info:whatsthis" #~ msgid "This is the file name suggested by the server" #~ msgstr "Имя файла, предложенное сервером." #~ msgid "Do you really want to execute '%1'?" #~ msgstr "Выполнить «%1»?" #~ msgid "Execute File?" #~ msgstr "Выполнить файл?" #~ msgid "Accept" #~ msgstr "Принять" #~ msgid "Reject" #~ msgstr "Отклонить" #~ msgid "Untitled" #~ msgstr "Безымянный" #~ msgid "" #~ "The document \"%1\" has been modified.\n" #~ "Do you want to save your changes or discard them?" #~ msgstr "" #~ "Документ «%1» был изменён.\n" #~ "Сохранить изменения или отклонить их?" #~ msgid "Close Document" #~ msgstr "Закрыть документ" #~ msgid "Error reading from PTY" #~ msgstr "Ошибка чтения из PTY" #~ msgid "Error writing to PTY" #~ msgstr "Ошибка записи в PTY" #~ msgid "PTY operation timed out" #~ msgstr "Истекло время ожидания завершения операции PTY" #~ msgid "Error opening PTY" #~ msgstr "Ошибка открытия PTY" #~ msgid "Kross" #~ msgstr "Kross" #~ msgid "KDE application to run Kross scripts." #~ msgstr "Приложение KDE для запуска скриптов Kross." #~ msgid "(C) 2006 Sebastian Sauer" #~ msgstr "© Sebastian Sauer, 2006" #~ msgid "Run Kross scripts." #~ msgstr "Запуск скриптов Kross." #~ msgid "Sebastian Sauer" #~ msgstr "Sebastian Sauer" #~ msgid "Scriptfile" #~ msgstr "Скрипт" #~ msgid "Scriptfile \"%1\" does not exist." #~ msgstr "Файл скрипта «%1» не найден." #~ msgid "Failed to determine interpreter for scriptfile \"%1\"" #~ msgstr "Не удалось определить интерпретатор для скрипта «%1»" #~ msgid "Failed to open scriptfile \"%1\"" #~ msgstr "Не удалось открыть файл скрипта «%1»" #~ msgid "Failed to load interpreter \"%1\"" #~ msgstr "Не удалось загрузить интерпретатор «%1»" #~ msgid "No such interpreter \"%1\"" #~ msgstr "Неизвестный интерпретатор «%1»" #~ msgid "Failed to create script for interpreter \"%1\"" #~ msgstr "Не удалось создать скрипт для интерпретатора «%1»" #~ msgid "Level of safety of the Ruby interpreter" #~ msgstr "Уровень безопасности интерпретатора Ruby" #~ msgid "Cancel?" #~ msgstr "Отменить?" #~ msgid "No such function \"%1\"" #~ msgstr "Функция «%1» не существует" #~ msgid "Text:" #~ msgstr "Текст:" #~ msgid "Comment:" #~ msgstr "Комментарий:" #~ msgid "Icon:" #~ msgstr "Значок:" #~ msgid "Interpreter:" #~ msgstr "Интерпретатор:" #~ msgid "File:" #~ msgstr "Файл:" #~ msgid "Execute the selected script." #~ msgstr "Запустить выбранный скрипт." #~ msgid "Stop execution of the selected script." #~ msgstr "Остановить выполнение выбранного скрипта." #~ msgid "Edit..." #~ msgstr "Изменить..." #~ msgid "Edit selected script." #~ msgstr "Изменить выбранный скрипт." #~ msgid "Add..." #~ msgstr "Добавить..." #~ msgid "Add a new script." #~ msgstr "Создать новый скрипт." #~ msgid "Remove selected script." #~ msgstr "Удалить выбранный скрипт." #~ msgctxt "@title:group Script properties" #~ msgid "General" #~ msgstr "Главное" #~ msgid "The module %1 could not be found." #~ msgstr "Модуль %1 не найден." #~ msgid "" #~ "

    The diagnosis is:
    The desktop file %1 could not be found." #~ msgstr "

    Проблема:
    не удалось найти файл %1.

    " #~ msgid "The module %1 is disabled." #~ msgstr "Модуль %1 отключен." #~ msgid "" #~ "

    Either the hardware/software the module configures is not " #~ "available or the module has been disabled by the administrator.

    " #~ msgstr "" #~ "

    Не найдено оборудование или программное обеспечение для работы " #~ "модуля или использование модуля отключено администратором.

    " #~ msgid "The module %1 is not a valid configuration module." #~ msgstr "Модуль %1 не является правильным модулем настройки KDE." #~ msgid "" #~ "The diagnosis is:
    The desktop file %1 does not specify a library." #~ "    " #~ msgstr "Проблема:
    файл %1 не содержит имя библиотеки.    " #~ msgid "There was an error loading the module." #~ msgstr "При загрузке модуля произошла ошибка." #~ msgid "" #~ "The diagnosis is:
    %1

    Possible reasons:

    • An error " #~ "occurred during your last KDE upgrade leaving an orphaned control module
    • You have old third party modules lying around.

    Check " #~ "these points carefully and try to remove the module mentioned in the " #~ "error message. If this fails, consider contacting your distributor or " #~ "packager.

    " #~ msgstr "" #~ "Проблема:
    %1

    Возможные причины:

    • Ошибка при " #~ "последнем обновлении KDE, в результате которой остался модуль управления " #~ "от предыдущей версии;
    • У вас установлены сторонние модули " #~ "настройки.

    Внимательно проверьте эти пункты и удалите " #~ "перечисленные выше модули. Если ошибка повторяется, обратитесь к " #~ "поставщику пакетов.

    " #~ msgid "" #~ "

    Possible reasons:

    • An error occurred during your last KDE " #~ "upgrade leaving an orphaned control module
    • You have old third " #~ "party modules lying around.

    Check these points carefully " #~ "and try to remove the module mentioned in the error message. If this " #~ "fails, consider contacting your distributor or packager.

    " #~ msgstr "" #~ "

    Возможные причины:

    • Ошибка при последнем обновлении KDE, в " #~ "результате которой остался модуль настройки от предыдущей версии
    • У вас установлены сторонние модули настройки.

    Внимательно проверьте эти пункты и удалите перечисленные выше " #~ "модули. Если ошибка повторяется, обратитесь к поставщику пакетов.

    " #~ msgctxt "Argument is application name" #~ msgid "This configuration section is already opened in %1" #~ msgstr "Этот модуль настройки уже открыт в %1" #~ msgid "" #~ "The settings of the current module have changed.\n" #~ "Do you want to apply the changes or discard them?" #~ msgstr "" #~ "В текущем модуле имеются несохранённые изменения.\n" #~ "Применить их?" #~ msgid "Apply Settings" #~ msgstr "Сохранение параметров" #~ msgid "Distance between desktop icons" #~ msgstr "Расстояние между значками на рабочем столе" #~ msgid "The distance between icons specified in pixels." #~ msgstr "Расстояние между значками в пикселах." #~ msgid "Widget style to use" #~ msgstr "Стиль элементов интерфейса" #~ msgid "" #~ "The name of the widget style, for example \"keramik\" or \"plastik\". " #~ "Without quotes." #~ msgstr "" #~ "Название стиля элементов интерфейса, например, «keramik» или " #~ "«plastik» (без кавычек)." #~ msgid "Use the PC speaker" #~ msgstr "Использовать динамик, встроенный в системный блок" #~ msgid "" #~ "Whether the ordinary PC speaker should be used instead of KDE's own " #~ "notifications system." #~ msgstr "" #~ "Использовать ли динамик, встроенный в системный блок, вместо системы " #~ "уведомлений KDE." #~ msgid "What terminal application to use" #~ msgstr "Какое терминальное приложение использовать" #~ msgid "" #~ "Whenever a terminal application is launched this terminal emulator " #~ "program will be used.\n" #~ msgstr "Какое приложение использовать для терминала.\n" #~ msgid "Fixed width font" #~ msgstr "Моноширинный шрифт" #~ msgid "" #~ "This font is used when a fixed font is needed. A fixed font has a " #~ "constant width.\n" #~ msgstr "" #~ "Этот шрифт будет использован при выводе текста моноширинным шрифтом. Все " #~ "символы моноширинного шрифта имеют одинаковую ширину.\n" #~ msgid "System wide font" #~ msgstr "Системный шрифт" #~ msgid "Font for menus" #~ msgstr "Шрифт меню" #~ msgid "What font to use for menus in applications." #~ msgstr "Шрифт, который будет использоваться для меню." #~ msgid "Color for links" #~ msgstr "Цвет ссылок" #~ msgid "What color links should be that have not yet been clicked on" #~ msgstr "Цвет не посещённых ссылок" #~ msgid "Color for visited links" #~ msgstr "Цвет посещённых ссылок" #~ msgid "Font for the taskbar" #~ msgstr "Шрифт панели задач" #~ msgid "" #~ "What font to use for the panel at the bottom of the screen, where the " #~ "currently running applications are." #~ msgstr "" #~ "Шрифт, который будет использован для панели со списком запущенных " #~ "программ." #~ msgid "Fonts for toolbars" #~ msgstr "Шрифт панелей инструментов" #~ msgid "Shortcut for taking screenshot" #~ msgstr "Комбинация клавиш для создания снимка экрана" #~ msgid "Shortcut for toggling Clipboard Actions on and off" #~ msgstr "" #~ "Комбинация клавиш для включения и выключения действий с содержимым буфера " #~ "обмена" #~ msgid "Shortcut for shutting down the computer without confirmation" #~ msgstr "Комбинация клавиш для выключения компьютера без подтверждения" #~ msgid "Show directories first" #~ msgstr "Папки в начале" #~ msgid "" #~ "Whether directories should be placed at the top when displaying files" #~ msgstr "Помещать ли папки перед списком файлов" #~ msgid "The URLs recently visited" #~ msgstr "Посещённые ссылки" #~ msgid "Used for auto-completion in file dialogs, for example" #~ msgstr "Используется для автодополнения в диалогах, например" #~ msgid "Show file preview in file dialog" #~ msgstr "Показывать предварительный просмотр в диалогах выбора файла" #~ msgid "Show hidden files" #~ msgstr "Показывать скрытые файлы" #~ msgid "" #~ "Whether files starting with a dot (convention for hidden files) should be " #~ "shown" #~ msgstr "" #~ "При включении этого параметра будут показываться скрытые файлы и папки " #~ "(имена которых начинается с точки)" #~ msgid "Show speedbar" #~ msgstr "Показать панель быстрого доступа" #~ msgid "" #~ "Whether the shortcut icons to the left in the file dialog should be shown" #~ msgstr "" #~ "Показывать панель со значками быстрого доступа к папкам с левой стороны " #~ "диалога выбора файла" #~ msgid "What country" #~ msgstr "Страна" #~ msgid "" #~ "Used to determine how to display numbers, currency and time/date, for " #~ "example" #~ msgstr "" #~ "Используется для определения формата показа чисел, денежных сумм, даты и " #~ "времени" #~ msgid "What language to use to display text" #~ msgstr "Язык текста" #~ msgid "Character used for indicating positive numbers" #~ msgstr "Символ, используемый для показа положительных чисел" #~ msgid "Most countries have no character for this" #~ msgstr "Большинство стран не использует такой символ" #~ msgid "Path to the autostart directory" #~ msgstr "Путь к папке автозапуска" #~ msgid "" #~ "Path to the directory containing executables to be run on session login" #~ msgstr "" #~ "Путь к папке, содержащей исполняемые файлы, которые выполняются в начале " #~ "сеанса KDE" #~ msgid "Enable SOCKS support" #~ msgstr "Включить поддержку SOCKS" #~ msgid "Whether SOCKS version 4 and 5 should be enabled in KDE's sub systems" #~ msgstr "Использовать поддержку SOCKS версии 4 и 5 в KDE" #~ msgid "Path to custom SOCKS library" #~ msgstr "Путь к библиотеке SOCKS" #~ msgid "Highlight toolbar buttons on mouse over" #~ msgstr "" #~ "Подсвечивать кнопки на панелях инструментов при наведении на них курсором " #~ "мыши" #~ msgid "Show text on toolbar icons " #~ msgstr "Показывать надписи на кнопках панелей инструментов" #~ msgid "Whether text should be shown in addition to icons on toolbar icons" #~ msgstr "" #~ "Показывать надписи на кнопках панелей инструментов в дополнении к значкам" #~ msgid "Password echo type" #~ msgstr "Показ символов при вводе пароля" #~ msgid "The size of the dialog" #~ msgstr "Размер диалога" #~ msgid "" #~ "Automatic changes have been performed due to plugin dependencies. Click " #~ "here for further information" #~ msgstr "" #~ "Для удовлетворения зависимости расширения будут предприняты некоторые " #~ "автоматические изменения. Нажмите здесь для получения дополнительной " #~ "информации" #~ msgid "" #~ "Automatic changes have been performed in order to satisfy plugin " #~ "dependencies:\n" #~ msgstr "" #~ "Для удовлетворения зависимости расширения будут предприняты следующие " #~ "автоматические изменения:\n" #~ msgid "" #~ "\n" #~ " %1 plugin has been automatically checked because of the dependency of " #~ "%2 plugin" #~ msgstr "" #~ "\n" #~ " Расширение %1 будет выбрано, так как от него зависит расширение %2" #~ msgid "" #~ "\n" #~ " %1 plugin has been automatically unchecked because of its dependency " #~ "on %2 plugin" #~ msgstr "" #~ "\n" #~ " Расширение %1 не будет выбрано, так как зависит от расширения %2" #~ msgid "Dependency Check" #~ msgstr "Проверка зависимостей" #~ msgid "%1 plugin automatically added due to plugin dependencies" #~ msgid_plural "%1 plugins automatically added due to plugin dependencies" #~ msgstr[0] "%1 расширение автоматически добавлено при проверке зависимостей" #~ msgstr[1] "%1 расширения автоматически добавлены при проверке зависимостей" #~ msgstr[2] "%1 расширений автоматически добавлены при проверке зависимостей" #~ msgstr[3] "%1 расширение автоматически добавлено при проверке зависимостей" #~ msgid ", " #~ msgstr ", " #~ msgid "%1 plugin automatically removed due to plugin dependencies" #~ msgid_plural "%1 plugins automatically removed due to plugin dependencies" #~ msgstr[0] "%1 расширение автоматически удалено при проверке зависимостей" #~ msgstr[1] "%1 расширения автоматически удалены при проверке зависимостей" #~ msgstr[2] "%1 расширений автоматически удалены при проверке зависимостей" #~ msgstr[3] "%1 расширение автоматически удалено при проверке зависимостей" #~ msgid "Search Plugins" #~ msgstr "Поиск расширений" #~ msgctxt "Used only for plugins" #~ msgid "About %1" #~ msgstr "О расширении %1" #~ msgid "Could not load print preview part" #~ msgstr "Не удалось загрузить компонент предварительного просмотра" #~ msgid "Print Preview" #~ msgstr "Предварительный просмотр" #~ msgid "Select Components" #~ msgstr "Выберите компоненты" #~ msgid "Enable component" #~ msgstr "Включить компонент" #~ msgid "Success" #~ msgstr "Выполнено" #~ msgid "Communication error" #~ msgstr "Ошибка связи" #~ msgid "Invalid type in Database" #~ msgstr "Недопустимый тип в базе данных" #~ msgctxt "" #~ "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the " #~ "user entered." #~ msgid "Query Results from '%1'" #~ msgstr "Результаты поиска «%1»" #~ msgctxt "@title UDS_DISPLAY_NAME for a KIO directory listing." #~ msgid "Query Results" #~ msgstr "Результаты поиска" #~ msgctxt "" #~ "Boolean AND keyword in desktop search strings. You can add several " #~ "variants separated by spaces, e.g. retain the English one alongside the " #~ "translation; keywords are not case sensitive. Make sure there is no " #~ "conflict with the OR keyword." #~ msgid "and" #~ msgstr "and и" #~ msgctxt "" #~ "Boolean OR keyword in desktop search strings. You can add several " #~ "variants separated by spaces, e.g. retain the English one alongside the " #~ "translation; keywords are not case sensitive. Make sure there is no " #~ "conflict with the AND keyword." #~ msgid "or" #~ msgstr "or или" #~ msgid "Nepomuk Resource Class Generator" #~ msgstr "Генератор классов ресурсов Nepomuk" #~ msgid "(c) 2006-2009, Sebastian Trüg" #~ msgstr "© Sebastian Trüg, 2006-2009" #~ msgid "Sebastian Trüg" #~ msgstr "Sebastian Trüg" #~ msgid "Maintainer" #~ msgstr "Сопровождающий" #~ msgid "Tobias Koenig" #~ msgstr "Tobias Koenig" #~ msgid "Major cleanup - Personal hero of maintainer" #~ msgstr "Подчистка кода; личный герой сопровождающего" #~ msgid "Verbose output debugging mode." #~ msgstr "Подробный вывод для отладки." #~ msgid "" #~ "Generate simple and fast wrapper classes not based on Nepomuk::Resource " #~ "which do not provide any data integrity checking" #~ msgstr "" #~ "Генерация компактных и быстрых классов, не базирующихся на Nepomuk::" #~ "Resource, который не обеспечивает проверки целостности данных." #~ msgid "Actually generate the code." #~ msgstr "Генерация кода." #~ msgid "List all includes (deprecated)." #~ msgstr "Список всех включаемых файлов (устаревшее)." #~ msgid "" #~ "List all header files that will be generated via the --writeall command." #~ msgstr "Список всех включаемых файлов, генерируемых командой --writeall." #~ msgid "" #~ "List all source files that will be generated via the --writeall command." #~ msgstr "Список всех файлов кода, генерируемых командой --writeall." #~ msgid "" #~ "The ontology files containing the ontologies to be generated, a space " #~ "separated list (deprecated: use arguments instead.)" #~ msgstr "" #~ "Файл онтологий, для которых нужно сгенерировать онтологии. Файлы " #~ "указываются в виде разделённого пробелами списка (устаревшее, вместо " #~ "этого используйте отдельные параметры командной строки)." #~ msgid "Include path prefix (deprecated)" #~ msgstr "Префикс пути к заголовочным файлам (устаревшее)" #~ msgid "Specify the target folder to store generated files into." #~ msgstr "Папка для генерируемых файлов." #~ msgid "Templates to be used (deprecated)." #~ msgstr "Используемые шаблоны (устаревшее)." #~ msgid "" #~ "Optionally specify the classes to be generated. Use option multiple times " #~ "(defaults to all classes)" #~ msgstr "" #~ "Необязательное указание генерируемых классов (по умолчанию — все классы). " #~ "Этот ключ можно использовать несколько раз для указания нескольких " #~ "классов." #~ msgid "" #~ "Serialization used in the ontology files. Will default to primitive file " #~ "extension detection." #~ msgstr "" #~ "Используемый тип сериализации в файлах онтологий. По умолчанию " #~ "определяется по расширению файла." #~ msgid "" #~ "Set the used visibility in case the classes are to be used in public API. " #~ " will be used to construct the export macro name and the " #~ "export header. By default classes will not be exported." #~ msgstr "" #~ "Видимость классов для публичного API. Для генерации экспортирующего " #~ "заголовочного файла и имён макросов используется . По " #~ "умолчанию классы не экспортируются." #~ msgid "The ontology files containing the ontologies to be generated." #~ msgstr "Файлы онтологий для генерируемой онтологии." #~ msgctxt "@title:window" #~ msgid "Change Tags" #~ msgstr "Изменение меток" #~ msgctxt "@title:window" #~ msgid "Add Tags" #~ msgstr "Добавление меток" #~ msgctxt "@label:textbox" #~ msgid "Configure which tags should be applied." #~ msgstr "Выберите метки для объектов." #~ msgctxt "@label" #~ msgid "Create new tag:" #~ msgstr "Новая метка:" #~ msgctxt "@info" #~ msgid "Delete tag" #~ msgstr "Удалить метку" #~ msgctxt "@info" #~ msgid "" #~ "Should the tag %1 really be deleted for all files?" #~ msgstr "Убрать метку %1 со всех файлов?" #~ msgctxt "@title" #~ msgid "Delete tag" #~ msgstr "Удаление метки" #~ msgctxt "@action:button" #~ msgid "Delete" #~ msgstr "Удалить" #~ msgctxt "@action:button" #~ msgid "Cancel" #~ msgstr "Отмена" #~ msgid "Changing annotations" #~ msgstr "Изменение аннотаций" #~ msgctxt "@label" #~ msgid "Show all tags..." #~ msgstr "Показать все метки..." #~ msgctxt "@label" #~ msgid "Add Tags..." #~ msgstr "Добавить..." #~ msgctxt "@label" #~ msgid "Change..." #~ msgstr "Изменить..." #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Anytime" #~ msgstr "Дата не важна" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Today" #~ msgstr "Сегодня" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Yesterday" #~ msgstr "Вчера" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "This Week" #~ msgstr "На этой неделе" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "This Month" #~ msgstr "В этом месяце" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Last Month" #~ msgstr "В прошлом месяце" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "This Year" #~ msgstr "В этом году" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Last Year" #~ msgstr "В прошлом году" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources that will open a dialog to choose a date range" #~ msgid "Custom..." #~ msgstr "Другая дата..." #~ msgid "This Week" #~ msgstr "На этой неделе" #~ msgid "This Month" #~ msgstr "В этом месяце" #~ msgid "Anytime" #~ msgstr "В любое время" #~ msgid "Before" #~ msgstr "До" #~ msgid "After" #~ msgstr "После" #~ msgctxt "" #~ "@option:check An item in a list of resources that allows to query for " #~ "more resources to put in the list" #~ msgid "More..." #~ msgstr "Дополнительно..." #~ msgctxt "@option:check A filter on file type" #~ msgid "Documents" #~ msgstr "Документы" #~ msgctxt "@option:check A filter on file type - audio files" #~ msgid "Audio" #~ msgstr "Аудиофайлы" #~ msgctxt "@option:check A filter on file type - media video" #~ msgid "Video" #~ msgstr "Видеофайлы" #~ msgctxt "@option:check A filter on file type" #~ msgid "Images" #~ msgstr "Изображения" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "No priority" #~ msgstr "Без приоритета" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "Last modified" #~ msgstr "Последние изменённые" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "Most important" #~ msgstr "Наиболее важные" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "Never opened" #~ msgstr "Ни разу не открытые" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "Any Rating" #~ msgstr "Оценка не важна" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "1 or more" #~ msgstr "1 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "2 or more" #~ msgstr "2 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "3 or more" #~ msgstr "3 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "4 or more" #~ msgstr "4 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "Max Rating" #~ msgstr "Максимальная оценка" #~ msgctxt "" #~ "@title KCategorizedSortFilterProxyModel grouping for all Nepomukj " #~ "resources that are of type rdfs:Resource" #~ msgid "Miscellaneous" #~ msgstr "Разное" #~ msgctxt "@title:column The Nepomuk resource label and icon" #~ msgid "Resource" #~ msgstr "Источник" #~ msgctxt "@title:column The Nepomuk resource's RDF type" #~ msgid "Resource Type" #~ msgstr "Тип источника" #~ msgid "Enter Search Terms..." #~ msgstr "Введите текст для поиска..." #~ msgctxt "@option:check A filter on resource type" #~ msgid "Contacts" #~ msgstr "Контакты" #~ msgctxt "@option:check A filter on resource type" #~ msgid "Emails" #~ msgstr "Адреса электронной почты" #~ msgctxt "@option:check A filter on resource type" #~ msgid "Tasks" #~ msgstr "Задачи" #~ msgctxt "@option:check A filter on resource type" #~ msgid "Tags" #~ msgstr "Метки" #~ msgctxt "@option:check Do filter on type - show only files" #~ msgid "Files" #~ msgstr "Файлы" #~ msgctxt "@option:check Do filter on type - show everything but files" #~ msgid "Other" #~ msgstr "Другое" #~ msgid "ThreadWeaver Jobs Examples" #~ msgstr "Примеры заданий ThreadWeaver" #~ msgid "" #~ "The program executes 100 jobs in 4 threads. Each job waits for a random " #~ "number of milliseconds between 1 and 1000." #~ msgstr "" #~ "Программа запускает 100 заданий в 4 потоках. Каждое задание находится в " #~ "ожидании случайный период от 1 до 1000 миллисекунд." #~ msgid "" #~ "Check to see logging information about thread activity. Watch the console " #~ "output to see the log information." #~ msgstr "" #~ "Установите флажок для вывода информации по активности программных потоков " #~ "на консоль." #~ msgid "Log thread activity" #~ msgstr "Вывод активности потоков" #~ msgid "Displays Thread Activity" #~ msgstr "Показывает активность потоков" #~ msgid "Start" #~ msgstr "Запуск" #~ msgid "GUI based example for the Weaver Thread Manager" #~ msgstr "Пример использования ThreadWeaver с графическим интерфейсом" #~ msgid "Remaining number of jobs:" #~ msgstr "Оставшееся число заданий:" #~ msgid "What time is it? Click to update." #~ msgstr "Сколько времени? Нажмите для обновления." #~ msgid "" #~ "

    (do not know yet)

    " #~ msgstr "" #~ "

    (нет данных)

    " #~ msgid "Select Files..." #~ msgstr "Выбор файлов..." #~ msgid "Cancel" #~ msgstr "Отмена" #~ msgid "Suspend" #~ msgstr "Приостановить" #~ msgid "Anonymous" #~ msgstr "Анонимно" Index: trunk/l10n-kf5/ru/messages/frameworks/kdelibs4support.po =================================================================== --- trunk/l10n-kf5/ru/messages/frameworks/kdelibs4support.po (revision 1549882) +++ trunk/l10n-kf5/ru/messages/frameworks/kdelibs4support.po (revision 1549883) @@ -1,13543 +1,13543 @@ # KDE - kdelibs/kdelibs4.po Russian translation. # Copyright (C) 2005, KDE Russian translation team. # # Denis Perchine , 2000. # Igor Trush , 2000. # Gregory Mokhin , 2000, 2004, 2005. # Albert R. Valiev , 2002, 2008. # Leonid Kanter , 2002, 2003, 2004, 2005, 2008. # Ivan Kashukov , 2003. # Nick Shaforostoff , 2004, 2005, 2006, 2007, 2008, 2009. # Andrey Cherepanov , 2005, 2006, 2007, 2008, 2009, 2011. # Evgeniy Ivanov , 2008. -# Alexander Potashev , 2009, 2010, 2011, 2014, 2015, 2016, 2018. +# Alexander Potashev , 2009, 2010, 2011, 2014, 2015, 2016, 2018, 2019. # Yury G. Kudryashov , 2011. # Yuri Efremov , 2011, 2012. # Inga Barinova , 2012. # Julia Dronova , 2012, 2013. # Alexander Lakhin , 2013. msgid "" msgstr "" "Project-Id-Version: kdelibs4\n" "Report-Msgid-Bugs-To: https://bugs.kde.org\n" "POT-Creation-Date: 2019-07-23 02:42+0200\n" -"PO-Revision-Date: 2018-04-25 17:54+0300\n" +"PO-Revision-Date: 2019-08-18 04:49+0300\n" "Last-Translator: Alexander Potashev \n" "Language-Team: Russian \n" "Language: ru\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Lokalize 2.0\n" +"X-Generator: Lokalize 19.07.70\n" "Plural-Forms: nplurals=4; plural=n==1 ? 3 : n%10==1 && n%100!=11 ? 0 : n" "%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2;\n" "X-Environment: kde\n" "X-Accelerator-Marker: &\n" "X-Text-Markup: kde4\n" #, kde-format msgctxt "NAME OF TRANSLATORS" msgid "Your names" msgstr "" "Денис Першин,Игорь Труш,Григорий Мохин,Альберт Валиев,Леонид Кантер,Иван " "Кашуков,Николай Шафоростов,Андрей Черепанов,Евгений Иванов,Александр Поташев," "Юрий Кудряшов,Юрий Ефремов,Инга Баринова,Юлия Дронова,Александр Лахин" #, kde-format msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" msgstr "" "dyp@perchine.com,trush@elcat.kg,mok@kde.ru,darkstar@altlinux.ru," "leon@asplinux.ru,dolphin210@yandex.ru,shafff@ukr.net,cas@altlinux.ru," "powerfox@kde.ru,aspotashev@gmail.com,urkud.urkud@gmail.com,yur.arh@gmail.com," "ingabarinova@gmail.com,juliette.tux@gmail.com,exclusion@gmail.com" #, kde-format msgctxt "color" msgid "AliceBlue" msgstr "Блекло-голубой" #, kde-format msgctxt "color" msgid "AntiqueWhite" msgstr "Белый-антик" #, kde-format msgctxt "color" msgid "AntiqueWhite1" msgstr "Белый-антик 1" #, kde-format msgctxt "color" msgid "AntiqueWhite2" msgstr "Белый-антик 2" #, kde-format msgctxt "color" msgid "AntiqueWhite3" msgstr "Белый-антик 3" #, kde-format msgctxt "color" msgid "AntiqueWhite4" msgstr "Белый-антик 4" #, kde-format msgctxt "color" msgid "BlanchedAlmond" msgstr "Светло-кремовый" #, kde-format msgctxt "color" msgid "BlueViolet" msgstr "Светло-фиолетовый" #, kde-format msgctxt "color" msgid "CadetBlue" msgstr "Серо-синий" #, kde-format msgctxt "color" msgid "CadetBlue1" msgstr "Серо-синий 1" #, kde-format msgctxt "color" msgid "CadetBlue2" msgstr "Серо-синий 2" #, kde-format msgctxt "color" msgid "CadetBlue3" msgstr "Серо-синий 3" #, kde-format msgctxt "color" msgid "CadetBlue4" msgstr "Серо-синий 4" #, kde-format msgctxt "color" msgid "CornflowerBlue" msgstr "Васильковый" #, kde-format msgctxt "color" msgid "DarkBlue" msgstr "Тёмно-синий" #, kde-format msgctxt "color" msgid "DarkCyan" msgstr "Тёмный циан" #, kde-format msgctxt "color" msgid "DarkGoldenrod" msgstr "Тёмно-золотистый" #, kde-format msgctxt "color" msgid "DarkGoldenrod1" msgstr "Тёмно-золотистый 1" #, kde-format msgctxt "color" msgid "DarkGoldenrod2" msgstr "Тёмно-золотистый 2" #, kde-format msgctxt "color" msgid "DarkGoldenrod3" msgstr "Тёмно-золотистый 3" #, kde-format msgctxt "color" msgid "DarkGoldenrod4" msgstr "Тёмно-золотистый 4" #, kde-format msgctxt "color" msgid "DarkGray" msgstr "Тёмно-серый" #, kde-format msgctxt "color" msgid "DarkGreen" msgstr "Тёмно-зелёный" #, kde-format msgctxt "color" msgid "DarkGrey" msgstr "Тёмно-серый" #, kde-format msgctxt "color" msgid "DarkKhaki" msgstr "Тёмный хаки" #, kde-format msgctxt "color" msgid "DarkMagenta" msgstr "Тёмный фуксин" #, kde-format msgctxt "color" msgid "DarkOliveGreen" msgstr "Тёмно-оливковый" #, kde-format msgctxt "color" msgid "DarkOliveGreen1" msgstr "Тёмно-оливковый 1" #, kde-format msgctxt "color" msgid "DarkOliveGreen2" msgstr "Тёмно-оливковый 2" #, kde-format msgctxt "color" msgid "DarkOliveGreen3" msgstr "Тёмно-оливковый 3" #, kde-format msgctxt "color" msgid "DarkOliveGreen4" msgstr "Тёмно-оливковый 4" #, kde-format msgctxt "color" msgid "DarkOrange" msgstr "Тёмно-оранжевый" #, kde-format msgctxt "color" msgid "DarkOrange1" msgstr "Тёмно-оранжевый 1" #, kde-format msgctxt "color" msgid "DarkOrange2" msgstr "Тёмно-оранжевый 2" #, kde-format msgctxt "color" msgid "DarkOrange3" msgstr "Тёмно-оранжевый 3" #, kde-format msgctxt "color" msgid "DarkOrange4" msgstr "Тёмно-оранжевый 4" #, kde-format msgctxt "color" msgid "DarkOrchid" msgstr "Тёмный орсель" #, kde-format msgctxt "color" msgid "DarkOrchid1" msgstr "Тёмный орсель 1" #, kde-format msgctxt "color" msgid "DarkOrchid2" msgstr "Тёмный орсель 2" #, kde-format msgctxt "color" msgid "DarkOrchid3" msgstr "Тёмный орсель 3" #, kde-format msgctxt "color" msgid "DarkOrchid4" msgstr "Тёмный орсель 4" #, kde-format msgctxt "color" msgid "DarkRed" msgstr "Тёмно-красный" #, kde-format msgctxt "color" msgid "DarkSalmon" msgstr "Тёмный оранжево-розовый" #, kde-format msgctxt "color" msgid "DarkSeaGreen" msgstr "Тёмный морской волны" #, kde-format msgctxt "color" msgid "DarkSeaGreen1" msgstr "Тёмный морской волны 1" #, kde-format msgctxt "color" msgid "DarkSeaGreen2" msgstr "Тёмный морской волны 2" #, kde-format msgctxt "color" msgid "DarkSeaGreen3" msgstr "Тёмный морской волны 3" #, kde-format msgctxt "color" msgid "DarkSeaGreen4" msgstr "Тёмный морской волны 4" #, kde-format msgctxt "color" msgid "DarkSlateBlue" msgstr "Тёмный грифельно-синий" #, kde-format msgctxt "color" msgid "DarkSlateGray" msgstr "Тёмный грифельно-серый" #, kde-format msgctxt "color" msgid "DarkSlateGray1" msgstr "Тёмный грифельно-серый 1" #, kde-format msgctxt "color" msgid "DarkSlateGray2" msgstr "Тёмный грифельно-серый 2" #, kde-format msgctxt "color" msgid "DarkSlateGray3" msgstr "Тёмный грифельно-серый 3" #, kde-format msgctxt "color" msgid "DarkSlateGray4" msgstr "Тёмный грифельно-серый 4" #, kde-format msgctxt "color" msgid "DarkSlateGrey" msgstr "Тёмный грифельно-серый" #, kde-format msgctxt "color" msgid "DarkTurquoise" msgstr "Тёмно-бирюзовый" #, kde-format msgctxt "color" msgid "DarkViolet" msgstr "Тёмно-фиолетовый" #, kde-format msgctxt "color" msgid "DeepPink" msgstr "Тёмно-розовый" #, kde-format msgctxt "color" msgid "DeepPink1" msgstr "Тёмно-розовый 1" #, kde-format msgctxt "color" msgid "DeepPink2" msgstr "Тёмно-розовый 2" #, kde-format msgctxt "color" msgid "DeepPink3" msgstr "Тёмно-розовый 3" #, kde-format msgctxt "color" msgid "DeepPink4" msgstr "Тёмно-розовый 4" #, kde-format msgctxt "color" msgid "DeepSkyBlue" msgstr "Тёмный небесно-голубой" #, kde-format msgctxt "color" msgid "DeepSkyBlue1" msgstr "Тёмный небесно-голубой 1" #, kde-format msgctxt "color" msgid "DeepSkyBlue2" msgstr "Тёмный небесно-голубой 2" #, kde-format msgctxt "color" msgid "DeepSkyBlue3" msgstr "Тёмный небесно-голубой 3" #, kde-format msgctxt "color" msgid "DeepSkyBlue4" msgstr "Тёмный небесно-голубой 4" #, kde-format msgctxt "color" msgid "DimGray" msgstr "Тускло-серый" #, kde-format msgctxt "color" msgid "DimGrey" msgstr "Тускло-серый" #, kde-format msgctxt "color" msgid "DodgerBlue" msgstr "Тускло-васильковый" #, kde-format msgctxt "color" msgid "DodgerBlue1" msgstr "Тускло-васильковый 1" #, kde-format msgctxt "color" msgid "DodgerBlue2" msgstr "Тускло-васильковый 2" #, kde-format msgctxt "color" msgid "DodgerBlue3" msgstr "Тускло-васильковый 3" #, kde-format msgctxt "color" msgid "DodgerBlue4" msgstr "Тускло-васильковый 4" #, kde-format msgctxt "color" msgid "FloralWhite" msgstr "Цветочно-белый" #, kde-format msgctxt "color" msgid "ForestGreen" msgstr "Зелёный лесной" #, kde-format msgctxt "color" msgid "GhostWhite" msgstr "Призрачно-белый" #, kde-format msgctxt "color" msgid "GreenYellow" msgstr "Жёлто-зелёный" #, kde-format msgctxt "color" msgid "HotPink" msgstr "Ярко-розовый" #, kde-format msgctxt "color" msgid "HotPink1" msgstr "Ярко-розовый 1" #, kde-format msgctxt "color" msgid "HotPink2" msgstr "Ярко-розовый 2" #, kde-format msgctxt "color" msgid "HotPink3" msgstr "Ярко-розовый 3" #, kde-format msgctxt "color" msgid "HotPink4" msgstr "Ярко-розовый 4" #, kde-format msgctxt "color" msgid "IndianRed" msgstr "Ярко-красный" #, kde-format msgctxt "color" msgid "IndianRed1" msgstr "Ярко-красный 1" #, kde-format msgctxt "color" msgid "IndianRed2" msgstr "Ярко-красный 2" #, kde-format msgctxt "color" msgid "IndianRed3" msgstr "Ярко-красный 3" #, kde-format msgctxt "color" msgid "IndianRed4" msgstr "Ярко-красный 4" #, kde-format msgctxt "color" msgid "LavenderBlush" msgstr "Голубой с красным отливом" #, kde-format msgctxt "color" msgid "LavenderBlush1" msgstr "Голубой с красным отливом 1" #, kde-format msgctxt "color" msgid "LavenderBlush2" msgstr "Голубой с красным отливом 2" #, kde-format msgctxt "color" msgid "LavenderBlush3" msgstr "Голубой с красным отливом 3" #, kde-format msgctxt "color" msgid "LavenderBlush4" msgstr "Голубой с красным отливом 4" #, kde-format msgctxt "color" msgid "LawnGreen" msgstr "Зелёная лужайка" #, kde-format msgctxt "color" msgid "LemonChiffon" msgstr "Лимонный" #, kde-format msgctxt "color" msgid "LemonChiffon1" msgstr "Лимонный 1" #, kde-format msgctxt "color" msgid "LemonChiffon2" msgstr "Лимонный 2" #, kde-format msgctxt "color" msgid "LemonChiffon3" msgstr "Лимонный 3" #, kde-format msgctxt "color" msgid "LemonChiffon4" msgstr "Лимонный 4" #, kde-format msgctxt "color" msgid "LightBlue" msgstr "Светло-синий" #, kde-format msgctxt "color" msgid "LightBlue1" msgstr "Светло-синий 1" #, kde-format msgctxt "color" msgid "LightBlue2" msgstr "Светло-синий 2" #, kde-format msgctxt "color" msgid "LightBlue3" msgstr "Светло-синий 3" #, kde-format msgctxt "color" msgid "LightBlue4" msgstr "Светло-синий 4" #, kde-format msgctxt "color" msgid "LightCoral" msgstr "Светло-коралловый" #, kde-format msgctxt "color" msgid "LightCyan" msgstr "Светлый циан" #, kde-format msgctxt "color" msgid "LightCyan1" msgstr "Светлый циан 1" #, kde-format msgctxt "color" msgid "LightCyan2" msgstr "Светлый циан 2" #, kde-format msgctxt "color" msgid "LightCyan3" msgstr "Светлый циан 3" #, kde-format msgctxt "color" msgid "LightCyan4" msgstr "Светлый циан 4" #, kde-format msgctxt "color" msgid "LightGoldenrod" msgstr "Светло-золотистый" #, kde-format msgctxt "color" msgid "LightGoldenrod1" msgstr "Светло-золотистый 1" #, kde-format msgctxt "color" msgid "LightGoldenrod2" msgstr "Светло-золотистый 2" #, kde-format msgctxt "color" msgid "LightGoldenrod3" msgstr "Светло-золотистый 3" #, kde-format msgctxt "color" msgid "LightGoldenrod4" msgstr "Светло-золотистый 4" #, kde-format msgctxt "color" msgid "LightGoldenrodYellow" msgstr "Светло-жёлтый золотистый" #, kde-format msgctxt "color" msgid "LightGray" msgstr "Светло-серый" #, kde-format msgctxt "color" msgid "LightGreen" msgstr "Светло-зелёный" #, kde-format msgctxt "color" msgid "LightGrey" msgstr "Светло-серый" #, kde-format msgctxt "color" msgid "LightPink" msgstr "Светло-розовый" #, kde-format msgctxt "color" msgid "LightPink1" msgstr "Светло-розовый 1" #, kde-format msgctxt "color" msgid "LightPink2" msgstr "Светло-розовый 2" #, kde-format msgctxt "color" msgid "LightPink3" msgstr "Светло-розовый 3" #, kde-format msgctxt "color" msgid "LightPink4" msgstr "Светло-розовый 4" #, kde-format msgctxt "color" msgid "LightSalmon" msgstr "Светлый сомон" #, kde-format msgctxt "color" msgid "LightSalmon1" msgstr "Светлый сомон 1" #, kde-format msgctxt "color" msgid "LightSalmon2" msgstr "Светлый сомон 2" #, kde-format msgctxt "color" msgid "LightSalmon3" msgstr "Светлый сомон 3" #, kde-format msgctxt "color" msgid "LightSalmon4" msgstr "Светлый сомон 4" #, kde-format msgctxt "color" msgid "LightSeaGreen" msgstr "Светлый морской волны" #, kde-format msgctxt "color" msgid "LightSkyBlue" msgstr "Светлый небесно-голубой" #, kde-format msgctxt "color" msgid "LightSkyBlue1" msgstr "Светлый небесно-голубой 1" #, kde-format msgctxt "color" msgid "LightSkyBlue2" msgstr "Светлый небесно-голубой 2" #, kde-format msgctxt "color" msgid "LightSkyBlue3" msgstr "Светлый небесно-голубой 3" #, kde-format msgctxt "color" msgid "LightSkyBlue4" msgstr "Светлый небесно-голубой 4" #, kde-format msgctxt "color" msgid "LightSlateBlue" msgstr "Светлый грифельно-синий" #, kde-format msgctxt "color" msgid "LightSlateGray" msgstr "Грифельно-серый" #, kde-format msgctxt "color" msgid "LightSlateGrey" msgstr "Грифельно-серый" #, kde-format msgctxt "color" msgid "LightSteelBlue" msgstr "Голубой со стальным оттенком" #, kde-format msgctxt "color" msgid "LightSteelBlue1" msgstr "Голубой со стальным оттенком 1" #, kde-format msgctxt "color" msgid "LightSteelBlue2" msgstr "Голубой со стальным оттенком 2" #, kde-format msgctxt "color" msgid "LightSteelBlue3" msgstr "Голубой со стальным оттенком 3" #, kde-format msgctxt "color" msgid "LightSteelBlue4" msgstr "Голубой со стальным оттенком 4" #, kde-format msgctxt "color" msgid "LightYellow" msgstr "Светло-жёлтый" #, kde-format msgctxt "color" msgid "LightYellow1" msgstr "Светло-жёлтый 1" #, kde-format msgctxt "color" msgid "LightYellow2" msgstr "Светло-жёлтый 2" #, kde-format msgctxt "color" msgid "LightYellow3" msgstr "Светло-жёлтый 3" #, kde-format msgctxt "color" msgid "LightYellow4" msgstr "Светло-жёлтый 4" #, kde-format msgctxt "color" msgid "LimeGreen" msgstr "Лимонно-зелёный" #, kde-format msgctxt "color" msgid "MediumAquamarine" msgstr "Умеренный аквамарин" #, kde-format msgctxt "color" msgid "MediumBlue" msgstr "Умеренный синий" #, kde-format msgctxt "color" msgid "MediumOrchid" msgstr "Умеренный орсель" #, kde-format msgctxt "color" msgid "MediumOrchid1" msgstr "Умеренный орсель 1" #, kde-format msgctxt "color" msgid "MediumOrchid2" msgstr "Умеренный орсель 2" #, kde-format msgctxt "color" msgid "MediumOrchid3" msgstr "Умеренный орсель 3" #, kde-format msgctxt "color" msgid "MediumOrchid4" msgstr "Умеренный орсель 4" #, kde-format msgctxt "color" msgid "MediumPurple" msgstr "Умеренный пурпурный" #, kde-format msgctxt "color" msgid "MediumPurple1" msgstr "Умеренный пурпурный 1" #, kde-format msgctxt "color" msgid "MediumPurple2" msgstr "Умеренный пурпурный 2" #, kde-format msgctxt "color" msgid "MediumPurple3" msgstr "Умеренный пурпурный 3" #, kde-format msgctxt "color" msgid "MediumPurple4" msgstr "Умеренный пурпурный 4" #, kde-format msgctxt "color" msgid "MediumSeaGreen" msgstr "Умеренный морской волны" #, kde-format msgctxt "color" msgid "MediumSlateBlue" msgstr "Умеренный грифельно-синий" #, kde-format msgctxt "color" msgid "MediumSpringGreen" msgstr "Умеренный весенне-зелёный" #, kde-format msgctxt "color" msgid "MediumTurquoise" msgstr "Умеренный бирюзовый" #, kde-format msgctxt "color" msgid "MediumVioletRed" msgstr "Умеренный красно-фиолетовый" #, kde-format msgctxt "color" msgid "MidnightBlue" msgstr "Полуночно-синий" #, kde-format msgctxt "color" msgid "MintCream" msgstr "Мятно-кремовый" #, kde-format msgctxt "color" msgid "MistyRose" msgstr "Бледно-розовый" #, kde-format msgctxt "color" msgid "MistyRose1" msgstr "Бледно-розовый 1" #, kde-format msgctxt "color" msgid "MistyRose2" msgstr "Бледно-розовый 2" #, kde-format msgctxt "color" msgid "MistyRose3" msgstr "Бледно-розовый 3" #, kde-format msgctxt "color" msgid "MistyRose4" msgstr "Бледно-розовый 4" #, kde-format msgctxt "color" msgid "NavajoWhite" msgstr "Белый навахо" #, kde-format msgctxt "color" msgid "NavajoWhite1" msgstr "Белый навахо 1" #, kde-format msgctxt "color" msgid "NavajoWhite2" msgstr "Белый навахо 2" #, kde-format msgctxt "color" msgid "NavajoWhite3" msgstr "Белый навахо 3" #, kde-format msgctxt "color" msgid "NavajoWhite4" msgstr "Белый навахо 4" #, kde-format msgctxt "color" msgid "NavyBlue" msgstr "Тёмно-синий морской" #, kde-format msgctxt "color" msgid "OldLace" msgstr "Старого коньяка" #, kde-format msgctxt "color" msgid "OliveDrab" msgstr "Нежно-оливковый" #, kde-format msgctxt "color" msgid "OliveDrab1" msgstr "Нежно-оливковый 1" #, kde-format msgctxt "color" msgid "OliveDrab2" msgstr "Нежно-оливковый 2" #, kde-format msgctxt "color" msgid "OliveDrab3" msgstr "Нежно-оливковый 3" #, kde-format msgctxt "color" msgid "OliveDrab4" msgstr "Нежно-оливковый 4" #, kde-format msgctxt "color" msgid "OrangeRed" msgstr "Оранжево-красный" #, kde-format msgctxt "color" msgid "OrangeRed1" msgstr "Оранжево-красный 1" #, kde-format msgctxt "color" msgid "OrangeRed2" msgstr "Оранжево-красный 2" #, kde-format msgctxt "color" msgid "OrangeRed3" msgstr "Оранжево-красный 3" #, kde-format msgctxt "color" msgid "OrangeRed4" msgstr "Оранжево-красный 4" #, kde-format msgctxt "color" msgid "PaleGoldenrod" msgstr "Бледно-золотистый" #, kde-format msgctxt "color" msgid "PaleGreen" msgstr "Бледно-зелёный" #, kde-format msgctxt "color" msgid "PaleGreen1" msgstr "Бледно-зелёный 1" #, kde-format msgctxt "color" msgid "PaleGreen2" msgstr "Бледно-зелёный 2" #, kde-format msgctxt "color" msgid "PaleGreen3" msgstr "Бледно-зелёный 3" #, kde-format msgctxt "color" msgid "PaleGreen4" msgstr "Бледно-зелёный 4" #, kde-format msgctxt "color" msgid "PaleTurquoise" msgstr "Бледно-бирюзовый" #, kde-format msgctxt "color" msgid "PaleTurquoise1" msgstr "Бледно-бирюзовый 1" #, kde-format msgctxt "color" msgid "PaleTurquoise2" msgstr "Бледно-бирюзовый 2" #, kde-format msgctxt "color" msgid "PaleTurquoise3" msgstr "Бледно-бирюзовый 3" #, kde-format msgctxt "color" msgid "PaleTurquoise4" msgstr "Бледно-бирюзовый 4" #, kde-format msgctxt "color" msgid "PaleVioletRed" msgstr "Бледный красно-фиолетовый" #, kde-format msgctxt "color" msgid "PaleVioletRed1" msgstr "Бледный красно-фиолетовый 1" #, kde-format msgctxt "color" msgid "PaleVioletRed2" msgstr "Бледный красно-фиолетовый 2" #, kde-format msgctxt "color" msgid "PaleVioletRed3" msgstr "Бледный красно-фиолетовый 3" #, kde-format msgctxt "color" msgid "PaleVioletRed4" msgstr "Бледный красно-фиолетовый 4" #, kde-format msgctxt "color" msgid "PapayaWhip" msgstr "Дынный" #, kde-format msgctxt "color" msgid "PeachPuff" msgstr "Персиковый" #, kde-format msgctxt "color" msgid "PeachPuff1" msgstr "Персиковый 1" #, kde-format msgctxt "color" msgid "PeachPuff2" msgstr "Персиковый 2" #, kde-format msgctxt "color" msgid "PeachPuff3" msgstr "Персиковый 3" #, kde-format msgctxt "color" msgid "PeachPuff4" msgstr "Персиковый 4" #, kde-format msgctxt "color" msgid "PowderBlue" msgstr "Синий с пороховым оттенком" #, kde-format msgctxt "color" msgid "RosyBrown" msgstr "Розово-коричневый" #, kde-format msgctxt "color" msgid "RosyBrown1" msgstr "Розово-коричневый 1" #, kde-format msgctxt "color" msgid "RosyBrown2" msgstr "Розово-коричневый 2" #, kde-format msgctxt "color" msgid "RosyBrown3" msgstr "Розово-коричневый 3" #, kde-format msgctxt "color" msgid "RosyBrown4" msgstr "Розово-коричневый 4" #, kde-format msgctxt "color" msgid "RoyalBlue" msgstr "Голубой королевский" #, kde-format msgctxt "color" msgid "RoyalBlue1" msgstr "Голубой королевский 1" #, kde-format msgctxt "color" msgid "RoyalBlue2" msgstr "Голубой королевский 2" #, kde-format msgctxt "color" msgid "RoyalBlue3" msgstr "Голубой королевский 3" #, kde-format msgctxt "color" msgid "RoyalBlue4" msgstr "Голубой королевский 4" #, kde-format msgctxt "color" msgid "SaddleBrown" msgstr "Кожано-коричневый" #, kde-format msgctxt "color" msgid "SandyBrown" msgstr "Песочно-коричневый" #, kde-format msgctxt "color" msgid "SeaGreen" msgstr "Морской волны" #, kde-format msgctxt "color" msgid "SeaGreen1" msgstr "Морской волны 1" #, kde-format msgctxt "color" msgid "SeaGreen2" msgstr "Морской волны 2" #, kde-format msgctxt "color" msgid "SeaGreen3" msgstr "Морской волны 3" #, kde-format msgctxt "color" msgid "SeaGreen4" msgstr "Морской волны 4" #, kde-format msgctxt "color" msgid "SkyBlue" msgstr "Небесно-голубой" #, kde-format msgctxt "color" msgid "SkyBlue1" msgstr "Небесно-голубой 1" #, kde-format msgctxt "color" msgid "SkyBlue2" msgstr "Небесно-голубой 2" #, kde-format msgctxt "color" msgid "SkyBlue3" msgstr "Небесно-голубой 3" #, kde-format msgctxt "color" msgid "SkyBlue4" msgstr "Небесно-голубой 4" #, kde-format msgctxt "color" msgid "SlateBlue" msgstr "Грифельно-синий" #, kde-format msgctxt "color" msgid "SlateBlue1" msgstr "Грифельно-синий 1" #, kde-format msgctxt "color" msgid "SlateBlue2" msgstr "Грифельно-синий 2" #, kde-format msgctxt "color" msgid "SlateBlue3" msgstr "Грифельно-синий 3" #, kde-format msgctxt "color" msgid "SlateBlue4" msgstr "Грифельно-синий 4" #, kde-format msgctxt "color" msgid "SlateGray" msgstr "Синевато-серый" #, kde-format msgctxt "color" msgid "SlateGray1" msgstr "Синевато-серый 1" #, kde-format msgctxt "color" msgid "SlateGray2" msgstr "Синевато-серый 2" #, kde-format msgctxt "color" msgid "SlateGray3" msgstr "Синевато-серый 3" #, kde-format msgctxt "color" msgid "SlateGray4" msgstr "Синевато-серый 4" #, kde-format msgctxt "color" msgid "SlateGrey" msgstr "Синевато-серый" #, kde-format msgctxt "color" msgid "SpringGreen" msgstr "Весенне-зелёный" #, kde-format msgctxt "color" msgid "SpringGreen1" msgstr "Весенне-зелёный 1" #, kde-format msgctxt "color" msgid "SpringGreen2" msgstr "Весенне-зелёный 2" #, kde-format msgctxt "color" msgid "SpringGreen3" msgstr "Весенне-зелёный 3" #, kde-format msgctxt "color" msgid "SpringGreen4" msgstr "Весенне-зелёный 4" #, kde-format msgctxt "color" msgid "SteelBlue" msgstr "Синий со стальным оттенком" #, kde-format msgctxt "color" msgid "SteelBlue1" msgstr "Синий со стальным оттенком 1" #, kde-format msgctxt "color" msgid "SteelBlue2" msgstr "Синий со стальным оттенком 2" #, kde-format msgctxt "color" msgid "SteelBlue3" msgstr "Синий со стальным оттенком 3" #, kde-format msgctxt "color" msgid "SteelBlue4" msgstr "Синий со стальным оттенком 4" #, kde-format msgctxt "color" msgid "VioletRed" msgstr "Красно-фиолетовый" #, kde-format msgctxt "color" msgid "VioletRed1" msgstr "Красно-фиолетовый 1" #, kde-format msgctxt "color" msgid "VioletRed2" msgstr "Красно-фиолетовый 2" #, kde-format msgctxt "color" msgid "VioletRed3" msgstr "Красно-фиолетовый 3" #, kde-format msgctxt "color" msgid "VioletRed4" msgstr "Красно-фиолетовый 4" #, kde-format msgctxt "color" msgid "WhiteSmoke" msgstr "Белый дымчатый" #, kde-format msgctxt "color" msgid "YellowGreen" msgstr "Жёлто-зелёный" #, kde-format msgctxt "color" msgid "aquamarine" msgstr "Аквамарин" #, kde-format msgctxt "color" msgid "aquamarine1" msgstr "Аквамарин 1" #, kde-format msgctxt "color" msgid "aquamarine2" msgstr "Аквамарин 2" #, kde-format msgctxt "color" msgid "aquamarine3" msgstr "Аквамарин 3" #, kde-format msgctxt "color" msgid "aquamarine4" msgstr "Аквамарин 4" #, kde-format msgctxt "color" msgid "azure" msgstr "Лазурный" #, kde-format msgctxt "color" msgid "azure1" msgstr "Лазурный 1" #, kde-format msgctxt "color" msgid "azure2" msgstr "Лазурный 2" #, kde-format msgctxt "color" msgid "azure3" msgstr "Лазурный 3" #, kde-format msgctxt "color" msgid "azure4" msgstr "Лазурный 4" #, kde-format msgctxt "color" msgid "beige" msgstr "Бежевый" #, kde-format msgctxt "color" msgid "bisque" msgstr "Бисквитный" #, kde-format msgctxt "color" msgid "bisque1" msgstr "Бисквитный 1" #, kde-format msgctxt "color" msgid "bisque2" msgstr "Бисквитный 2" #, kde-format msgctxt "color" msgid "bisque3" msgstr "Бисквитный 3" #, kde-format msgctxt "color" msgid "bisque4" msgstr "Бисквитный 4" #, kde-format msgctxt "color" msgid "black" msgstr "Чёрный" #, kde-format msgctxt "color" msgid "blue" msgstr "Синий" #, kde-format msgctxt "color" msgid "blue1" msgstr "Синий 1" #, kde-format msgctxt "color" msgid "blue2" msgstr "Синий 2" #, kde-format msgctxt "color" msgid "blue3" msgstr "Синий 3" #, kde-format msgctxt "color" msgid "blue4" msgstr "Синий 4" #, kde-format msgctxt "color" msgid "brown" msgstr "Коричневый" #, kde-format msgctxt "color" msgid "brown1" msgstr "Коричневый 1" #, kde-format msgctxt "color" msgid "brown2" msgstr "Коричневый 2" #, kde-format msgctxt "color" msgid "brown3" msgstr "Коричневый 3" #, kde-format msgctxt "color" msgid "brown4" msgstr "Коричневый 4" #, kde-format msgctxt "color" msgid "burlywood" msgstr "Желтоватый" #, kde-format msgctxt "color" msgid "burlywood1" msgstr "Желтоватый 1" #, kde-format msgctxt "color" msgid "burlywood2" msgstr "Желтоватый 2" #, kde-format msgctxt "color" msgid "burlywood3" msgstr "Желтоватый 3" #, kde-format msgctxt "color" msgid "burlywood4" msgstr "Желтоватый 4" #, kde-format msgctxt "color" msgid "chartreuse" msgstr "Зеленовато-жёлтый" #, kde-format msgctxt "color" msgid "chartreuse1" msgstr "Зеленовато-жёлтый 1" #, kde-format msgctxt "color" msgid "chartreuse2" msgstr "Зеленовато-жёлтый 2" #, kde-format msgctxt "color" msgid "chartreuse3" msgstr "Зеленовато-жёлтый 3" #, kde-format msgctxt "color" msgid "chartreuse4" msgstr "Зеленовато-жёлтый 4" #, kde-format msgctxt "color" msgid "chocolate" msgstr "Шоколадный" #, kde-format msgctxt "color" msgid "chocolate1" msgstr "Шоколадный 1" #, kde-format msgctxt "color" msgid "chocolate2" msgstr "Шоколадный 2" #, kde-format msgctxt "color" msgid "chocolate3" msgstr "Шоколадный 3" #, kde-format msgctxt "color" msgid "chocolate4" msgstr "Шоколадный 4" #, kde-format msgctxt "color" msgid "coral" msgstr "Коралловый" #, kde-format msgctxt "color" msgid "coral1" msgstr "Коралловый 1" #, kde-format msgctxt "color" msgid "coral2" msgstr "Коралловый 2" #, kde-format msgctxt "color" msgid "coral3" msgstr "Коралловый 3" #, kde-format msgctxt "color" msgid "coral4" msgstr "Коралловый 4" #, kde-format msgctxt "color" msgid "cornsilk" msgstr "Шёлковый оттенок" #, kde-format msgctxt "color" msgid "cornsilk1" msgstr "Шёлковый оттенок 1" #, kde-format msgctxt "color" msgid "cornsilk2" msgstr "Шёлковый оттенок 2" #, kde-format msgctxt "color" msgid "cornsilk3" msgstr "Шёлковый оттенок 3" #, kde-format msgctxt "color" msgid "cornsilk4" msgstr "Шёлковый оттенок 4" #, kde-format msgctxt "color" msgid "cyan" msgstr "Зеленовато-голубой" #, kde-format msgctxt "color" msgid "cyan1" msgstr "Зеленовато-голубой 1" #, kde-format msgctxt "color" msgid "cyan2" msgstr "Зеленовато-голубой 2" #, kde-format msgctxt "color" msgid "cyan3" msgstr "Зеленовато-голубой 3" #, kde-format msgctxt "color" msgid "cyan4" msgstr "Зеленовато-голубой 4" #, kde-format msgctxt "color" msgid "firebrick" msgstr "Кирпичный" #, kde-format msgctxt "color" msgid "firebrick1" msgstr "Кирпичный 1" #, kde-format msgctxt "color" msgid "firebrick2" msgstr "Кирпичный 2" #, kde-format msgctxt "color" msgid "firebrick3" msgstr "Кирпичный 3" #, kde-format msgctxt "color" msgid "firebrick4" msgstr "Кирпичный 4" #, kde-format msgctxt "color" msgid "gainsboro" msgstr "Гейнсборо" #, kde-format msgctxt "color" msgid "gold" msgstr "Золотой" #, kde-format msgctxt "color" msgid "gold1" msgstr "Золотой 1" #, kde-format msgctxt "color" msgid "gold2" msgstr "Золотой 2" #, kde-format msgctxt "color" msgid "gold3" msgstr "Золотой 3" #, kde-format msgctxt "color" msgid "gold4" msgstr "Золотой 4" #, kde-format msgctxt "color" msgid "goldenrod" msgstr "Золотистый" #, kde-format msgctxt "color" msgid "goldenrod1" msgstr "Золотистый 1" #, kde-format msgctxt "color" msgid "goldenrod2" msgstr "Золотистый 2" #, kde-format msgctxt "color" msgid "goldenrod3" msgstr "Золотистый 3" #, kde-format msgctxt "color" msgid "goldenrod4" msgstr "Золотистый 4" #, kde-format msgctxt "color" msgid "green" msgstr "Зелёный" #, kde-format msgctxt "color" msgid "green1" msgstr "Зелёный 1" #, kde-format msgctxt "color" msgid "green2" msgstr "Зелёный 2" #, kde-format msgctxt "color" msgid "green3" msgstr "Зелёный 3" #, kde-format msgctxt "color" msgid "green4" msgstr "Зелёный 4" #, kde-format msgctxt "color" msgid "honeydew" msgstr "Медовый" #, kde-format msgctxt "color" msgid "honeydew1" msgstr "Медовый 1" #, kde-format msgctxt "color" msgid "honeydew2" msgstr "Медовый 2" #, kde-format msgctxt "color" msgid "honeydew3" msgstr "Медовый 3" #, kde-format msgctxt "color" msgid "honeydew4" msgstr "Медовый 4" #, kde-format msgctxt "color" msgid "ivory" msgstr "Слоновая кость" #, kde-format msgctxt "color" msgid "ivory1" msgstr "Слоновая кость 1" #, kde-format msgctxt "color" msgid "ivory2" msgstr "Слоновая кость 2" #, kde-format msgctxt "color" msgid "ivory3" msgstr "Слоновая кость 3" #, kde-format msgctxt "color" msgid "ivory4" msgstr "Слоновая кость 4" #, kde-format msgctxt "color" msgid "khaki" msgstr "Хаки" #, kde-format msgctxt "color" msgid "khaki1" msgstr "Хаки 1" #, kde-format msgctxt "color" msgid "khaki2" msgstr "Хаки 2" #, kde-format msgctxt "color" msgid "khaki3" msgstr "Хаки 3" #, kde-format msgctxt "color" msgid "khaki4" msgstr "Хаки 4" #, kde-format msgctxt "color" msgid "lavender" msgstr "Бледно-лиловый" #, kde-format msgctxt "color" msgid "linen" msgstr "Льняной" #, kde-format msgctxt "color" msgid "magenta" msgstr "Фуксин" #, kde-format msgctxt "color" msgid "magenta1" msgstr "Фуксин 1" #, kde-format msgctxt "color" msgid "magenta2" msgstr "Фуксин 2" #, kde-format msgctxt "color" msgid "magenta3" msgstr "Фуксин 3" #, kde-format msgctxt "color" msgid "magenta4" msgstr "Фуксин 4" #, kde-format msgctxt "color" msgid "maroon" msgstr "Тёмно-бордовый" #, kde-format msgctxt "color" msgid "maroon1" msgstr "Тёмно-бордовый 1" #, kde-format msgctxt "color" msgid "maroon2" msgstr "Тёмно-бордовый 2" #, kde-format msgctxt "color" msgid "maroon3" msgstr "Тёмно-бордовый 3" #, kde-format msgctxt "color" msgid "maroon4" msgstr "Тёмно-бордовый 4" #, kde-format msgctxt "color" msgid "moccasin" msgstr "Телесный" #, kde-format msgctxt "color" msgid "navy" msgstr "Тёмно-синий морской" #, kde-format msgctxt "color" msgid "orange" msgstr "Оранжевый" #, kde-format msgctxt "color" msgid "orange1" msgstr "Оранжевый 1" #, kde-format msgctxt "color" msgid "orange2" msgstr "Оранжевый 2" #, kde-format msgctxt "color" msgid "orange3" msgstr "Оранжевый 3" #, kde-format msgctxt "color" msgid "orange4" msgstr "Оранжевый 4" #, kde-format msgctxt "color" msgid "orchid" msgstr "Орсель" #, kde-format msgctxt "color" msgid "orchid1" msgstr "Орсель 1" #, kde-format msgctxt "color" msgid "orchid2" msgstr "Орсель 2" #, kde-format msgctxt "color" msgid "orchid3" msgstr "Орсель 3" #, kde-format msgctxt "color" msgid "orchid4" msgstr "Орсель 4" #, kde-format msgctxt "color" msgid "peru" msgstr "Тёмно-рыжий" #, kde-format msgctxt "color" msgid "pink" msgstr "Розовый" #, kde-format msgctxt "color" msgid "pink1" msgstr "Розовый 1" #, kde-format msgctxt "color" msgid "pink2" msgstr "Розовый 2" #, kde-format msgctxt "color" msgid "pink3" msgstr "Розовый 3" #, kde-format msgctxt "color" msgid "pink4" msgstr "Розовый 4" #, kde-format msgctxt "color" msgid "plum" msgstr "Сливовый" #, kde-format msgctxt "color" msgid "plum1" msgstr "Сливовый 1" #, kde-format msgctxt "color" msgid "plum2" msgstr "Сливовый 2" #, kde-format msgctxt "color" msgid "plum3" msgstr "Сливовый 3" #, kde-format msgctxt "color" msgid "plum4" msgstr "Сливовый 4" #, kde-format msgctxt "color" msgid "purple" msgstr "Пурпурный" #, kde-format msgctxt "color" msgid "purple1" msgstr "Пурпурный 1" #, kde-format msgctxt "color" msgid "purple2" msgstr "Пурпурный 2" #, kde-format msgctxt "color" msgid "purple3" msgstr "Пурпурный 3" #, kde-format msgctxt "color" msgid "purple4" msgstr "Пурпурный 4" #, kde-format msgctxt "color" msgid "red" msgstr "Красный" #, kde-format msgctxt "color" msgid "red1" msgstr "Красный 1" #, kde-format msgctxt "color" msgid "red2" msgstr "Красный 2" #, kde-format msgctxt "color" msgid "red3" msgstr "Красный 3" #, kde-format msgctxt "color" msgid "red4" msgstr "Красный 4" #, kde-format msgctxt "color" msgid "salmon" msgstr "Сомон" #, kde-format msgctxt "color" msgid "salmon1" msgstr "Сомон 1" #, kde-format msgctxt "color" msgid "salmon2" msgstr "Сомон 2" #, kde-format msgctxt "color" msgid "salmon3" msgstr "Сомон 3" #, kde-format msgctxt "color" msgid "salmon4" msgstr "Сомон 4" #, kde-format msgctxt "color" msgid "seashell" msgstr "Морской раковины" #, kde-format msgctxt "color" msgid "seashell1" msgstr "Морской раковины 1" #, kde-format msgctxt "color" msgid "seashell2" msgstr "Морской раковины 2" #, kde-format msgctxt "color" msgid "seashell3" msgstr "Морской раковины 3" #, kde-format msgctxt "color" msgid "seashell4" msgstr "Морской раковины 4" #, kde-format msgctxt "color" msgid "sienna" msgstr "Охра" #, kde-format msgctxt "color" msgid "sienna1" msgstr "Охра 1" #, kde-format msgctxt "color" msgid "sienna2" msgstr "Охра 2" #, kde-format msgctxt "color" msgid "sienna3" msgstr "Охра 3" #, kde-format msgctxt "color" msgid "sienna4" msgstr "Охра 4" #, kde-format msgctxt "color" msgid "snow" msgstr "Белоснежный" #, kde-format msgctxt "color" msgid "snow1" msgstr "Белоснежный 1" #, kde-format msgctxt "color" msgid "snow2" msgstr "Белоснежный 2" #, kde-format msgctxt "color" msgid "snow3" msgstr "Белоснежный 3" #, kde-format msgctxt "color" msgid "snow4" msgstr "Белоснежный 4" #, kde-format msgctxt "color" msgid "tan" msgstr "Рыжевато-коричневый" #, kde-format msgctxt "color" msgid "tan1" msgstr "Рыжевато-коричневый 1" #, kde-format msgctxt "color" msgid "tan2" msgstr "Рыжевато-коричневый 2" #, kde-format msgctxt "color" msgid "tan3" msgstr "Рыжевато-коричневый 3" #, kde-format msgctxt "color" msgid "tan4" msgstr "Рыжевато-коричневый 4" #, kde-format msgctxt "color" msgid "thistle" msgstr "Чертополоха" #, kde-format msgctxt "color" msgid "thistle1" msgstr "Чертополоха 1" #, kde-format msgctxt "color" msgid "thistle2" msgstr "Чертополоха 2" #, kde-format msgctxt "color" msgid "thistle3" msgstr "Чертополоха 3" #, kde-format msgctxt "color" msgid "thistle4" msgstr "Чертополоха 4" #, kde-format msgctxt "color" msgid "tomato" msgstr "Томатный" #, kde-format msgctxt "color" msgid "tomato1" msgstr "Томатный 1" #, kde-format msgctxt "color" msgid "tomato2" msgstr "Томатный 2" #, kde-format msgctxt "color" msgid "tomato3" msgstr "Томатный 3" #, kde-format msgctxt "color" msgid "tomato4" msgstr "Томатный 4" #, kde-format msgctxt "color" msgid "turquoise" msgstr "Бирюзовый" #, kde-format msgctxt "color" msgid "turquoise1" msgstr "Бирюзовый 1" #, kde-format msgctxt "color" msgid "turquoise2" msgstr "Бирюзовый 2" #, kde-format msgctxt "color" msgid "turquoise3" msgstr "Бирюзовый 3" #, kde-format msgctxt "color" msgid "turquoise4" msgstr "Бирюзовый 4" #, kde-format msgctxt "color" msgid "violet" msgstr "Фиолетовый" #, kde-format msgctxt "color" msgid "wheat" msgstr "Пшеничный" #, kde-format msgctxt "color" msgid "wheat1" msgstr "Пшеничный 1" #, kde-format msgctxt "color" msgid "wheat2" msgstr "Пшеничный 2" #, kde-format msgctxt "color" msgid "wheat3" msgstr "Пшеничный 3" #, kde-format msgctxt "color" msgid "wheat4" msgstr "Пшеничный 4" #, kde-format msgctxt "color" msgid "white" msgstr "Белый" #, kde-format msgctxt "color" msgid "yellow" msgstr "Жёлтый" #, kde-format msgctxt "color" msgid "yellow1" msgstr "Жёлтый 1" #, kde-format msgctxt "color" msgid "yellow2" msgstr "Жёлтый 2" #, kde-format msgctxt "color" msgid "yellow3" msgstr "Жёлтый 3" #, kde-format msgctxt "color" msgid "yellow4" msgstr "Жёлтый 4" #: kdebugdialog/kdebugdialog.cpp:43 kdebugdialog/klistdebugdialog.cpp:37 #, kde-format msgid "Debug Settings" msgstr "Настройка отладки" #: kdebugdialog/kdebugdialog.cpp:58 #, kde-format msgid "File" msgstr "Файл" #: kdebugdialog/kdebugdialog.cpp:59 #, kde-format msgid "Message Box" msgstr "Окно сообщения" #: kdebugdialog/kdebugdialog.cpp:60 #, kde-format msgid "Shell" msgstr "Оболочка" #: kdebugdialog/kdebugdialog.cpp:61 #, kde-format msgid "Syslog" msgstr "Журнал системных сообщений" #: kdebugdialog/kdebugdialog.cpp:62 #, kde-format msgid "None" msgstr "Ничего" #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) #: kdebugdialog/kdebugdialog.ui:48 #, kde-format msgid "Information" msgstr "Сведения" #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (text), widget (QLabel, label_8) #. i18n: ectx: property (text), widget (QLabel, label_4) #. i18n: ectx: property (text), widget (QLabel, label_6) #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 #, kde-format msgid "Output to:" msgstr "Вывод в:" #. i18n: ectx: property (text), widget (QLabel, label_3) #. i18n: ectx: property (text), widget (QLabel, label_9) #. i18n: ectx: property (text), widget (QLabel, label_5) #. i18n: ectx: property (text), widget (QLabel, label_7) #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 #, kde-format msgid "Filename:" msgstr "Имя файла:" #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) #: kdebugdialog/kdebugdialog.ui:83 #, kde-format msgid "Error" msgstr "Ошибка" #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) #: kdebugdialog/kdebugdialog.ui:118 #, kde-format msgid "Abort on fatal errors" msgstr "Отмена при фатальных ошибках" #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:77 #, kde-format msgid "Disable all debug output" msgstr "Отключить вывод любой отладочной информации" #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) #: kdebugdialog/kdebugdialog.ui:145 #, kde-format msgid "Warning" msgstr "Предупреждение" #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) #: kdebugdialog/kdebugdialog.ui:180 #, kde-format msgid "Fatal Error" msgstr "Критическая ошибка" #: kdebugdialog/klistdebugdialog.cpp:68 #, kde-format msgid "&Select All" msgstr "Выбрать в&се" #: kdebugdialog/klistdebugdialog.cpp:69 #, kde-format msgid "&Deselect All" msgstr "Отменить весь вы&бор" #: kdebugdialog/main.cpp:100 #, kde-format msgid "KDebugDialog" msgstr "KDebugDialog" #: kdebugdialog/main.cpp:101 #, kde-format msgid "A dialog box for setting preferences for debug output" msgstr "Диалог настройки свойств вывода отладки" #: kdebugdialog/main.cpp:102 #, kde-format msgid "Copyright 1999-2009, David Faure " msgstr "© David Faure , 1999-2009" #: kdebugdialog/main.cpp:103 #, kde-format msgid "David Faure" msgstr "David Faure" #: kdebugdialog/main.cpp:103 #, kde-format msgid "Maintainer" msgstr "Сопровождающий" #: kdebugdialog/main.cpp:108 #, kde-format msgid "Show the fully-fledged dialog instead of the default list dialog" msgstr "Показать полнофункциональный диалог вместо диалога по умолчанию." #: kdebugdialog/main.cpp:109 #, kde-format msgid "Turn area on" msgstr "Показывать отладочную информацию" #: kdebugdialog/main.cpp:110 #, kde-format msgid "Turn area off" msgstr "Не показывать отладочную информацию" #: kdecore/k3resolver.cpp:535 kdecore/netsupp.cpp:868 #, kde-format msgid "no error" msgstr "нет ошибки" #: kdecore/k3resolver.cpp:536 #, kde-format msgid "requested family not supported for this host name" msgstr "Для указанного имени сервера требуемое семейство не поддерживается" #: kdecore/k3resolver.cpp:537 kdecore/netsupp.cpp:870 #, kde-format msgid "temporary failure in name resolution" msgstr "временный сбой разрешения имён" #: kdecore/k3resolver.cpp:538 kdecore/netsupp.cpp:872 #, kde-format msgid "non-recoverable failure in name resolution" msgstr "фатальный сбой разрешения имён" #: kdecore/k3resolver.cpp:539 #, kde-format msgid "invalid flags" msgstr "неверные флаги" #: kdecore/k3resolver.cpp:540 kdecore/netsupp.cpp:874 #, kde-format msgid "memory allocation failure" msgstr "ошибка выделения памяти" #: kdecore/k3resolver.cpp:541 kdecore/netsupp.cpp:876 #, kde-format msgid "name or service not known" msgstr "неизвестное имя или сервис" #: kdecore/k3resolver.cpp:542 #, kde-format msgid "requested family not supported" msgstr "запрошенное семейство не поддерживается" #: kdecore/k3resolver.cpp:543 #, kde-format msgid "requested service not supported for this socket type" msgstr "запрошенный сервис не поддерживается этим типом сокета" #: kdecore/k3resolver.cpp:544 #, kde-format msgid "requested socket type not supported" msgstr "запрошенный тип сокета не поддерживается" #: kdecore/k3resolver.cpp:545 #, kde-format msgid "unknown error" msgstr "неизвестная ошибка" #: kdecore/k3resolver.cpp:547 #, kde-format msgctxt "1: the i18n'ed system error code, from errno" msgid "system error: %1" msgstr "системная ошибка: %1" #: kdecore/k3resolver.cpp:558 #, kde-format msgid "request was canceled" msgstr "запрос отменён" #: kdecore/k3socketaddress.cpp:631 #, kde-format msgctxt "1: the unknown socket address family number" msgid "Unknown family %1" msgstr "Неизвестная гарнитура %1" #: kdecore/k3socketbase.cpp:215 #, kde-format msgctxt "Socket error code NoError" msgid "no error" msgstr "нет ошибки" #: kdecore/k3socketbase.cpp:220 #, kde-format msgctxt "Socket error code LookupFailure" msgid "name lookup has failed" msgstr "ошибка разрешения имени" #: kdecore/k3socketbase.cpp:225 #, kde-format msgctxt "Socket error code AddressInUse" msgid "address already in use" msgstr "адрес уже используется" #: kdecore/k3socketbase.cpp:230 #, kde-format msgctxt "Socket error code AlreadyBound" msgid "socket is already bound" msgstr "сокет уже связан с адресом и портом" #: kdecore/k3socketbase.cpp:235 #, kde-format msgctxt "Socket error code AlreadyCreated" msgid "socket is already created" msgstr "сокет уже создан" #: kdecore/k3socketbase.cpp:240 #, kde-format msgctxt "Socket error code NotBound" msgid "socket is not bound" msgstr "сокет свободен" #: kdecore/k3socketbase.cpp:245 #, kde-format msgctxt "Socket error code NotCreated" msgid "socket has not been created" msgstr "сокет не создан" #: kdecore/k3socketbase.cpp:250 #, kde-format msgctxt "Socket error code WouldBlock" msgid "operation would block" msgstr "операция привела бы к блокировке" #: kdecore/k3socketbase.cpp:255 #, kde-format msgctxt "Socket error code ConnectionRefused" msgid "connection actively refused" msgstr "соединение отвергнуто" #: kdecore/k3socketbase.cpp:260 #, kde-format msgctxt "Socket error code ConnectionTimedOut" msgid "connection timed out" msgstr "время ожидания соединения истекло" #: kdecore/k3socketbase.cpp:265 #, kde-format msgctxt "Socket error code InProgress" msgid "operation is already in progress" msgstr "операция уже выполняется" #: kdecore/k3socketbase.cpp:270 #, kde-format msgctxt "Socket error code NetFailure" msgid "network failure occurred" msgstr "сбой сети" #: kdecore/k3socketbase.cpp:275 #, kde-format msgctxt "Socket error code NotSupported" msgid "operation is not supported" msgstr "операция не поддерживается" #: kdecore/k3socketbase.cpp:280 #, kde-format msgctxt "Socket error code Timeout" msgid "timed operation timed out" msgstr "истекло время ожидания операции" #: kdecore/k3socketbase.cpp:285 #, kde-format msgctxt "Socket error code UnknownError" msgid "an unknown/unexpected error has happened" msgstr "неизвестная или непредвиденная ошибка" #: kdecore/k3socketbase.cpp:290 #, kde-format msgctxt "Socket error code RemotelyDisconnected" msgid "remote host closed connection" msgstr "Удалённый узел закрыл соединение" #: kdecore/k4aboutdata.cpp:267 #, kde-format msgid "" "No licensing terms for this program have been specified.\n" "Please check the documentation or the source for any\n" "licensing terms.\n" msgstr "" "Лицензия в данной программе не указана.\n" "Возможно, она указана в документации или в исходных текстах этой программы.\n" #: kdecore/k4aboutdata.cpp:273 #, kde-format msgid "This program is distributed under the terms of the %1." msgstr "Программа распространяется на условиях %1." #: kdecore/k4aboutdata.cpp:297 #, kde-format msgctxt "@item license (short name)" msgid "GPL v2" msgstr "GPL v2" #: kdecore/k4aboutdata.cpp:298 #, kde-format msgctxt "@item license" msgid "GNU General Public License Version 2" msgstr "GNU General Public License, версия 2" #: kdecore/k4aboutdata.cpp:301 #, kde-format msgctxt "@item license (short name)" msgid "LGPL v2" msgstr "LGPL v2" #: kdecore/k4aboutdata.cpp:302 #, kde-format msgctxt "@item license" msgid "GNU Lesser General Public License Version 2" msgstr "GNU Lesser General Public License, версия 2" #: kdecore/k4aboutdata.cpp:305 #, kde-format msgctxt "@item license (short name)" msgid "BSD License" msgstr "Лицензия BSD" #: kdecore/k4aboutdata.cpp:306 #, kde-format msgctxt "@item license" msgid "BSD License" msgstr "Лицензия BSD" #: kdecore/k4aboutdata.cpp:309 #, kde-format msgctxt "@item license (short name)" msgid "Artistic License" msgstr "Artistic License" #: kdecore/k4aboutdata.cpp:310 #, kde-format msgctxt "@item license" msgid "Artistic License" msgstr "Artistic License" #: kdecore/k4aboutdata.cpp:313 #, kde-format msgctxt "@item license (short name)" msgid "QPL v1.0" msgstr "QPL v1.0" #: kdecore/k4aboutdata.cpp:314 #, kde-format msgctxt "@item license" msgid "Q Public License" msgstr "Q Public License" #: kdecore/k4aboutdata.cpp:317 #, kde-format msgctxt "@item license (short name)" msgid "GPL v3" msgstr "GPL v3" #: kdecore/k4aboutdata.cpp:318 #, kde-format msgctxt "@item license" msgid "GNU General Public License Version 3" msgstr "GNU General Public License, версия 3" #: kdecore/k4aboutdata.cpp:321 #, kde-format msgctxt "@item license (short name)" msgid "LGPL v3" msgstr "LGPL v3" #: kdecore/k4aboutdata.cpp:322 #, kde-format msgctxt "@item license" msgid "GNU Lesser General Public License Version 3" msgstr "GNU Lesser General Public License, версия 3" #: kdecore/k4aboutdata.cpp:326 #, kde-format msgctxt "@item license" msgid "Custom" msgstr "Другая лицензия" #: kdecore/k4aboutdata.cpp:329 #, kde-format msgctxt "@item license" msgid "Not specified" msgstr "Лицензия не указана" #: kdecore/k4aboutdata.cpp:891 #, kde-format msgctxt "replace this with information about your translation team" msgid "" "

    KDE is translated into many languages thanks to the work of the " "translation teams all over the world.

    For more information on KDE " "internationalization visit http://l10n.kde." "org

    " msgstr "" "

    Графическая среда KDE переведена на многие языки благодаря работе команд " "переводчиков в разных странах.

    Для дополнительной информации о " -"переводе KDE зайдите на l10n.kde.org, а " -"также на www.kde.ru. Там вы сможете узнать " -"о работе команды, переводившей KDE на русский язык, и, возможно, сами " -"захотите участвовать в этой работе.

    " +"переводе KDE зайдите на l10n.kde.org, а " +"также на kde.ru/translation. Там " +"вы сможете узнать о работе команды, переводившей KDE на русский язык, и, " +"возможно, сами захотите участвовать в этой работе.

    " #: kdecore/kcalendarsystem.cpp:108 #, kde-format msgctxt "@item Calendar system" msgid "Gregorian" msgstr "Григорианский" #: kdecore/kcalendarsystem.cpp:110 #, kde-format msgctxt "@item Calendar system" msgid "Coptic" msgstr "Коптский" #: kdecore/kcalendarsystem.cpp:112 #, kde-format msgctxt "@item Calendar system" msgid "Ethiopian" msgstr "Эфиопский" #: kdecore/kcalendarsystem.cpp:114 #, kde-format msgctxt "@item Calendar system" msgid "Hebrew" msgstr "Еврейский" #: kdecore/kcalendarsystem.cpp:116 #, kde-format msgctxt "@item Calendar system" msgid "Islamic / Hijri (Civil)" msgstr "Исламский" #: kdecore/kcalendarsystem.cpp:118 #, kde-format msgctxt "@item Calendar system" msgid "Indian National" msgstr "Индийский национальный" #: kdecore/kcalendarsystem.cpp:120 #, kde-format msgctxt "@item Calendar system" msgid "Jalali" msgstr "Джалали" #: kdecore/kcalendarsystem.cpp:122 #, kde-format msgctxt "@item Calendar system" msgid "Japanese" msgstr "Японский" #: kdecore/kcalendarsystem.cpp:124 #, kde-format msgctxt "@item Calendar system" msgid "Julian" msgstr "Юлианский" #: kdecore/kcalendarsystem.cpp:126 #, kde-format msgctxt "@item Calendar system" msgid "Taiwanese" msgstr "Тайваньский" #: kdecore/kcalendarsystem.cpp:128 #, kde-format msgctxt "@item Calendar system" msgid "Thai" msgstr "Тайский" #: kdecore/kcalendarsystem.cpp:131 #, kde-format msgctxt "@item Calendar system" msgid "Invalid Calendar Type" msgstr "Неверный тип календаря" #: kdecore/kcalendarsystem.cpp:1495 #, kde-format msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" msgid "-" msgstr "-" #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 #: kio/kfilemetadataprovider.cpp:199 #, kde-format msgid "Today" msgstr "Сегодня" #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 #: kio/kfilemetadataprovider.cpp:202 #, kde-format msgid "Yesterday" msgstr "Вчера" #: kdecore/kcalendarsystemcoptic.cpp:45 #, kde-format msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" msgid "Anno Martyrum" msgstr "эры Диоклетиана" #: kdecore/kcalendarsystemcoptic.cpp:46 #, kde-format msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" msgid "AM" msgstr "э. Д." #: kdecore/kcalendarsystemcoptic.cpp:47 #, kde-format msgctxt "" "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemcoptic.cpp:153 #, kde-format msgctxt "Coptic month 1 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemcoptic.cpp:155 #, kde-format msgctxt "Coptic month 2 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:157 #, kde-format msgctxt "Coptic month 3 - KLocale::NarrowName" msgid "H" msgstr "а" #: kdecore/kcalendarsystemcoptic.cpp:159 #, kde-format msgctxt "Coptic month 4 - KLocale::NarrowName" msgid "K" msgstr "х" #: kdecore/kcalendarsystemcoptic.cpp:161 #, kde-format msgctxt "Coptic month 5 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemcoptic.cpp:163 #, kde-format msgctxt "Coptic month 6 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemcoptic.cpp:165 #, kde-format msgctxt "Coptic month 7 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:167 #, kde-format msgctxt "Coptic month 8 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:169 #, kde-format msgctxt "Coptic month 9 - KLocale::NarrowName" msgid "P" msgstr "п" #: kdecore/kcalendarsystemcoptic.cpp:171 #, kde-format msgctxt "Coptic month 10 - KLocale::NarrowName" msgid "P" msgstr "п" #: kdecore/kcalendarsystemcoptic.cpp:173 #, kde-format msgctxt "Coptic month 11 - KLocale::NarrowName" msgid "E" msgstr "э" #: kdecore/kcalendarsystemcoptic.cpp:175 #, kde-format msgctxt "Coptic month 12 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemcoptic.cpp:177 #, kde-format msgctxt "Coptic month 13 - KLocale::NarrowName" msgid "K" msgstr "к" #: kdecore/kcalendarsystemcoptic.cpp:186 #, kde-format msgctxt "Coptic month 1 - KLocale::ShortName Possessive" msgid "of Tho" msgstr "тот" #: kdecore/kcalendarsystemcoptic.cpp:188 #, kde-format msgctxt "Coptic month 2 - KLocale::ShortName Possessive" msgid "of Pao" msgstr "фао" #: kdecore/kcalendarsystemcoptic.cpp:190 #, kde-format msgctxt "Coptic month 3 - KLocale::ShortName Possessive" msgid "of Hat" msgstr "ати" #: kdecore/kcalendarsystemcoptic.cpp:192 #, kde-format msgctxt "Coptic month 4 - KLocale::ShortName Possessive" msgid "of Kia" msgstr "хоя" #: kdecore/kcalendarsystemcoptic.cpp:194 #, kde-format msgctxt "Coptic month 5 - KLocale::ShortName Possessive" msgid "of Tob" msgstr "тиб" #: kdecore/kcalendarsystemcoptic.cpp:196 #, kde-format msgctxt "Coptic month 6 - KLocale::ShortName Possessive" msgid "of Mes" msgstr "мех" #: kdecore/kcalendarsystemcoptic.cpp:198 #, kde-format msgctxt "Coptic month 7 - KLocale::ShortName Possessive" msgid "of Par" msgstr "фам" #: kdecore/kcalendarsystemcoptic.cpp:200 #, kde-format msgctxt "Coptic month 8 - KLocale::ShortName Possessive" msgid "of Pam" msgstr "фар" #: kdecore/kcalendarsystemcoptic.cpp:202 #, kde-format msgctxt "Coptic month 9 - KLocale::ShortName Possessive" msgid "of Pas" msgstr "пах" #: kdecore/kcalendarsystemcoptic.cpp:204 #, kde-format msgctxt "Coptic month 10 - KLocale::ShortName Possessive" msgid "of Pan" msgstr "пай" #: kdecore/kcalendarsystemcoptic.cpp:206 #, kde-format msgctxt "Coptic month 11 - KLocale::ShortName Possessive" msgid "of Epe" msgstr "эпи" #: kdecore/kcalendarsystemcoptic.cpp:208 #, kde-format msgctxt "Coptic month 12 - KLocale::ShortName Possessive" msgid "of Meo" msgstr "мес" #: kdecore/kcalendarsystemcoptic.cpp:210 #, kde-format msgctxt "Coptic month 13 - KLocale::ShortName Possessive" msgid "of Kou" msgstr "куд" #: kdecore/kcalendarsystemcoptic.cpp:219 #, kde-format msgctxt "Coptic month 1 - KLocale::ShortName" msgid "Tho" msgstr "Тот" #: kdecore/kcalendarsystemcoptic.cpp:221 #, kde-format msgctxt "Coptic month 2 - KLocale::ShortName" msgid "Pao" msgstr "Фао" #: kdecore/kcalendarsystemcoptic.cpp:223 #, kde-format msgctxt "Coptic month 3 - KLocale::ShortName" msgid "Hat" msgstr "Ати" #: kdecore/kcalendarsystemcoptic.cpp:225 #, kde-format msgctxt "Coptic month 4 - KLocale::ShortName" msgid "Kia" msgstr "Хоя" #: kdecore/kcalendarsystemcoptic.cpp:227 #, kde-format msgctxt "Coptic month 5 - KLocale::ShortName" msgid "Tob" msgstr "Тиб" #: kdecore/kcalendarsystemcoptic.cpp:229 #, kde-format msgctxt "Coptic month 6 - KLocale::ShortName" msgid "Mes" msgstr "Мех" #: kdecore/kcalendarsystemcoptic.cpp:231 #, kde-format msgctxt "Coptic month 7 - KLocale::ShortName" msgid "Par" msgstr "Фам" #: kdecore/kcalendarsystemcoptic.cpp:233 #, kde-format msgctxt "Coptic month 8 - KLocale::ShortName" msgid "Pam" msgstr "Фар" #: kdecore/kcalendarsystemcoptic.cpp:235 #, kde-format msgctxt "Coptic month 9 - KLocale::ShortName" msgid "Pas" msgstr "Пах" #: kdecore/kcalendarsystemcoptic.cpp:237 #, kde-format msgctxt "Coptic month 10 - KLocale::ShortName" msgid "Pan" msgstr "Пай" #: kdecore/kcalendarsystemcoptic.cpp:239 #, kde-format msgctxt "Coptic month 11 - KLocale::ShortName" msgid "Epe" msgstr "Эпи" #: kdecore/kcalendarsystemcoptic.cpp:241 #, kde-format msgctxt "Coptic month 12 - KLocale::ShortName" msgid "Meo" msgstr "Мес" #: kdecore/kcalendarsystemcoptic.cpp:243 #, kde-format msgctxt "Coptic month 12 - KLocale::ShortName" msgid "Kou" msgstr "Куд" #: kdecore/kcalendarsystemcoptic.cpp:252 #, kde-format msgctxt "Coptic month 1 - KLocale::LongName Possessive" msgid "of Thoout" msgstr "тота" #: kdecore/kcalendarsystemcoptic.cpp:254 #, kde-format msgctxt "Coptic month 2 - KLocale::LongName Possessive" msgid "of Paope" msgstr "фаофи" #: kdecore/kcalendarsystemcoptic.cpp:256 #, kde-format msgctxt "Coptic month 3 - KLocale::LongName Possessive" msgid "of Hathor" msgstr "атира" #: kdecore/kcalendarsystemcoptic.cpp:258 #, kde-format msgctxt "Coptic month 4 - KLocale::LongName Possessive" msgid "of Kiahk" msgstr "хойяка" #: kdecore/kcalendarsystemcoptic.cpp:260 #, kde-format msgctxt "Coptic month 5 - KLocale::LongName Possessive" msgid "of Tobe" msgstr "тиби" #: kdecore/kcalendarsystemcoptic.cpp:262 #, kde-format msgctxt "Coptic month 6 - KLocale::LongName Possessive" msgid "of Meshir" msgstr "мехира" #: kdecore/kcalendarsystemcoptic.cpp:264 #, kde-format msgctxt "Coptic month 7 - KLocale::LongName Possessive" msgid "of Paremhotep" msgstr "фаменота" #: kdecore/kcalendarsystemcoptic.cpp:266 #, kde-format msgctxt "Coptic month 8 - KLocale::LongName Possessive" msgid "of Parmoute" msgstr "фармути" #: kdecore/kcalendarsystemcoptic.cpp:268 #, kde-format msgctxt "Coptic month 9 - KLocale::LongName Possessive" msgid "of Pashons" msgstr "пахона" #: kdecore/kcalendarsystemcoptic.cpp:270 #, kde-format msgctxt "Coptic month 10 - KLocale::LongName Possessive" msgid "of Paone" msgstr "пайни" #: kdecore/kcalendarsystemcoptic.cpp:272 #, kde-format msgctxt "Coptic month 11 - KLocale::LongName Possessive" msgid "of Epep" msgstr "эпифи" #: kdecore/kcalendarsystemcoptic.cpp:274 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName Possessive" msgid "of Mesore" msgstr "месори" #: kdecore/kcalendarsystemcoptic.cpp:276 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName Possessive" msgid "of Kouji nabot" msgstr "куджи-набота" #: kdecore/kcalendarsystemcoptic.cpp:285 #, kde-format msgctxt "Coptic month 1 - KLocale::LongName" msgid "Thoout" msgstr "Тот" #: kdecore/kcalendarsystemcoptic.cpp:287 #, kde-format msgctxt "Coptic month 2 - KLocale::LongName" msgid "Paope" msgstr "Фаофи" #: kdecore/kcalendarsystemcoptic.cpp:289 #, kde-format msgctxt "Coptic month 3 - KLocale::LongName" msgid "Hathor" msgstr "Атир" #: kdecore/kcalendarsystemcoptic.cpp:291 #, kde-format msgctxt "Coptic month 4 - KLocale::LongName" msgid "Kiahk" msgstr "Хойяк" #: kdecore/kcalendarsystemcoptic.cpp:293 #, kde-format msgctxt "Coptic month 5 - KLocale::LongName" msgid "Tobe" msgstr "Тиби" #: kdecore/kcalendarsystemcoptic.cpp:295 #, kde-format msgctxt "Coptic month 6 - KLocale::LongName" msgid "Meshir" msgstr "Мехир" #: kdecore/kcalendarsystemcoptic.cpp:297 #, kde-format msgctxt "Coptic month 7 - KLocale::LongName" msgid "Paremhotep" msgstr "Фаменот" #: kdecore/kcalendarsystemcoptic.cpp:299 #, kde-format msgctxt "Coptic month 8 - KLocale::LongName" msgid "Parmoute" msgstr "Фармути" #: kdecore/kcalendarsystemcoptic.cpp:301 #, kde-format msgctxt "Coptic month 9 - KLocale::LongName" msgid "Pashons" msgstr "Пахон" #: kdecore/kcalendarsystemcoptic.cpp:303 #, kde-format msgctxt "Coptic month 10 - KLocale::LongName" msgid "Paone" msgstr "Пайни" #: kdecore/kcalendarsystemcoptic.cpp:305 #, kde-format msgctxt "Coptic month 11 - KLocale::LongName" msgid "Epep" msgstr "Эпифи" #: kdecore/kcalendarsystemcoptic.cpp:307 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName" msgid "Mesore" msgstr "Месори" #: kdecore/kcalendarsystemcoptic.cpp:309 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName" msgid "Kouji nabot" msgstr "Куджи-набот" #: kdecore/kcalendarsystemcoptic.cpp:324 #, kde-format msgctxt "Coptic weekday 1 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:326 #, kde-format msgctxt "Coptic weekday 2 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:328 #, kde-format msgctxt "Coptic weekday 3 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:330 #, kde-format msgctxt "Coptic weekday 4 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:332 #, kde-format msgctxt "Coptic weekday 5 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:334 #, kde-format msgctxt "Coptic weekday 6 - KLocale::NarrowName" msgid "P" msgstr "ф" #: kdecore/kcalendarsystemcoptic.cpp:336 #, kde-format msgctxt "Coptic weekday 7 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemcoptic.cpp:345 #, kde-format msgctxt "Coptic weekday 1 - KLocale::ShortName" msgid "Pes" msgstr "Фес" #: kdecore/kcalendarsystemcoptic.cpp:347 #, kde-format msgctxt "Coptic weekday 2 - KLocale::ShortName" msgid "Psh" msgstr "Фсх" #: kdecore/kcalendarsystemcoptic.cpp:349 #, kde-format msgctxt "Coptic weekday 3 - KLocale::ShortName" msgid "Pef" msgstr "Феф" #: kdecore/kcalendarsystemcoptic.cpp:351 #, kde-format msgctxt "Coptic weekday 4 - KLocale::ShortName" msgid "Pti" msgstr "Фти" #: kdecore/kcalendarsystemcoptic.cpp:353 #, kde-format msgctxt "Coptic weekday 5 - KLocale::ShortName" msgid "Pso" msgstr "Фсу" #: kdecore/kcalendarsystemcoptic.cpp:355 #, kde-format msgctxt "Coptic weekday 6 - KLocale::ShortName" msgid "Psa" msgstr "Фса" #: kdecore/kcalendarsystemcoptic.cpp:357 #, kde-format msgctxt "Coptic weekday 7 - KLocale::ShortName" msgid "Tky" msgstr "Тки" #: kdecore/kcalendarsystemcoptic.cpp:365 #, kde-format msgctxt "Coptic weekday 1 - KLocale::LongName" msgid "Pesnau" msgstr "Фесно" #: kdecore/kcalendarsystemcoptic.cpp:367 #, kde-format msgctxt "Coptic weekday 2 - KLocale::LongName" msgid "Pshoment" msgstr "Фсхомент" #: kdecore/kcalendarsystemcoptic.cpp:369 #, kde-format msgctxt "Coptic weekday 3 - KLocale::LongName" msgid "Peftoou" msgstr "Фефту" #: kdecore/kcalendarsystemcoptic.cpp:371 #, kde-format msgctxt "Coptic weekday 4 - KLocale::LongName" msgid "Ptiou" msgstr "Фтиу" #: kdecore/kcalendarsystemcoptic.cpp:373 #, kde-format msgctxt "Coptic weekday 5 - KLocale::LongName" msgid "Psoou" msgstr "Фсуу" #: kdecore/kcalendarsystemcoptic.cpp:375 #, kde-format msgctxt "Coptic weekday 6 - KLocale::LongName" msgid "Psabbaton" msgstr "Фсабатон" #: kdecore/kcalendarsystemcoptic.cpp:377 #, kde-format msgctxt "Coptic weekday 7 - KLocale::LongName" msgid "Tkyriakē" msgstr "Ткириаке" #: kdecore/kcalendarsystemethiopian.cpp:50 #, kde-format msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" msgid "Amata Mehrat" msgstr "эры милосердия" #: kdecore/kcalendarsystemethiopian.cpp:51 #, kde-format msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" msgid "AM" msgstr "э. м." #: kdecore/kcalendarsystemethiopian.cpp:52 #, kde-format msgctxt "" "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemethiopian.cpp:66 #, kde-format msgctxt "Ethiopian month 1 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemethiopian.cpp:68 #, kde-format msgctxt "Ethiopian month 2 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemethiopian.cpp:70 #, kde-format msgctxt "Ethiopian month 3 - KLocale::NarrowName" msgid "H" msgstr "х" #: kdecore/kcalendarsystemethiopian.cpp:72 #, kde-format msgctxt "Ethiopian month 4 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemethiopian.cpp:74 #, kde-format msgctxt "Ethiopian month 5 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemethiopian.cpp:76 #, kde-format msgctxt "Ethiopian month 6 - KLocale::NarrowName" msgid "Y" msgstr "я" #: kdecore/kcalendarsystemethiopian.cpp:78 #, kde-format msgctxt "Ethiopian month 7 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemethiopian.cpp:80 #, kde-format msgctxt "Ethiopian month 8 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemethiopian.cpp:82 #, kde-format msgctxt "Ethiopian month 9 - KLocale::NarrowName" msgid "G" msgstr "г" #: kdecore/kcalendarsystemethiopian.cpp:84 #, kde-format msgctxt "Ethiopian month 10 - KLocale::NarrowName" msgid "S" msgstr "с" #: kdecore/kcalendarsystemethiopian.cpp:86 #, kde-format msgctxt "Ethiopian month 11 - KLocale::NarrowName" msgid "H" msgstr "х" #: kdecore/kcalendarsystemethiopian.cpp:88 #, kde-format msgctxt "Ethiopian month 12 - KLocale::NarrowName" msgid "N" msgstr "н" #: kdecore/kcalendarsystemethiopian.cpp:90 #, kde-format msgctxt "Ethiopian month 13 - KLocale::NarrowName" msgid "P" msgstr "э" #: kdecore/kcalendarsystemethiopian.cpp:99 #, kde-format msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" msgid "of Mes" msgstr "мех" #: kdecore/kcalendarsystemethiopian.cpp:101 #, kde-format msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" msgid "of Teq" msgstr "тек" #: kdecore/kcalendarsystemethiopian.cpp:103 #, kde-format msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" msgid "of Hed" msgstr "хед" #: kdecore/kcalendarsystemethiopian.cpp:105 #, kde-format msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" msgid "of Tah" msgstr "тах" #: kdecore/kcalendarsystemethiopian.cpp:107 #, kde-format msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" msgid "of Ter" msgstr "тер" #: kdecore/kcalendarsystemethiopian.cpp:109 #, kde-format msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" msgid "of Yak" msgstr "яка" #: kdecore/kcalendarsystemethiopian.cpp:111 #, kde-format msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" msgid "of Mag" msgstr "маг" #: kdecore/kcalendarsystemethiopian.cpp:113 #, kde-format msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" msgid "of Miy" msgstr "мия" #: kdecore/kcalendarsystemethiopian.cpp:115 #, kde-format msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" msgid "of Gen" msgstr "ген" #: kdecore/kcalendarsystemethiopian.cpp:117 #, kde-format msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" msgid "of Sen" msgstr "сэн" #: kdecore/kcalendarsystemethiopian.cpp:119 #, kde-format msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" msgid "of Ham" msgstr "хам" #: kdecore/kcalendarsystemethiopian.cpp:121 #, kde-format msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" msgid "of Neh" msgstr "нах" #: kdecore/kcalendarsystemethiopian.cpp:123 #, kde-format msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" msgid "of Pag" msgstr "эпа" #: kdecore/kcalendarsystemethiopian.cpp:132 #, kde-format msgctxt "Ethiopian month 1 - KLocale::ShortName" msgid "Mes" msgstr "Мех" #: kdecore/kcalendarsystemethiopian.cpp:134 #, kde-format msgctxt "Ethiopian month 2 - KLocale::ShortName" msgid "Teq" msgstr "Тек" #: kdecore/kcalendarsystemethiopian.cpp:136 #, kde-format msgctxt "Ethiopian month 3 - KLocale::ShortName" msgid "Hed" msgstr "Хед" #: kdecore/kcalendarsystemethiopian.cpp:138 #, kde-format msgctxt "Ethiopian month 4 - KLocale::ShortName" msgid "Tah" msgstr "Тах" #: kdecore/kcalendarsystemethiopian.cpp:140 #, kde-format msgctxt "Ethiopian month 5 - KLocale::ShortName" msgid "Ter" msgstr "Тер" #: kdecore/kcalendarsystemethiopian.cpp:142 #, kde-format msgctxt "Ethiopian month 6 - KLocale::ShortName" msgid "Yak" msgstr "Яка" #: kdecore/kcalendarsystemethiopian.cpp:144 #, kde-format msgctxt "Ethiopian month 7 - KLocale::ShortName" msgid "Mag" msgstr "Маг" #: kdecore/kcalendarsystemethiopian.cpp:146 #, kde-format msgctxt "Ethiopian month 8 - KLocale::ShortName" msgid "Miy" msgstr "Мия" #: kdecore/kcalendarsystemethiopian.cpp:148 #, kde-format msgctxt "Ethiopian month 9 - KLocale::ShortName" msgid "Gen" msgstr "Ген" #: kdecore/kcalendarsystemethiopian.cpp:150 #, kde-format msgctxt "Ethiopian month 10 - KLocale::ShortName" msgid "Sen" msgstr "Сэн" #: kdecore/kcalendarsystemethiopian.cpp:152 #, kde-format msgctxt "Ethiopian month 11 - KLocale::ShortName" msgid "Ham" msgstr "Хам" #: kdecore/kcalendarsystemethiopian.cpp:154 #, kde-format msgctxt "Ethiopian month 12 - KLocale::ShortName" msgid "Neh" msgstr "Нах" #: kdecore/kcalendarsystemethiopian.cpp:156 #, kde-format msgctxt "Ethiopian month 13 - KLocale::ShortName" msgid "Pag" msgstr "Эпа" #: kdecore/kcalendarsystemethiopian.cpp:165 #, kde-format msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" msgid "of Meskerem" msgstr "мескерема" #: kdecore/kcalendarsystemethiopian.cpp:167 #, kde-format msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" msgid "of Tequemt" msgstr "текемта" #: kdecore/kcalendarsystemethiopian.cpp:169 #, kde-format msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" msgid "of Hedar" msgstr "хедара" #: kdecore/kcalendarsystemethiopian.cpp:171 #, kde-format msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" msgid "of Tahsas" msgstr "тахсаса" #: kdecore/kcalendarsystemethiopian.cpp:173 #, kde-format msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" msgid "of Ter" msgstr "тер" #: kdecore/kcalendarsystemethiopian.cpp:175 #, kde-format msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" msgid "of Yakatit" msgstr "якатита" #: kdecore/kcalendarsystemethiopian.cpp:177 #, kde-format msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" msgid "of Magabit" msgstr "магабита" #: kdecore/kcalendarsystemethiopian.cpp:179 #, kde-format msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" msgid "of Miyazya" msgstr "миязии" #: kdecore/kcalendarsystemethiopian.cpp:181 #, kde-format msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" msgid "of Genbot" msgstr "генбота" #: kdecore/kcalendarsystemethiopian.cpp:183 #, kde-format msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" msgid "of Sene" msgstr "сэнэ" #: kdecore/kcalendarsystemethiopian.cpp:185 #, kde-format msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" msgid "of Hamle" msgstr "хамлэ" #: kdecore/kcalendarsystemethiopian.cpp:187 #, kde-format msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" msgid "of Nehase" msgstr "нахасэ" #: kdecore/kcalendarsystemethiopian.cpp:189 #, kde-format msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" msgid "of Pagumen" msgstr "эпагомена" # http://www.penta-arzneimittel.de/TYPO3v5/Packages/Framework/FLOW3/Resources/Private/Locale/CLDR/Sources/main/ru.xml --aspotashev #: kdecore/kcalendarsystemethiopian.cpp:198 #, kde-format msgctxt "Ethiopian month 1 - KLocale::LongName" msgid "Meskerem" msgstr "Мескерем" #: kdecore/kcalendarsystemethiopian.cpp:200 #, kde-format msgctxt "Ethiopian month 2 - KLocale::LongName" msgid "Tequemt" msgstr "Текемт" #: kdecore/kcalendarsystemethiopian.cpp:202 #, kde-format msgctxt "Ethiopian month 3 - KLocale::LongName" msgid "Hedar" msgstr "Хедар" #: kdecore/kcalendarsystemethiopian.cpp:204 #, kde-format msgctxt "Ethiopian month 4 - KLocale::LongName" msgid "Tahsas" msgstr "Тахсас" #: kdecore/kcalendarsystemethiopian.cpp:206 #, kde-format msgctxt "Ethiopian month 5 - KLocale::LongName" msgid "Ter" msgstr "Тер" #: kdecore/kcalendarsystemethiopian.cpp:208 #, kde-format msgctxt "Ethiopian month 6 - KLocale::LongName" msgid "Yakatit" msgstr "Якатит" #: kdecore/kcalendarsystemethiopian.cpp:210 #, kde-format msgctxt "Ethiopian month 7 - KLocale::LongName" msgid "Magabit" msgstr "Магабит" #: kdecore/kcalendarsystemethiopian.cpp:212 #, kde-format msgctxt "Ethiopian month 8 - KLocale::LongName" msgid "Miyazya" msgstr "Миязия" #: kdecore/kcalendarsystemethiopian.cpp:214 #, kde-format msgctxt "Ethiopian month 9 - KLocale::LongName" msgid "Genbot" msgstr "Генбот" #: kdecore/kcalendarsystemethiopian.cpp:216 #, kde-format msgctxt "Ethiopian month 10 - KLocale::LongName" msgid "Sene" msgstr "Сэнэ" #: kdecore/kcalendarsystemethiopian.cpp:218 #, kde-format msgctxt "Ethiopian month 11 - KLocale::LongName" msgid "Hamle" msgstr "Хамлэ" #: kdecore/kcalendarsystemethiopian.cpp:220 #, kde-format msgctxt "Ethiopian month 12 - KLocale::LongName" msgid "Nehase" msgstr "Нахасэ" #: kdecore/kcalendarsystemethiopian.cpp:222 #, kde-format msgctxt "Ethiopian month 13 - KLocale::LongName" msgid "Pagumen" msgstr "Эпагомен" #: kdecore/kcalendarsystemethiopian.cpp:236 #, kde-format msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " msgid "S" msgstr "с" #: kdecore/kcalendarsystemethiopian.cpp:238 #, kde-format msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " msgid "M" msgstr "м" #: kdecore/kcalendarsystemethiopian.cpp:240 #, kde-format msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " msgid "R" msgstr "р" #: kdecore/kcalendarsystemethiopian.cpp:242 #, kde-format msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " msgid "H" msgstr "х" #: kdecore/kcalendarsystemethiopian.cpp:244 #, kde-format msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " msgid "A" msgstr "а" #: kdecore/kcalendarsystemethiopian.cpp:246 #, kde-format msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " msgid "Q" msgstr "к" #: kdecore/kcalendarsystemethiopian.cpp:248 #, kde-format msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " msgid "E" msgstr "э" #: kdecore/kcalendarsystemethiopian.cpp:257 #, kde-format msgctxt "Ethiopian weekday 1 - KLocale::ShortName" msgid "Seg" msgstr "Сег" #: kdecore/kcalendarsystemethiopian.cpp:259 #, kde-format msgctxt "Ethiopian weekday 2 - KLocale::ShortName" msgid "Mak" msgstr "Мак" #: kdecore/kcalendarsystemethiopian.cpp:261 #, kde-format msgctxt "Ethiopian weekday 3 - KLocale::ShortName" msgid "Rob" msgstr "Роб" #: kdecore/kcalendarsystemethiopian.cpp:263 #, kde-format msgctxt "Ethiopian weekday 4 - KLocale::ShortName" msgid "Ham" msgstr "Хам" #: kdecore/kcalendarsystemethiopian.cpp:265 #, kde-format msgctxt "Ethiopian weekday 5 - KLocale::ShortName" msgid "Arb" msgstr "Арб" #: kdecore/kcalendarsystemethiopian.cpp:267 #, kde-format msgctxt "Ethiopian weekday 6 - KLocale::ShortName" msgid "Qed" msgstr "Кед" #: kdecore/kcalendarsystemethiopian.cpp:269 #, kde-format msgctxt "Ethiopian weekday 7 - KLocale::ShortName" msgid "Ehu" msgstr "Эху" #: kdecore/kcalendarsystemethiopian.cpp:276 #, kde-format msgctxt "Ethiopian weekday 1 - KLocale::LongName" msgid "Segno" msgstr "Сегно" #: kdecore/kcalendarsystemethiopian.cpp:278 #, kde-format msgctxt "Ethiopian weekday 2 - KLocale::LongName" msgid "Maksegno" msgstr "Максегно" #: kdecore/kcalendarsystemethiopian.cpp:280 #, kde-format msgctxt "Ethiopian weekday 3 - KLocale::LongName" msgid "Rob" msgstr "Роб" #: kdecore/kcalendarsystemethiopian.cpp:282 #, kde-format msgctxt "Ethiopian weekday 4 - KLocale::LongName" msgid "Hamus" msgstr "Хамус" #: kdecore/kcalendarsystemethiopian.cpp:284 #, kde-format msgctxt "Ethiopian weekday 5 - KLocale::LongName" msgid "Arb" msgstr "арб" #: kdecore/kcalendarsystemethiopian.cpp:286 #, kde-format msgctxt "Ethiopian weekday 6 - KLocale::LongName" msgid "Qedame" msgstr "Кедам" #: kdecore/kcalendarsystemethiopian.cpp:288 #, kde-format msgctxt "Ethiopian weekday 7 - KLocale::LongName" msgid "Ehud" msgstr "Эхуд" #: kdecore/kcalendarsystemgregorian.cpp:53 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" msgid "Before Common Era" msgstr "до нашей эры" #: kdecore/kcalendarsystemgregorian.cpp:54 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" msgid "BCE" msgstr "до н. э." #: kdecore/kcalendarsystemgregorian.cpp:56 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" msgid "Before Christ" msgstr "до Рождества Христова" #: kdecore/kcalendarsystemgregorian.cpp:57 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" msgid "BC" msgstr "до Р. Х." #: kdecore/kcalendarsystemgregorian.cpp:59 #, kde-format msgctxt "" "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemgregorian.cpp:63 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" msgid "Common Era" msgstr "нашей эры" #: kdecore/kcalendarsystemgregorian.cpp:64 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" msgid "CE" msgstr "н. э." #: kdecore/kcalendarsystemgregorian.cpp:66 #: kdecore/kcalendarsystemjapanese.cpp:57 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" msgid "Anno Domini" msgstr "от Рождества Христова" #: kdecore/kcalendarsystemgregorian.cpp:67 #: kdecore/kcalendarsystemjapanese.cpp:58 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" msgid "AD" msgstr "Р. Х." #: kdecore/kcalendarsystemgregorian.cpp:69 #: kdecore/kcalendarsystemjapanese.cpp:59 #, kde-format msgctxt "" "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemgregorian.cpp:138 #, kde-format msgctxt "Gregorian month 1 - KLocale::NarrowName" msgid "J" msgstr "я" #: kdecore/kcalendarsystemgregorian.cpp:140 #, kde-format msgctxt "Gregorian month 2 - KLocale::NarrowName" msgid "F" msgstr "ф" #: kdecore/kcalendarsystemgregorian.cpp:142 #, kde-format msgctxt "Gregorian month 3 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemgregorian.cpp:144 #, kde-format msgctxt "Gregorian month 4 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemgregorian.cpp:146 #, kde-format msgctxt "Gregorian month 5 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemgregorian.cpp:148 #, kde-format msgctxt "Gregorian month 6 - KLocale::NarrowName" msgid "J" msgstr "и" #: kdecore/kcalendarsystemgregorian.cpp:150 #, kde-format msgctxt "Gregorian month 7 - KLocale::NarrowName" msgid "J" msgstr "и" #: kdecore/kcalendarsystemgregorian.cpp:152 #, kde-format msgctxt "Gregorian month 8 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemgregorian.cpp:154 #, kde-format msgctxt "Gregorian month 9 - KLocale::NarrowName" msgid "S" msgstr "с" #: kdecore/kcalendarsystemgregorian.cpp:156 #, kde-format msgctxt "Gregorian month 10 - KLocale::NarrowName" msgid "O" msgstr "о" #: kdecore/kcalendarsystemgregorian.cpp:158 #, kde-format msgctxt "Gregorian month 11 - KLocale::NarrowName" msgid "N" msgstr "н" #: kdecore/kcalendarsystemgregorian.cpp:160 #, kde-format msgctxt "Gregorian month 12 - KLocale::NarrowName" msgid "D" msgstr "д" #: kdecore/kcalendarsystemgregorian.cpp:169 #, kde-format msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" msgid "of Jan" msgstr "янв" #: kdecore/kcalendarsystemgregorian.cpp:171 #, kde-format msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" msgid "of Feb" msgstr "фев" #: kdecore/kcalendarsystemgregorian.cpp:173 #, kde-format msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" msgid "of Mar" msgstr "мар" #: kdecore/kcalendarsystemgregorian.cpp:175 #, kde-format msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" msgid "of Apr" msgstr "апр" #: kdecore/kcalendarsystemgregorian.cpp:177 #, kde-format msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" msgid "of May" msgstr "мая" #: kdecore/kcalendarsystemgregorian.cpp:179 #, kde-format msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" msgid "of Jun" msgstr "июн" #: kdecore/kcalendarsystemgregorian.cpp:181 #, kde-format msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" msgid "of Jul" msgstr "июл" #: kdecore/kcalendarsystemgregorian.cpp:183 #, kde-format msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" msgid "of Aug" msgstr "авг" #: kdecore/kcalendarsystemgregorian.cpp:185 #, kde-format msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" msgid "of Sep" msgstr "сен" #: kdecore/kcalendarsystemgregorian.cpp:187 #, kde-format msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" msgid "of Oct" msgstr "окт" #: kdecore/kcalendarsystemgregorian.cpp:189 #, kde-format msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" msgid "of Nov" msgstr "ноя" #: kdecore/kcalendarsystemgregorian.cpp:191 #, kde-format msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" msgid "of Dec" msgstr "дек" #: kdecore/kcalendarsystemgregorian.cpp:200 #, kde-format msgctxt "Gregorian month 1 - KLocale::ShortName" msgid "Jan" msgstr "Янв" #: kdecore/kcalendarsystemgregorian.cpp:202 #, kde-format msgctxt "Gregorian month 2 - KLocale::ShortName" msgid "Feb" msgstr "Фев" #: kdecore/kcalendarsystemgregorian.cpp:204 #, kde-format msgctxt "Gregorian month 3 - KLocale::ShortName" msgid "Mar" msgstr "Мар" #: kdecore/kcalendarsystemgregorian.cpp:206 #, kde-format msgctxt "Gregorian month 4 - KLocale::ShortName" msgid "Apr" msgstr "Апр" #: kdecore/kcalendarsystemgregorian.cpp:208 #, kde-format msgctxt "Gregorian month 5 - KLocale::ShortName" msgid "May" msgstr "Май" #: kdecore/kcalendarsystemgregorian.cpp:210 #, kde-format msgctxt "Gregorian month 6 - KLocale::ShortName" msgid "Jun" msgstr "Июн" #: kdecore/kcalendarsystemgregorian.cpp:212 #, kde-format msgctxt "Gregorian month 7 - KLocale::ShortName" msgid "Jul" msgstr "Июл" #: kdecore/kcalendarsystemgregorian.cpp:214 #, kde-format msgctxt "Gregorian month 8 - KLocale::ShortName" msgid "Aug" msgstr "Авг" #: kdecore/kcalendarsystemgregorian.cpp:216 #, kde-format msgctxt "Gregorian month 9 - KLocale::ShortName" msgid "Sep" msgstr "Сен" #: kdecore/kcalendarsystemgregorian.cpp:218 #, kde-format msgctxt "Gregorian month 10 - KLocale::ShortName" msgid "Oct" msgstr "Окт" #: kdecore/kcalendarsystemgregorian.cpp:220 #, kde-format msgctxt "Gregorian month 11 - KLocale::ShortName" msgid "Nov" msgstr "Ноя" #: kdecore/kcalendarsystemgregorian.cpp:222 #, kde-format msgctxt "Gregorian month 12 - KLocale::ShortName" msgid "Dec" msgstr "Дек" #: kdecore/kcalendarsystemgregorian.cpp:231 #, kde-format msgctxt "Gregorian month 1 - KLocale::LongName Possessive" msgid "of January" msgstr "января" #: kdecore/kcalendarsystemgregorian.cpp:233 #, kde-format msgctxt "Gregorian month 2 - KLocale::LongName Possessive" msgid "of February" msgstr "февраля" #: kdecore/kcalendarsystemgregorian.cpp:235 #, kde-format msgctxt "Gregorian month 3 - KLocale::LongName Possessive" msgid "of March" msgstr "марта" #: kdecore/kcalendarsystemgregorian.cpp:237 #, kde-format msgctxt "Gregorian month 4 - KLocale::LongName Possessive" msgid "of April" msgstr "апреля" #: kdecore/kcalendarsystemgregorian.cpp:239 #, kde-format msgctxt "Gregorian month 5 - KLocale::LongName Possessive" msgid "of May" msgstr "мая" #: kdecore/kcalendarsystemgregorian.cpp:241 #, kde-format msgctxt "Gregorian month 6 - KLocale::LongName Possessive" msgid "of June" msgstr "июня" #: kdecore/kcalendarsystemgregorian.cpp:243 #, kde-format msgctxt "Gregorian month 7 - KLocale::LongName Possessive" msgid "of July" msgstr "июля" #: kdecore/kcalendarsystemgregorian.cpp:245 #, kde-format msgctxt "Gregorian month 8 - KLocale::LongName Possessive" msgid "of August" msgstr "августа" #: kdecore/kcalendarsystemgregorian.cpp:247 #, kde-format msgctxt "Gregorian month 9 - KLocale::LongName Possessive" msgid "of September" msgstr "сентября" #: kdecore/kcalendarsystemgregorian.cpp:249 #, kde-format msgctxt "Gregorian month 10 - KLocale::LongName Possessive" msgid "of October" msgstr "октября" #: kdecore/kcalendarsystemgregorian.cpp:251 #, kde-format msgctxt "Gregorian month 11 - KLocale::LongName Possessive" msgid "of November" msgstr "ноября" #: kdecore/kcalendarsystemgregorian.cpp:253 #, kde-format msgctxt "Gregorian month 12 - KLocale::LongName Possessive" msgid "of December" msgstr "декабря" #: kdecore/kcalendarsystemgregorian.cpp:262 #, kde-format msgctxt "Gregorian month 1 - KLocale::LongName" msgid "January" msgstr "Январь" #: kdecore/kcalendarsystemgregorian.cpp:264 #, kde-format msgctxt "Gregorian month 2 - KLocale::LongName" msgid "February" msgstr "Февраль" #: kdecore/kcalendarsystemgregorian.cpp:266 #, kde-format msgctxt "Gregorian month 3 - KLocale::LongName" msgid "March" msgstr "Март" #: kdecore/kcalendarsystemgregorian.cpp:268 #, kde-format msgctxt "Gregorian month 4 - KLocale::LongName" msgid "April" msgstr "Апрель" #: kdecore/kcalendarsystemgregorian.cpp:270 #, kde-format msgctxt "Gregorian month 5 - KLocale::LongName" msgid "May" msgstr "Май" #: kdecore/kcalendarsystemgregorian.cpp:272 #, kde-format msgctxt "Gregorian month 6 - KLocale::LongName" msgid "June" msgstr "Июнь" #: kdecore/kcalendarsystemgregorian.cpp:274 #, kde-format msgctxt "Gregorian month 7 - KLocale::LongName" msgid "July" msgstr "Июль" #: kdecore/kcalendarsystemgregorian.cpp:276 #, kde-format msgctxt "Gregorian month 8 - KLocale::LongName" msgid "August" msgstr "Август" #: kdecore/kcalendarsystemgregorian.cpp:278 #, kde-format msgctxt "Gregorian month 9 - KLocale::LongName" msgid "September" msgstr "Сентябрь" #: kdecore/kcalendarsystemgregorian.cpp:280 #, kde-format msgctxt "Gregorian month 10 - KLocale::LongName" msgid "October" msgstr "Октябрь" #: kdecore/kcalendarsystemgregorian.cpp:282 #, kde-format msgctxt "Gregorian month 11 - KLocale::LongName" msgid "November" msgstr "Ноябрь" #: kdecore/kcalendarsystemgregorian.cpp:284 #, kde-format msgctxt "Gregorian month 12 - KLocale::LongName" msgid "December" msgstr "Декабрь" #: kdecore/kcalendarsystemgregorian.cpp:297 #: kdecore/kcalendarsystemhebrew.cpp:807 #, kde-format msgctxt "Gregorian weekday 1 - KLocale::NarrowName " msgid "M" msgstr "п" #: kdecore/kcalendarsystemgregorian.cpp:299 #: kdecore/kcalendarsystemhebrew.cpp:809 #, kde-format msgctxt "Gregorian weekday 2 - KLocale::NarrowName " msgid "T" msgstr "в" #: kdecore/kcalendarsystemgregorian.cpp:301 #: kdecore/kcalendarsystemhebrew.cpp:811 #, kde-format msgctxt "Gregorian weekday 3 - KLocale::NarrowName " msgid "W" msgstr "с" #: kdecore/kcalendarsystemgregorian.cpp:303 #: kdecore/kcalendarsystemhebrew.cpp:813 #, kde-format msgctxt "Gregorian weekday 4 - KLocale::NarrowName " msgid "T" msgstr "ч" #: kdecore/kcalendarsystemgregorian.cpp:305 #: kdecore/kcalendarsystemhebrew.cpp:815 #, kde-format msgctxt "Gregorian weekday 5 - KLocale::NarrowName " msgid "F" msgstr "п" #: kdecore/kcalendarsystemgregorian.cpp:307 #: kdecore/kcalendarsystemhebrew.cpp:817 #, kde-format msgctxt "Gregorian weekday 6 - KLocale::NarrowName " msgid "S" msgstr "с" #: kdecore/kcalendarsystemgregorian.cpp:309 #: kdecore/kcalendarsystemhebrew.cpp:819 #, kde-format msgctxt "Gregorian weekday 7 - KLocale::NarrowName " msgid "S" msgstr "в" #: kdecore/kcalendarsystemgregorian.cpp:318 #: kdecore/kcalendarsystemhebrew.cpp:828 #, kde-format msgctxt "Gregorian weekday 1 - KLocale::ShortName" msgid "Mon" msgstr "Пн" #: kdecore/kcalendarsystemgregorian.cpp:320 #: kdecore/kcalendarsystemhebrew.cpp:830 #, kde-format msgctxt "Gregorian weekday 2 - KLocale::ShortName" msgid "Tue" msgstr "Вт" #: kdecore/kcalendarsystemgregorian.cpp:322 #: kdecore/kcalendarsystemhebrew.cpp:832 #, kde-format msgctxt "Gregorian weekday 3 - KLocale::ShortName" msgid "Wed" msgstr "Ср" #: kdecore/kcalendarsystemgregorian.cpp:324 #: kdecore/kcalendarsystemhebrew.cpp:834 #, kde-format msgctxt "Gregorian weekday 4 - KLocale::ShortName" msgid "Thu" msgstr "Чт" #: kdecore/kcalendarsystemgregorian.cpp:326 #: kdecore/kcalendarsystemhebrew.cpp:836 #, kde-format msgctxt "Gregorian weekday 5 - KLocale::ShortName" msgid "Fri" msgstr "Пт" #: kdecore/kcalendarsystemgregorian.cpp:328 #: kdecore/kcalendarsystemhebrew.cpp:838 #, kde-format msgctxt "Gregorian weekday 6 - KLocale::ShortName" msgid "Sat" msgstr "Сб" #: kdecore/kcalendarsystemgregorian.cpp:330 #: kdecore/kcalendarsystemhebrew.cpp:840 #, kde-format msgctxt "Gregorian weekday 7 - KLocale::ShortName" msgid "Sun" msgstr "Вс" #: kdecore/kcalendarsystemgregorian.cpp:337 #: kdecore/kcalendarsystemhebrew.cpp:847 #, kde-format msgctxt "Gregorian weekday 1 - KLocale::LongName" msgid "Monday" msgstr "Понедельник" #: kdecore/kcalendarsystemgregorian.cpp:339 #: kdecore/kcalendarsystemhebrew.cpp:849 #, kde-format msgctxt "Gregorian weekday 2 - KLocale::LongName" msgid "Tuesday" msgstr "Вторник" #: kdecore/kcalendarsystemgregorian.cpp:341 #: kdecore/kcalendarsystemhebrew.cpp:851 #, kde-format msgctxt "Gregorian weekday 3 - KLocale::LongName" msgid "Wednesday" msgstr "Среда" #: kdecore/kcalendarsystemgregorian.cpp:343 #: kdecore/kcalendarsystemhebrew.cpp:853 #, kde-format msgctxt "Gregorian weekday 4 - KLocale::LongName" msgid "Thursday" msgstr "Четверг" #: kdecore/kcalendarsystemgregorian.cpp:345 #: kdecore/kcalendarsystemhebrew.cpp:855 #, kde-format msgctxt "Gregorian weekday 5 - KLocale::LongName" msgid "Friday" msgstr "Пятница" #: kdecore/kcalendarsystemgregorian.cpp:347 #: kdecore/kcalendarsystemhebrew.cpp:857 #, kde-format msgctxt "Gregorian weekday 6 - KLocale::LongName" msgid "Saturday" msgstr "Суббота" #: kdecore/kcalendarsystemgregorian.cpp:349 #: kdecore/kcalendarsystemhebrew.cpp:859 #, kde-format msgctxt "Gregorian weekday 7 - KLocale::LongName" msgid "Sunday" msgstr "Воскресенье" #: kdecore/kcalendarsystemhebrew.cpp:281 #, kde-format msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" msgid "Anno Mundi" msgstr "от сотворения мира" #: kdecore/kcalendarsystemhebrew.cpp:282 #, kde-format msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" msgid "AM" msgstr "мира" #: kdecore/kcalendarsystemhebrew.cpp:283 #, kde-format msgctxt "" "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemhebrew.cpp:625 #, kde-format msgctxt "Hebrew month 1 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemhebrew.cpp:627 #, kde-format msgctxt "Hebrew month 2 - KLocale::NarrowName" msgid "H" msgstr "х" #: kdecore/kcalendarsystemhebrew.cpp:629 #, kde-format msgctxt "Hebrew month 3 - KLocale::NarrowName" msgid "K" msgstr "к" #: kdecore/kcalendarsystemhebrew.cpp:631 #, kde-format msgctxt "Hebrew month 4 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemhebrew.cpp:633 #, kde-format msgctxt "Hebrew month 5 - KLocale::NarrowName" msgid "S" msgstr "ш" #: kdecore/kcalendarsystemhebrew.cpp:635 #, kde-format msgctxt "Hebrew month 6 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemhebrew.cpp:637 #, kde-format msgctxt "Hebrew month 7 - KLocale::NarrowName" msgid "N" msgstr "н" #: kdecore/kcalendarsystemhebrew.cpp:639 #, kde-format msgctxt "Hebrew month 8 - KLocale::NarrowName" msgid "I" msgstr "и" #: kdecore/kcalendarsystemhebrew.cpp:641 #, kde-format msgctxt "Hebrew month 9 - KLocale::NarrowName" msgid "S" msgstr "с" #: kdecore/kcalendarsystemhebrew.cpp:643 #, kde-format msgctxt "Hebrew month 10 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemhebrew.cpp:645 #, kde-format msgctxt "Hebrew month 11 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemhebrew.cpp:647 #, kde-format msgctxt "Hebrew month 12 - KLocale::NarrowName" msgid "E" msgstr "э" #: kdecore/kcalendarsystemhebrew.cpp:649 #, kde-format msgctxt "Hebrew month 13 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemhebrew.cpp:651 #, kde-format msgctxt "Hebrew month 14 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemhebrew.cpp:660 #, kde-format msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" msgid "of Tis" msgstr "тиш" #: kdecore/kcalendarsystemhebrew.cpp:662 #, kde-format msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" msgid "of Hes" msgstr "хеш" #: kdecore/kcalendarsystemhebrew.cpp:664 #, kde-format msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" msgid "of Kis" msgstr "кис" #: kdecore/kcalendarsystemhebrew.cpp:666 #, kde-format msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" msgid "of Tev" msgstr "тев" #: kdecore/kcalendarsystemhebrew.cpp:668 #, kde-format msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" msgid "of Shv" msgstr "шва" #: kdecore/kcalendarsystemhebrew.cpp:670 #, kde-format msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" msgid "of Ada" msgstr "ада" #: kdecore/kcalendarsystemhebrew.cpp:672 #, kde-format msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" msgid "of Nis" msgstr "нис" #: kdecore/kcalendarsystemhebrew.cpp:674 #, kde-format msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" msgid "of Iya" msgstr "ияр" #: kdecore/kcalendarsystemhebrew.cpp:676 #, kde-format msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" msgid "of Siv" msgstr "сив" #: kdecore/kcalendarsystemhebrew.cpp:678 #, kde-format msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" msgid "of Tam" msgstr "там" #: kdecore/kcalendarsystemhebrew.cpp:680 #, kde-format msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" msgid "of Av" msgstr "ава" #: kdecore/kcalendarsystemhebrew.cpp:682 #, kde-format msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" msgid "of Elu" msgstr "элу" #: kdecore/kcalendarsystemhebrew.cpp:684 #, kde-format msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" msgid "of Ad1" msgstr "ад1" #: kdecore/kcalendarsystemhebrew.cpp:686 #, kde-format msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" msgid "of Ad2" msgstr "ад2" #: kdecore/kcalendarsystemhebrew.cpp:695 #, kde-format msgctxt "Hebrew month 1 - KLocale::ShortName" msgid "Tis" msgstr "Тиш" #: kdecore/kcalendarsystemhebrew.cpp:697 #, kde-format msgctxt "Hebrew month 2 - KLocale::ShortName" msgid "Hes" msgstr "Хеш" #: kdecore/kcalendarsystemhebrew.cpp:699 #, kde-format msgctxt "Hebrew month 3 - KLocale::ShortName" msgid "Kis" msgstr "Кис" #: kdecore/kcalendarsystemhebrew.cpp:701 #, kde-format msgctxt "Hebrew month 4 - KLocale::ShortName" msgid "Tev" msgstr "Тев" #: kdecore/kcalendarsystemhebrew.cpp:703 #, kde-format msgctxt "Hebrew month 5 - KLocale::ShortName" msgid "Shv" msgstr "Шва" #: kdecore/kcalendarsystemhebrew.cpp:705 #, kde-format msgctxt "Hebrew month 6 - KLocale::ShortName" msgid "Ada" msgstr "Ада" #: kdecore/kcalendarsystemhebrew.cpp:707 #, kde-format msgctxt "Hebrew month 7 - KLocale::ShortName" msgid "Nis" msgstr "Нис" #: kdecore/kcalendarsystemhebrew.cpp:709 #, kde-format msgctxt "Hebrew month 8 - KLocale::ShortName" msgid "Iya" msgstr "Ияр" #: kdecore/kcalendarsystemhebrew.cpp:711 #, kde-format msgctxt "Hebrew month 9 - KLocale::ShortName" msgid "Siv" msgstr "Сив" #: kdecore/kcalendarsystemhebrew.cpp:713 #, kde-format msgctxt "Hebrew month 10 - KLocale::ShortName" msgid "Tam" msgstr "Там" #: kdecore/kcalendarsystemhebrew.cpp:715 #, kde-format msgctxt "Hebrew month 11 - KLocale::ShortName" msgid "Av" msgstr "Ав" #: kdecore/kcalendarsystemhebrew.cpp:717 #, kde-format msgctxt "Hebrew month 12 - KLocale::ShortName" msgid "Elu" msgstr "Элу" #: kdecore/kcalendarsystemhebrew.cpp:719 #, kde-format msgctxt "Hebrew month 13 - KLocale::ShortName" msgid "Ad1" msgstr "Ад1" #: kdecore/kcalendarsystemhebrew.cpp:721 #, kde-format msgctxt "Hebrew month 14 - KLocale::ShortName" msgid "Ad2" msgstr "Ад2" #: kdecore/kcalendarsystemhebrew.cpp:730 #, kde-format msgctxt "Hebrew month 1 - KLocale::LongName Possessive" msgid "of Tishrey" msgstr "тишри" #: kdecore/kcalendarsystemhebrew.cpp:732 #, kde-format msgctxt "Hebrew month 2 - KLocale::LongName Possessive" msgid "of Heshvan" msgstr "хешвана" #: kdecore/kcalendarsystemhebrew.cpp:734 #, kde-format msgctxt "Hebrew month 3 - KLocale::LongName Possessive" msgid "of Kislev" msgstr "кислева" #: kdecore/kcalendarsystemhebrew.cpp:736 #, kde-format msgctxt "Hebrew month 4 - KLocale::LongName Possessive" msgid "of Tevet" msgstr "тевета" #: kdecore/kcalendarsystemhebrew.cpp:738 #, kde-format msgctxt "Hebrew month 5 - KLocale::LongName Possessive" msgid "of Shvat" msgstr "швата" #: kdecore/kcalendarsystemhebrew.cpp:740 #, kde-format msgctxt "Hebrew month 6 - KLocale::LongName Possessive" msgid "of Adar" msgstr "адара" #: kdecore/kcalendarsystemhebrew.cpp:742 #, kde-format msgctxt "Hebrew month 7 - KLocale::LongName Possessive" msgid "of Nisan" msgstr "нисана" #: kdecore/kcalendarsystemhebrew.cpp:744 #, kde-format msgctxt "Hebrew month 8 - KLocale::LongName Possessive" msgid "of Iyar" msgstr "ияра" #: kdecore/kcalendarsystemhebrew.cpp:746 #, kde-format msgctxt "Hebrew month 9 - KLocale::LongName Possessive" msgid "of Sivan" msgstr "сивана" #: kdecore/kcalendarsystemhebrew.cpp:748 #, kde-format msgctxt "Hebrew month 10 - KLocale::LongName Possessive" msgid "of Tamuz" msgstr "тамуза" #: kdecore/kcalendarsystemhebrew.cpp:750 #, kde-format msgctxt "Hebrew month 11 - KLocale::LongName Possessive" msgid "of Av" msgstr "ава" #: kdecore/kcalendarsystemhebrew.cpp:752 #, kde-format msgctxt "Hebrew month 12 - KLocale::LongName Possessive" msgid "of Elul" msgstr "элула" #: kdecore/kcalendarsystemhebrew.cpp:754 #, kde-format msgctxt "Hebrew month 13 - KLocale::LongName Possessive" msgid "of Adar I" msgstr "адара" #: kdecore/kcalendarsystemhebrew.cpp:756 #, kde-format msgctxt "Hebrew month 14 - KLocale::LongName Possessive" msgid "of Adar II" msgstr "адара бет" #: kdecore/kcalendarsystemhebrew.cpp:765 #, kde-format msgctxt "Hebrew month 1 - KLocale::LongName" msgid "Tishrey" msgstr "Тишри" #: kdecore/kcalendarsystemhebrew.cpp:767 #, kde-format msgctxt "Hebrew month 2 - KLocale::LongName" msgid "Heshvan" msgstr "Хешван" #: kdecore/kcalendarsystemhebrew.cpp:769 #, kde-format msgctxt "Hebrew month 3 - KLocale::LongName" msgid "Kislev" msgstr "Кислев" #: kdecore/kcalendarsystemhebrew.cpp:771 #, kde-format msgctxt "Hebrew month 4 - KLocale::LongName" msgid "Tevet" msgstr "Тевет" #: kdecore/kcalendarsystemhebrew.cpp:773 #, kde-format msgctxt "Hebrew month 5 - KLocale::LongName" msgid "Shvat" msgstr "Шват" #: kdecore/kcalendarsystemhebrew.cpp:775 #, kde-format msgctxt "Hebrew month 6 - KLocale::LongName" msgid "Adar" msgstr "Адар" #: kdecore/kcalendarsystemhebrew.cpp:777 #, kde-format msgctxt "Hebrew month 7 - KLocale::LongName" msgid "Nisan" msgstr "Нисан" #: kdecore/kcalendarsystemhebrew.cpp:779 #, kde-format msgctxt "Hebrew month 8 - KLocale::LongName" msgid "Iyar" msgstr "Ияр" #: kdecore/kcalendarsystemhebrew.cpp:781 #, kde-format msgctxt "Hebrew month 9 - KLocale::LongName" msgid "Sivan" msgstr "Сиван" #: kdecore/kcalendarsystemhebrew.cpp:783 #, kde-format msgctxt "Hebrew month 10 - KLocale::LongName" msgid "Tamuz" msgstr "Тамуз" #: kdecore/kcalendarsystemhebrew.cpp:785 #, kde-format msgctxt "Hebrew month 11 - KLocale::LongName" msgid "Av" msgstr "Ав" #: kdecore/kcalendarsystemhebrew.cpp:787 #, kde-format msgctxt "Hebrew month 12 - KLocale::LongName" msgid "Elul" msgstr "Элул" #: kdecore/kcalendarsystemhebrew.cpp:789 #, kde-format msgctxt "Hebrew month 13 - KLocale::LongName" msgid "Adar I" msgstr "Адар I" #: kdecore/kcalendarsystemhebrew.cpp:791 #, kde-format msgctxt "Hebrew month 14 - KLocale::LongName" msgid "Adar II" msgstr "Адар II" #: kdecore/kcalendarsystemindiannational.cpp:66 #, kde-format msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" msgid "Saka Era" msgstr "эры Сака" #: kdecore/kcalendarsystemindiannational.cpp:67 #, kde-format msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" msgid "SE" msgstr "э. С." #: kdecore/kcalendarsystemindiannational.cpp:68 #, kde-format msgctxt "" "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. " "2000 SE" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemindiannational.cpp:158 #, kde-format msgctxt "Indian National month 1 - KLocale::NarrowName" msgid "C" msgstr "ч" #: kdecore/kcalendarsystemindiannational.cpp:160 #, kde-format msgctxt "Indian National month 2 - KLocale::NarrowName" msgid "V" msgstr "в" #: kdecore/kcalendarsystemindiannational.cpp:162 #, kde-format msgctxt "Indian National month 3 - KLocale::NarrowName" msgid "J" msgstr "д" #: kdecore/kcalendarsystemindiannational.cpp:164 #, kde-format msgctxt "Indian National month 4 - KLocale::NarrowName" msgid "Ā" msgstr "а" #: kdecore/kcalendarsystemindiannational.cpp:166 #, kde-format msgctxt "Indian National month 5 - KLocale::NarrowName" msgid "S" msgstr "с" #: kdecore/kcalendarsystemindiannational.cpp:168 #, kde-format msgctxt "Indian National month 6 - KLocale::NarrowName" msgid "B" msgstr "б" #: kdecore/kcalendarsystemindiannational.cpp:170 #, kde-format msgctxt "Indian National month 7 - KLocale::NarrowName" msgid "Ā" msgstr "а" #: kdecore/kcalendarsystemindiannational.cpp:172 #, kde-format msgctxt "Indian National month 8 - KLocale::NarrowName" msgid "K" msgstr "к" #: kdecore/kcalendarsystemindiannational.cpp:174 #, kde-format msgctxt "Indian National month 9 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemindiannational.cpp:176 #, kde-format msgctxt "Indian National month 10 - KLocale::NarrowName" msgid "P" msgstr "п" #: kdecore/kcalendarsystemindiannational.cpp:178 #, kde-format msgctxt "Indian National month 11 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemindiannational.cpp:180 #, kde-format msgctxt "Indian National month 12 - KLocale::NarrowName" msgid "P" msgstr "п" #: kdecore/kcalendarsystemindiannational.cpp:189 #, kde-format msgctxt "Indian National month 1 - KLocale::ShortName Possessive" msgid "of Cha" msgstr "Чай" #: kdecore/kcalendarsystemindiannational.cpp:191 #, kde-format msgctxt "Indian National month 2 - KLocale::ShortName Possessive" msgid "of Vai" msgstr "Ваи" #: kdecore/kcalendarsystemindiannational.cpp:193 #, kde-format msgctxt "Indian National month 3 - KLocale::ShortName Possessive" msgid "of Jya" msgstr "Джа" #: kdecore/kcalendarsystemindiannational.cpp:195 #, kde-format msgctxt "Indian National month 4 - KLocale::ShortName Possessive" msgid "of Āsh" msgstr "Аса" #: kdecore/kcalendarsystemindiannational.cpp:197 #, kde-format msgctxt "Indian National month 5 - KLocale::ShortName Possessive" msgid "of Shr" msgstr "Сра" #: kdecore/kcalendarsystemindiannational.cpp:199 #, kde-format msgctxt "Indian National month 6 - KLocale::ShortName Possessive" msgid "of Bhā" msgstr "Бха" #: kdecore/kcalendarsystemindiannational.cpp:201 #, kde-format msgctxt "Indian National month 7 - KLocale::ShortName Possessive" msgid "of Āsw" msgstr "Азв" #: kdecore/kcalendarsystemindiannational.cpp:203 #, kde-format msgctxt "Indian National month 8 - KLocale::ShortName Possessive" msgid "of Kār" msgstr "Кар" #: kdecore/kcalendarsystemindiannational.cpp:205 #, kde-format msgctxt "Indian National month 9 - KLocale::ShortName Possessive" msgid "of Agr" msgstr "Агр" #: kdecore/kcalendarsystemindiannational.cpp:207 #, kde-format msgctxt "Indian National month 10 - KLocale::ShortName Possessive" msgid "of Pau" msgstr "Пау" #: kdecore/kcalendarsystemindiannational.cpp:209 #, kde-format msgctxt "Indian National month 11 - KLocale::ShortName Possessive" msgid "of Māg" msgstr "Маг" #: kdecore/kcalendarsystemindiannational.cpp:211 #, kde-format msgctxt "Indian National month 12 - KLocale::ShortName Possessive" msgid "of Phā" msgstr "Пха" #: kdecore/kcalendarsystemindiannational.cpp:220 #, kde-format msgctxt "Indian National month 1 - KLocale::ShortName" msgid "Cha" msgstr "Чай" #: kdecore/kcalendarsystemindiannational.cpp:222 #, kde-format msgctxt "Indian National month 2 - KLocale::ShortName" msgid "Vai" msgstr "Ваи" #: kdecore/kcalendarsystemindiannational.cpp:224 #, kde-format msgctxt "Indian National month 3 - KLocale::ShortName" msgid "Jya" msgstr "Джа" #: kdecore/kcalendarsystemindiannational.cpp:226 #, kde-format msgctxt "Indian National month 4 - KLocale::ShortName" msgid "Āsh" msgstr "Аса" #: kdecore/kcalendarsystemindiannational.cpp:228 #, kde-format msgctxt "Indian National month 5 - KLocale::ShortName" msgid "Shr" msgstr "Сра" #: kdecore/kcalendarsystemindiannational.cpp:230 #, kde-format msgctxt "Indian National month 6 - KLocale::ShortName" msgid "Bhā" msgstr "Бха" #: kdecore/kcalendarsystemindiannational.cpp:232 #, kde-format msgctxt "Indian National month 7 - KLocale::ShortName" msgid "Āsw" msgstr "Азв" #: kdecore/kcalendarsystemindiannational.cpp:234 #, kde-format msgctxt "Indian National month 8 - KLocale::ShortName" msgid "Kār" msgstr "Кар" #: kdecore/kcalendarsystemindiannational.cpp:236 #, kde-format msgctxt "Indian National month 9 - KLocale::ShortName" msgid "Agr" msgstr "Агр" #: kdecore/kcalendarsystemindiannational.cpp:238 #, kde-format msgctxt "Indian National month 10 - KLocale::ShortName" msgid "Pau" msgstr "Пау" #: kdecore/kcalendarsystemindiannational.cpp:240 #, kde-format msgctxt "Indian National month 11 - KLocale::ShortName" msgid "Māg" msgstr "Маг" #: kdecore/kcalendarsystemindiannational.cpp:242 #, kde-format msgctxt "Indian National month 12 - KLocale::ShortName" msgid "Phā" msgstr "Пха" #: kdecore/kcalendarsystemindiannational.cpp:251 #, kde-format msgctxt "Indian National month 1 - KLocale::LongName Possessive" msgid "of Chaitra" msgstr "Чайтра" #: kdecore/kcalendarsystemindiannational.cpp:253 #, kde-format msgctxt "Indian National month 2 - KLocale::LongName Possessive" msgid "of Vaishākh" msgstr "Ваисакха" #: kdecore/kcalendarsystemindiannational.cpp:255 #, kde-format msgctxt "Indian National month 3 - KLocale::LongName Possessive" msgid "of Jyaishtha" msgstr "Джанштха" #: kdecore/kcalendarsystemindiannational.cpp:257 #, kde-format msgctxt "Indian National month 4 - KLocale::LongName Possessive" msgid "of Āshādha" msgstr "Асадха" #: kdecore/kcalendarsystemindiannational.cpp:259 #, kde-format msgctxt "Indian National month 5 - KLocale::LongName Possessive" msgid "of Shrāvana" msgstr "Сравана" #: kdecore/kcalendarsystemindiannational.cpp:261 #, kde-format msgctxt "Indian National month 6 - KLocale::LongName Possessive" msgid "of Bhādrapad" msgstr "Бхадра" #: kdecore/kcalendarsystemindiannational.cpp:263 #, kde-format msgctxt "Indian National month 7 - KLocale::LongName Possessive" msgid "of Āshwin" msgstr "Азвина" #: kdecore/kcalendarsystemindiannational.cpp:265 #, kde-format msgctxt "Indian National month 8 - KLocale::LongName Possessive" msgid "of Kārtik" msgstr "Картика" #: kdecore/kcalendarsystemindiannational.cpp:267 #, kde-format msgctxt "Indian National month 9 - KLocale::LongName Possessive" msgid "of Agrahayana" msgstr "Аграхайана" #: kdecore/kcalendarsystemindiannational.cpp:269 #, kde-format msgctxt "Indian National month 10 - KLocale::LongName Possessive" msgid "of Paush" msgstr "Пауза" #: kdecore/kcalendarsystemindiannational.cpp:271 #, kde-format msgctxt "Indian National month 11 - KLocale::LongName Possessive" msgid "of Māgh" msgstr "Магха" #: kdecore/kcalendarsystemindiannational.cpp:273 #, kde-format msgctxt "Indian National month 12 - KLocale::LongName Possessive" msgid "of Phālgun" msgstr "Пхалгуна" #: kdecore/kcalendarsystemindiannational.cpp:282 #, kde-format msgctxt "Indian National month 1 - KLocale::LongName" msgid "Chaitra" msgstr "Чайтра" #: kdecore/kcalendarsystemindiannational.cpp:284 #, kde-format msgctxt "Indian National month 2 - KLocale::LongName" msgid "Vaishākh" msgstr "Ваисакха" #: kdecore/kcalendarsystemindiannational.cpp:286 #, kde-format msgctxt "Indian National month 3 - KLocale::LongName" msgid "Jyaishtha" msgstr "Джанштха" #: kdecore/kcalendarsystemindiannational.cpp:288 #, kde-format msgctxt "Indian National month 4 - KLocale::LongName" msgid "Āshādha" msgstr "Асадха" #: kdecore/kcalendarsystemindiannational.cpp:290 #, kde-format msgctxt "Indian National month 5 - KLocale::LongName" msgid "Shrāvana" msgstr "Сравана" #: kdecore/kcalendarsystemindiannational.cpp:292 #, kde-format msgctxt "Indian National month 6 - KLocale::LongName" msgid "Bhādrapad" msgstr "Бхадра" #: kdecore/kcalendarsystemindiannational.cpp:294 #, kde-format msgctxt "Indian National month 7 - KLocale::LongName" msgid "Āshwin" msgstr "Азвина" #: kdecore/kcalendarsystemindiannational.cpp:296 #, kde-format msgctxt "Indian National month 8 - KLocale::LongName" msgid "Kārtik" msgstr "Картика" #: kdecore/kcalendarsystemindiannational.cpp:298 #, kde-format msgctxt "Indian National month 9 - KLocale::LongName" msgid "Agrahayana" msgstr "Аграхайана" #: kdecore/kcalendarsystemindiannational.cpp:300 #, kde-format msgctxt "Indian National month 10 - KLocale::LongName" msgid "Paush" msgstr "Пауза" #: kdecore/kcalendarsystemindiannational.cpp:302 #, kde-format msgctxt "Indian National month 11 - KLocale::LongName" msgid "Māgh" msgstr "Магха" #: kdecore/kcalendarsystemindiannational.cpp:304 #, kde-format msgctxt "Indian National month 12 - KLocale::LongName" msgid "Phālgun" msgstr "Пхалгуна" #: kdecore/kcalendarsystemindiannational.cpp:317 #, kde-format msgctxt "Indian National weekday 1 - KLocale::NarrowName " msgid "S" msgstr "с" #: kdecore/kcalendarsystemindiannational.cpp:319 #, kde-format msgctxt "Indian National weekday 2 - KLocale::NarrowName " msgid "M" msgstr "м" #: kdecore/kcalendarsystemindiannational.cpp:321 #, kde-format msgctxt "Indian National weekday 3 - KLocale::NarrowName " msgid "B" msgstr "б" #: kdecore/kcalendarsystemindiannational.cpp:323 #, kde-format msgctxt "Indian National weekday 4 - KLocale::NarrowName " msgid "G" msgstr "г" #: kdecore/kcalendarsystemindiannational.cpp:325 #, kde-format msgctxt "Indian National weekday 5 - KLocale::NarrowName " msgid "S" msgstr "ш" #: kdecore/kcalendarsystemindiannational.cpp:327 #, kde-format msgctxt "Indian National weekday 6 - KLocale::NarrowName " msgid "S" msgstr "ш" #: kdecore/kcalendarsystemindiannational.cpp:329 #, kde-format msgctxt "Indian National weekday 7 - KLocale::NarrowName " msgid "R" msgstr "б" #: kdecore/kcalendarsystemindiannational.cpp:338 #, kde-format msgctxt "Indian National weekday 1 - KLocale::ShortName" msgid "Som" msgstr "Сом" #: kdecore/kcalendarsystemindiannational.cpp:340 #, kde-format msgctxt "Indian National weekday 2 - KLocale::ShortName" msgid "Mañ" msgstr "Ман" #: kdecore/kcalendarsystemindiannational.cpp:342 #, kde-format msgctxt "Indian National weekday 3 - KLocale::ShortName" msgid "Bud" msgstr "Буд" #: kdecore/kcalendarsystemindiannational.cpp:344 #, kde-format msgctxt "Indian National weekday 4 - KLocale::ShortName" msgid "Gur" msgstr "Гур" #: kdecore/kcalendarsystemindiannational.cpp:346 #, kde-format msgctxt "Indian National weekday 5 - KLocale::ShortName" msgid "Suk" msgstr "Шук" #: kdecore/kcalendarsystemindiannational.cpp:348 #, kde-format msgctxt "Indian National weekday 6 - KLocale::ShortName" msgid "San" msgstr "Шан" #: kdecore/kcalendarsystemindiannational.cpp:350 #, kde-format msgctxt "Indian National weekday 7 - KLocale::ShortName" msgid "Rav" msgstr "Бха" # http://ru.wikipedia.org/wiki/Дни_недели --aspotashev #: kdecore/kcalendarsystemindiannational.cpp:357 #, kde-format msgctxt "Indian National weekday 1 - KLocale::LongName" msgid "Somavãra" msgstr "Сома Ваара" #: kdecore/kcalendarsystemindiannational.cpp:359 #, kde-format msgctxt "Indian National weekday 2 - KLocale::LongName" msgid "Mañgalvã" msgstr "Мангала Ваара" #: kdecore/kcalendarsystemindiannational.cpp:361 #, kde-format msgctxt "Indian National weekday 3 - KLocale::LongName" msgid "Budhavãra" msgstr "Будха Ваара" #: kdecore/kcalendarsystemindiannational.cpp:363 #, kde-format msgctxt "Indian National weekday 4 - KLocale::LongName" msgid "Guruvãra" msgstr "Гуру Ваара" #: kdecore/kcalendarsystemindiannational.cpp:365 #, kde-format msgctxt "Indian National weekday 5 - KLocale::LongName" msgid "Sukravãra" msgstr "Шукра Ваара" #: kdecore/kcalendarsystemindiannational.cpp:367 #, kde-format msgctxt "Indian National weekday 6 - KLocale::LongName" msgid "Sanivãra" msgstr "Шани Ваара" #: kdecore/kcalendarsystemindiannational.cpp:369 #, kde-format msgctxt "Indian National weekday 7 - KLocale::LongName" msgid "Raviãra" msgstr "Бхану Ваара" #: kdecore/kcalendarsystemislamiccivil.cpp:66 #, kde-format msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" msgid "Anno Hegirae" msgstr "от Хиджры" #: kdecore/kcalendarsystemislamiccivil.cpp:67 #, kde-format msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" msgid "AH" msgstr "Х." #: kdecore/kcalendarsystemislamiccivil.cpp:68 #, kde-format msgctxt "" "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemislamiccivil.cpp:166 #, kde-format msgctxt "Hijri month 1 - KLocale::NarrowName" msgid "M" msgstr "М" #: kdecore/kcalendarsystemislamiccivil.cpp:168 #, kde-format msgctxt "Hijri month 2 - KLocale::NarrowName" msgid "S" msgstr "С" #: kdecore/kcalendarsystemislamiccivil.cpp:170 #, kde-format msgctxt "Hijri month 3 - KLocale::NarrowName" msgid "A" msgstr "А" #: kdecore/kcalendarsystemislamiccivil.cpp:172 #, kde-format msgctxt "Hijri month 4 - KLocale::NarrowName" msgid "T" msgstr "Х" #: kdecore/kcalendarsystemislamiccivil.cpp:174 #, kde-format msgctxt "Hijri month 5 - KLocale::NarrowName" msgid "A" msgstr "А" #: kdecore/kcalendarsystemislamiccivil.cpp:176 #, kde-format msgctxt "Hijri month 6 - KLocale::NarrowName" msgid "T" msgstr "Х" #: kdecore/kcalendarsystemislamiccivil.cpp:178 #, kde-format msgctxt "Hijri month 7 - KLocale::NarrowName" msgid "R" msgstr "Р" #: kdecore/kcalendarsystemislamiccivil.cpp:180 #, kde-format msgctxt "Hijri month 8 - KLocale::NarrowName" msgid "S" msgstr "Ш" #: kdecore/kcalendarsystemislamiccivil.cpp:182 #, kde-format msgctxt "Hijri month 9 - KLocale::NarrowName" msgid "R" msgstr "Р" #: kdecore/kcalendarsystemislamiccivil.cpp:184 #, kde-format msgctxt "Hijri month 10 - KLocale::NarrowName" msgid "S" msgstr "Ш" #: kdecore/kcalendarsystemislamiccivil.cpp:186 #, kde-format msgctxt "Hijri month 11 - KLocale::NarrowName" msgid "Q" msgstr "К" #: kdecore/kcalendarsystemislamiccivil.cpp:188 #, kde-format msgctxt "Hijri month 12 - KLocale::NarrowName" msgid "H" msgstr "Х" #: kdecore/kcalendarsystemislamiccivil.cpp:197 #, kde-format msgctxt "Hijri month 1 - KLocale::ShortName Possessive" msgid "of Muh" msgstr "Мух" #: kdecore/kcalendarsystemislamiccivil.cpp:199 #, kde-format msgctxt "Hijri month 2 - KLocale::ShortName Possessive" msgid "of Saf" msgstr "Саф" #: kdecore/kcalendarsystemislamiccivil.cpp:201 #, kde-format msgctxt "Hijri month 3 - KLocale::ShortName Possessive" msgid "of R.A" msgstr "Р.а" #: kdecore/kcalendarsystemislamiccivil.cpp:203 #, kde-format msgctxt "Hijri month 4 - KLocale::ShortName Possessive" msgid "of R.T" msgstr "Р.х" #: kdecore/kcalendarsystemislamiccivil.cpp:205 #, kde-format msgctxt "Hijri month 5 - KLocale::ShortName Possessive" msgid "of J.A" msgstr "Д.а" #: kdecore/kcalendarsystemislamiccivil.cpp:207 #, kde-format msgctxt "Hijri month 6 - KLocale::ShortName Possessive" msgid "of J.T" msgstr "Д.х" #: kdecore/kcalendarsystemislamiccivil.cpp:209 #, kde-format msgctxt "Hijri month 7 - KLocale::ShortName Possessive" msgid "of Raj" msgstr "Рад" #: kdecore/kcalendarsystemislamiccivil.cpp:211 #, kde-format msgctxt "Hijri month 8 - KLocale::ShortName Possessive" msgid "of Sha" msgstr "Шаа" #: kdecore/kcalendarsystemislamiccivil.cpp:213 #, kde-format msgctxt "Hijri month 9 - KLocale::ShortName Possessive" msgid "of Ram" msgstr "Рам" #: kdecore/kcalendarsystemislamiccivil.cpp:215 #, kde-format msgctxt "Hijri month 10 - KLocale::ShortName Possessive" msgid "of Shw" msgstr "Шав" #: kdecore/kcalendarsystemislamiccivil.cpp:217 #, kde-format msgctxt "Hijri month 11 - KLocale::ShortName Possessive" msgid "of Qid" msgstr "Каа" #: kdecore/kcalendarsystemislamiccivil.cpp:219 #, kde-format msgctxt "Hijri month 12 - KLocale::ShortName Possessive" msgid "of Hij" msgstr "Хид" #: kdecore/kcalendarsystemislamiccivil.cpp:228 #, kde-format msgctxt "Hijri month 1 - KLocale::ShortName" msgid "Muh" msgstr "Мух" #: kdecore/kcalendarsystemislamiccivil.cpp:230 #, kde-format msgctxt "Hijri month 2 - KLocale::ShortName" msgid "Saf" msgstr "Саф" #: kdecore/kcalendarsystemislamiccivil.cpp:232 #, kde-format msgctxt "Hijri month 3 - KLocale::ShortName" msgid "R.A" msgstr "Р.а" #: kdecore/kcalendarsystemislamiccivil.cpp:234 #, kde-format msgctxt "Hijri month 4 - KLocale::ShortName" msgid "R.T" msgstr "Р.х" #: kdecore/kcalendarsystemislamiccivil.cpp:236 #, kde-format msgctxt "Hijri month 5 - KLocale::ShortName" msgid "J.A" msgstr "Д.а" #: kdecore/kcalendarsystemislamiccivil.cpp:238 #, kde-format msgctxt "Hijri month 6 - KLocale::ShortName" msgid "J.T" msgstr "Д.х" #: kdecore/kcalendarsystemislamiccivil.cpp:240 #, kde-format msgctxt "Hijri month 7 - KLocale::ShortName" msgid "Raj" msgstr "Рад" #: kdecore/kcalendarsystemislamiccivil.cpp:242 #, kde-format msgctxt "Hijri month 8 - KLocale::ShortName" msgid "Sha" msgstr "Шаа" #: kdecore/kcalendarsystemislamiccivil.cpp:244 #, kde-format msgctxt "Hijri month 9 - KLocale::ShortName" msgid "Ram" msgstr "Рам" #: kdecore/kcalendarsystemislamiccivil.cpp:246 #, kde-format msgctxt "Hijri month 10 - KLocale::ShortName" msgid "Shw" msgstr "Шав" #: kdecore/kcalendarsystemislamiccivil.cpp:248 #, kde-format msgctxt "Hijri month 11 - KLocale::ShortName" msgid "Qid" msgstr "Каа" #: kdecore/kcalendarsystemislamiccivil.cpp:250 #, kde-format msgctxt "Hijri month 12 - KLocale::ShortName" msgid "Hij" msgstr "Хид" #: kdecore/kcalendarsystemislamiccivil.cpp:259 #, kde-format msgctxt "Hijri month 1 - KLocale::LongName Possessive" msgid "of Muharram" msgstr "Мухаррама" #: kdecore/kcalendarsystemislamiccivil.cpp:261 #, kde-format msgctxt "Hijri month 2 - KLocale::LongName Possessive" msgid "of Safar" msgstr "Сафара" #: kdecore/kcalendarsystemislamiccivil.cpp:263 #, kde-format msgctxt "Hijri month 3 - KLocale::LongName Possessive" msgid "of Rabi` al-Awal" msgstr "Раби-уль-авваля" #: kdecore/kcalendarsystemislamiccivil.cpp:265 #, kde-format msgctxt "Hijri month 4 - KLocale::LongName Possessive" msgid "of Rabi` al-Thaani" msgstr "Раби-уль-ахира" #: kdecore/kcalendarsystemislamiccivil.cpp:267 #, kde-format msgctxt "Hijri month 5 - KLocale::LongName Possessive" msgid "of Jumaada al-Awal" msgstr "Джумад-уль-авваля" #: kdecore/kcalendarsystemislamiccivil.cpp:269 #, kde-format msgctxt "Hijri month 6 - KLocale::LongName Possessive" msgid "of Jumaada al-Thaani" msgstr "Джумад-уль-ахира" #: kdecore/kcalendarsystemislamiccivil.cpp:271 #, kde-format msgctxt "Hijri month 7 - KLocale::LongName Possessive" msgid "of Rajab" msgstr "Раджаба" #: kdecore/kcalendarsystemislamiccivil.cpp:273 #, kde-format msgctxt "Hijri month 8 - KLocale::LongName Possessive" msgid "of Sha`ban" msgstr "Шаабана" #: kdecore/kcalendarsystemislamiccivil.cpp:275 #, kde-format msgctxt "Hijri month 9 - KLocale::LongName Possessive" msgid "of Ramadan" msgstr "Рамадана" #: kdecore/kcalendarsystemislamiccivil.cpp:277 #, kde-format msgctxt "Hijri month 10 - KLocale::LongName Possessive" msgid "of Shawwal" msgstr "Шавваля" #: kdecore/kcalendarsystemislamiccivil.cpp:279 #, kde-format msgctxt "Hijri month 11 - KLocale::LongName Possessive" msgid "of Thu al-Qi`dah" msgstr "Зуль-Каады" #: kdecore/kcalendarsystemislamiccivil.cpp:281 #, kde-format msgctxt "Hijri month 12 - KLocale::LongName Possessive" msgid "of Thu al-Hijjah" msgstr "Зуль-Хиджжи" #: kdecore/kcalendarsystemislamiccivil.cpp:290 #, kde-format msgctxt "Hijri month 1 - KLocale::LongName" msgid "Muharram" msgstr "Мухаррам" #: kdecore/kcalendarsystemislamiccivil.cpp:292 #, kde-format msgctxt "Hijri month 2 - KLocale::LongName" msgid "Safar" msgstr "Сафар" #: kdecore/kcalendarsystemislamiccivil.cpp:294 #, kde-format msgctxt "Hijri month 3 - KLocale::LongName" msgid "Rabi` al-Awal" msgstr "Раби-уль-авваль" #: kdecore/kcalendarsystemislamiccivil.cpp:296 #, kde-format msgctxt "Hijri month 4 - KLocale::LongName" msgid "Rabi` al-Thaani" msgstr "Раби-уль-ахир" #: kdecore/kcalendarsystemislamiccivil.cpp:298 #, kde-format msgctxt "Hijri month 5 - KLocale::LongName" msgid "Jumaada al-Awal" msgstr "Джумад-уль-авваль" #: kdecore/kcalendarsystemislamiccivil.cpp:300 #, kde-format msgctxt "Hijri month 6 - KLocale::LongName" msgid "Jumaada al-Thaani" msgstr "Джумад-уль-ахир" #: kdecore/kcalendarsystemislamiccivil.cpp:302 #, kde-format msgctxt "Hijri month 7 - KLocale::LongName" msgid "Rajab" msgstr "Раджаб" #: kdecore/kcalendarsystemislamiccivil.cpp:304 #, kde-format msgctxt "Hijri month 8 - KLocale::LongName" msgid "Sha`ban" msgstr "Шаабан" #: kdecore/kcalendarsystemislamiccivil.cpp:306 #, kde-format msgctxt "Hijri month 9 - KLocale::LongName" msgid "Ramadan" msgstr "Рамадан" #: kdecore/kcalendarsystemislamiccivil.cpp:308 #, kde-format msgctxt "Hijri month 10 - KLocale::LongName" msgid "Shawwal" msgstr "Шавваль" #: kdecore/kcalendarsystemislamiccivil.cpp:310 #, kde-format msgctxt "Hijri month 11 - KLocale::LongName" msgid "Thu al-Qi`dah" msgstr "Зуль-Каада" #: kdecore/kcalendarsystemislamiccivil.cpp:312 #, kde-format msgctxt "Hijri month 12 - KLocale::LongName" msgid "Thu al-Hijjah" msgstr "Зуль-Хиджжа" #: kdecore/kcalendarsystemislamiccivil.cpp:325 #, kde-format msgctxt "Hijri weekday 1 - KLocale::NarrowName " msgid "I" msgstr "и" #: kdecore/kcalendarsystemislamiccivil.cpp:327 #, kde-format msgctxt "Hijri weekday 2 - KLocale::NarrowName " msgid "T" msgstr "с" #: kdecore/kcalendarsystemislamiccivil.cpp:329 #, kde-format msgctxt "Hijri weekday 3 - KLocale::NarrowName " msgid "A" msgstr "а" #: kdecore/kcalendarsystemislamiccivil.cpp:331 #, kde-format msgctxt "Hijri weekday 4 - KLocale::NarrowName " msgid "K" msgstr "х" #: kdecore/kcalendarsystemislamiccivil.cpp:333 #, kde-format msgctxt "Hijri weekday 5 - KLocale::NarrowName " msgid "J" msgstr "д" #: kdecore/kcalendarsystemislamiccivil.cpp:335 #, kde-format msgctxt "Hijri weekday 6 - KLocale::NarrowName " msgid "S" msgstr "с" #: kdecore/kcalendarsystemislamiccivil.cpp:337 #, kde-format msgctxt "Hijri weekday 7 - KLocale::NarrowName " msgid "A" msgstr "а" #: kdecore/kcalendarsystemislamiccivil.cpp:346 #, kde-format msgctxt "Hijri weekday 1 - KLocale::ShortName" msgid "Ith" msgstr "исн" #: kdecore/kcalendarsystemislamiccivil.cpp:348 #, kde-format msgctxt "Hijri weekday 2 - KLocale::ShortName" msgid "Thl" msgstr "сал" #: kdecore/kcalendarsystemislamiccivil.cpp:350 #, kde-format msgctxt "Hijri weekday 3 - KLocale::ShortName" msgid "Arb" msgstr "арб" #: kdecore/kcalendarsystemislamiccivil.cpp:352 #, kde-format msgctxt "Hijri weekday 4 - KLocale::ShortName" msgid "Kha" msgstr "хам" #: kdecore/kcalendarsystemislamiccivil.cpp:354 #, kde-format msgctxt "Hijri weekday 5 - KLocale::ShortName" msgid "Jum" msgstr "джу" #: kdecore/kcalendarsystemislamiccivil.cpp:356 #, kde-format msgctxt "Hijri weekday 6 - KLocale::ShortName" msgid "Sab" msgstr "саб" #: kdecore/kcalendarsystemislamiccivil.cpp:358 #, kde-format msgctxt "Hijri weekday 7 - KLocale::ShortName" msgid "Ahd" msgstr "аха" #: kdecore/kcalendarsystemislamiccivil.cpp:365 #, kde-format msgctxt "Hijri weekday 1 - KLocale::LongName" msgid "Yaum al-Ithnain" msgstr "Йаум аль-иснаи" #: kdecore/kcalendarsystemislamiccivil.cpp:367 #, kde-format msgctxt "Hijri weekday 2 - KLocale::LongName" msgid "Yau al-Thulatha" msgstr "Йаум ас-саласа" #: kdecore/kcalendarsystemislamiccivil.cpp:369 #, kde-format msgctxt "Hijri weekday 3 - KLocale::LongName" msgid "Yaum al-Arbi'a" msgstr "Йаум аль-арбаа" #: kdecore/kcalendarsystemislamiccivil.cpp:371 #, kde-format msgctxt "Hijri weekday 4 - KLocale::LongName" msgid "Yaum al-Khamees" msgstr "Йаум аль-хамис" #: kdecore/kcalendarsystemislamiccivil.cpp:373 #, kde-format msgctxt "Hijri weekday 5 - KLocale::LongName" msgid "Yaum al-Jumma" msgstr "Йаум аль-джум'а" #: kdecore/kcalendarsystemislamiccivil.cpp:375 #, kde-format msgctxt "Hijri weekday 6 - KLocale::LongName" msgid "Yaum al-Sabt" msgstr "Йаум ас-сабт" #: kdecore/kcalendarsystemislamiccivil.cpp:377 #, kde-format msgctxt "Hijri weekday 7 - KLocale::LongName" msgid "Yaum al-Ahad" msgstr "Йаум аль-ахад" #: kdecore/kcalendarsystemjalali.cpp:74 #, kde-format msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" msgid "Anno Persico" msgstr "хиджры" #: kdecore/kcalendarsystemjalali.cpp:75 #, kde-format msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" msgid "AP" msgstr "х." #: kdecore/kcalendarsystemjalali.cpp:76 #, kde-format msgctxt "" "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemjalali.cpp:172 #, kde-format msgctxt "Jalali month 1 - KLocale::NarrowName" msgid "F" msgstr "ф" #: kdecore/kcalendarsystemjalali.cpp:174 #, kde-format msgctxt "Jalali month 2 - KLocale::NarrowName" msgid "O" msgstr "о" #: kdecore/kcalendarsystemjalali.cpp:176 #, kde-format msgctxt "Jalali month 3 - KLocale::NarrowName" msgid "K" msgstr "х" #: kdecore/kcalendarsystemjalali.cpp:178 #, kde-format msgctxt "Jalali month 4 - KLocale::NarrowName" msgid "T" msgstr "т" #: kdecore/kcalendarsystemjalali.cpp:180 #, kde-format msgctxt "Jalali month 5 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemjalali.cpp:182 #, kde-format msgctxt "Jalali month 6 - KLocale::NarrowName" msgid "S" msgstr "ш" #: kdecore/kcalendarsystemjalali.cpp:184 #, kde-format msgctxt "Jalali month 7 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemjalali.cpp:186 #, kde-format msgctxt "Jalali month 8 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemjalali.cpp:188 #, kde-format msgctxt "Jalali month 9 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemjalali.cpp:190 #, kde-format msgctxt "Jalali month 10 - KLocale::NarrowName" msgid "D" msgstr "д" #: kdecore/kcalendarsystemjalali.cpp:192 #, kde-format msgctxt "Jalali month 11 - KLocale::NarrowName" msgid "B" msgstr "б" #: kdecore/kcalendarsystemjalali.cpp:194 #, kde-format msgctxt "Jalali month 12 - KLocale::NarrowName" msgid "E" msgstr "э" #: kdecore/kcalendarsystemjalali.cpp:203 #, kde-format msgctxt "Jalali month 1 - KLocale::ShortName Possessive" msgid "of Far" msgstr "Фар" #: kdecore/kcalendarsystemjalali.cpp:205 #, kde-format msgctxt "Jalali month 2 - KLocale::ShortName Possessive" msgid "of Ord" msgstr "Орд" #: kdecore/kcalendarsystemjalali.cpp:207 #, kde-format msgctxt "Jalali month 3 - KLocale::ShortName Possessive" msgid "of Kho" msgstr "Хор" #: kdecore/kcalendarsystemjalali.cpp:209 #, kde-format msgctxt "Jalali month 4 - KLocale::ShortName Possessive" msgid "of Tir" msgstr "Тир" #: kdecore/kcalendarsystemjalali.cpp:211 #, kde-format msgctxt "Jalali month 5 - KLocale::ShortName Possessive" msgid "of Mor" msgstr "Мор" #: kdecore/kcalendarsystemjalali.cpp:213 #, kde-format msgctxt "Jalali month 6 - KLocale::ShortName Possessive" msgid "of Sha" msgstr "Шах" #: kdecore/kcalendarsystemjalali.cpp:215 #, kde-format msgctxt "Jalali month 7 - KLocale::ShortName Possessive" msgid "of Meh" msgstr "Мех" #: kdecore/kcalendarsystemjalali.cpp:217 #, kde-format msgctxt "Jalali month 8 - KLocale::ShortName Possessive" msgid "of Aba" msgstr "Аба" #: kdecore/kcalendarsystemjalali.cpp:219 #, kde-format msgctxt "Jalali month 9 - KLocale::ShortName Possessive" msgid "of Aza" msgstr "Азе" #: kdecore/kcalendarsystemjalali.cpp:221 #, kde-format msgctxt "Jalali month 10 - KLocale::ShortName Possessive" msgid "of Dei" msgstr "Дей" #: kdecore/kcalendarsystemjalali.cpp:223 #, kde-format msgctxt "Jalali month 11 - KLocale::ShortName Possessive" msgid "of Bah" msgstr "Бах" #: kdecore/kcalendarsystemjalali.cpp:225 #, kde-format msgctxt "Jalali month 12 - KLocale::ShortName Possessive" msgid "of Esf" msgstr "Эсф" #: kdecore/kcalendarsystemjalali.cpp:234 #, kde-format msgctxt "Jalali month 1 - KLocale::ShortName" msgid "Far" msgstr "Фар" #: kdecore/kcalendarsystemjalali.cpp:236 #, kde-format msgctxt "Jalali month 2 - KLocale::ShortName" msgid "Ord" msgstr "Орд" #: kdecore/kcalendarsystemjalali.cpp:238 #, kde-format msgctxt "Jalali month 3 - KLocale::ShortName" msgid "Kho" msgstr "Хор" #: kdecore/kcalendarsystemjalali.cpp:240 #, kde-format msgctxt "Jalali month 4 - KLocale::ShortName" msgid "Tir" msgstr "Тир" #: kdecore/kcalendarsystemjalali.cpp:242 #, kde-format msgctxt "Jalali month 5 - KLocale::ShortName" msgid "Mor" msgstr "Мор" #: kdecore/kcalendarsystemjalali.cpp:244 #, kde-format msgctxt "Jalali month 6 - KLocale::ShortName" msgid "Sha" msgstr "Шах" #: kdecore/kcalendarsystemjalali.cpp:246 #, kde-format msgctxt "Jalali month 7 - KLocale::ShortName" msgid "Meh" msgstr "Мех" #: kdecore/kcalendarsystemjalali.cpp:248 #, kde-format msgctxt "Jalali month 8 - KLocale::ShortName" msgid "Aba" msgstr "Аба" #: kdecore/kcalendarsystemjalali.cpp:250 #, kde-format msgctxt "Jalali month 9 - KLocale::ShortName" msgid "Aza" msgstr "Аза" #: kdecore/kcalendarsystemjalali.cpp:252 #, kde-format msgctxt "Jalali month 10 - KLocale::ShortName" msgid "Dei" msgstr "Дей" #: kdecore/kcalendarsystemjalali.cpp:254 #, kde-format msgctxt "Jalali month 11 - KLocale::ShortName" msgid "Bah" msgstr "Бах" #: kdecore/kcalendarsystemjalali.cpp:256 #, kde-format msgctxt "Jalali month 12 - KLocale::ShortName" msgid "Esf" msgstr "Эсф" #: kdecore/kcalendarsystemjalali.cpp:265 #, kde-format msgctxt "Jalali month 1 - KLocale::LongName Possessive" msgid "of Farvardin" msgstr "Фарвардин" #: kdecore/kcalendarsystemjalali.cpp:267 #, kde-format msgctxt "Jalali month 2 - KLocale::LongName Possessive" msgid "of Ordibehesht" msgstr "Ордибехешт" #: kdecore/kcalendarsystemjalali.cpp:269 #, kde-format msgctxt "Jalali month 3 - KLocale::LongName Possessive" msgid "of Khordad" msgstr "Хордад" #: kdecore/kcalendarsystemjalali.cpp:271 #, kde-format msgctxt "Jalali month 4 - KLocale::LongName Possessive" msgid "of Tir" msgstr "Тир" #: kdecore/kcalendarsystemjalali.cpp:273 #, kde-format msgctxt "Jalali month 5 - KLocale::LongName Possessive" msgid "of Mordad" msgstr "Мордад" #: kdecore/kcalendarsystemjalali.cpp:275 #, kde-format msgctxt "Jalali month 6 - KLocale::LongName Possessive" msgid "of Shahrivar" msgstr "Шахривар" #: kdecore/kcalendarsystemjalali.cpp:277 #, kde-format msgctxt "Jalali month 7 - KLocale::LongName Possessive" msgid "of Mehr" msgstr "Мехр" #: kdecore/kcalendarsystemjalali.cpp:279 #, kde-format msgctxt "Jalali month 8 - KLocale::LongName Possessive" msgid "of Aban" msgstr "Абан" #: kdecore/kcalendarsystemjalali.cpp:281 #, kde-format msgctxt "Jalali month 9 - KLocale::LongName Possessive" msgid "of Azar" msgstr "Азар" #: kdecore/kcalendarsystemjalali.cpp:283 #, kde-format msgctxt "Jalali month 10 - KLocale::LongName Possessive" msgid "of Dei" msgstr "Дей" #: kdecore/kcalendarsystemjalali.cpp:285 #, kde-format msgctxt "Jalali month 11 - KLocale::LongName Possessive" msgid "of Bahman" msgstr "Бахман" #: kdecore/kcalendarsystemjalali.cpp:287 #, kde-format msgctxt "Jalali month 12 - KLocale::LongName Possessive" msgid "of Esfand" msgstr "Эсфанд" #: kdecore/kcalendarsystemjalali.cpp:296 #, kde-format msgctxt "Jalali month 1 - KLocale::LongName" msgid "Farvardin" msgstr "Фарвардин" #: kdecore/kcalendarsystemjalali.cpp:298 #, kde-format msgctxt "Jalali month 2 - KLocale::LongName" msgid "Ordibehesht" msgstr "Ордибехешт" #: kdecore/kcalendarsystemjalali.cpp:300 #, kde-format msgctxt "Jalali month 3 - KLocale::LongName" msgid "Khordad" msgstr "Хордад" #: kdecore/kcalendarsystemjalali.cpp:302 #, kde-format msgctxt "Jalali month 4 - KLocale::LongName" msgid "Tir" msgstr "Тир" #: kdecore/kcalendarsystemjalali.cpp:304 #, kde-format msgctxt "Jalali month 5 - KLocale::LongName" msgid "Mordad" msgstr "Мордад" #: kdecore/kcalendarsystemjalali.cpp:306 #, kde-format msgctxt "Jalali month 6 - KLocale::LongName" msgid "Shahrivar" msgstr "Шахривар" #: kdecore/kcalendarsystemjalali.cpp:308 #, kde-format msgctxt "Jalali month 7 - KLocale::LongName" msgid "Mehr" msgstr "Мехр" #: kdecore/kcalendarsystemjalali.cpp:310 #, kde-format msgctxt "Jalali month 8 - KLocale::LongName" msgid "Aban" msgstr "Абан" #: kdecore/kcalendarsystemjalali.cpp:312 #, kde-format msgctxt "Jalali month 9 - KLocale::LongName" msgid "Azar" msgstr "Азар" #: kdecore/kcalendarsystemjalali.cpp:314 #, kde-format msgctxt "Jalali month 10 - KLocale::LongName" msgid "Dei" msgstr "Дей" #: kdecore/kcalendarsystemjalali.cpp:316 #, kde-format msgctxt "Jalali month 11 - KLocale::LongName" msgid "Bahman" msgstr "Бахман" #: kdecore/kcalendarsystemjalali.cpp:318 #, kde-format msgctxt "Jalali month 12 - KLocale::LongName" msgid "Esfand" msgstr "Эсфанд" #: kdecore/kcalendarsystemjalali.cpp:331 #, kde-format msgctxt "Jalali weekday 1 - KLocale::NarrowName " msgid "2" msgstr "2" #: kdecore/kcalendarsystemjalali.cpp:333 #, kde-format msgctxt "Jalali weekday 2 - KLocale::NarrowName " msgid "3" msgstr "3" #: kdecore/kcalendarsystemjalali.cpp:335 #, kde-format msgctxt "Jalali weekday 3 - KLocale::NarrowName " msgid "4" msgstr "4" #: kdecore/kcalendarsystemjalali.cpp:337 #, kde-format msgctxt "Jalali weekday 4 - KLocale::NarrowName " msgid "5" msgstr "5" #: kdecore/kcalendarsystemjalali.cpp:339 #, kde-format msgctxt "Jalali weekday 5 - KLocale::NarrowName " msgid "J" msgstr "д" #: kdecore/kcalendarsystemjalali.cpp:341 #, kde-format msgctxt "Jalali weekday 6 - KLocale::NarrowName " msgid "S" msgstr "ш" #: kdecore/kcalendarsystemjalali.cpp:343 #, kde-format msgctxt "Jalali weekday 7 - KLocale::NarrowName " msgid "1" msgstr "1" #: kdecore/kcalendarsystemjalali.cpp:352 #, kde-format msgctxt "Jalali weekday 1 - KLocale::ShortName" msgid "2sh" msgstr "2" #: kdecore/kcalendarsystemjalali.cpp:354 #, kde-format msgctxt "Jalali weekday 2 - KLocale::ShortName" msgid "3sh" msgstr "3" #: kdecore/kcalendarsystemjalali.cpp:356 #, kde-format msgctxt "Jalali weekday 3 - KLocale::ShortName" msgid "4sh" msgstr "4" #: kdecore/kcalendarsystemjalali.cpp:358 #, kde-format msgctxt "Jalali weekday 4 - KLocale::ShortName" msgid "5sh" msgstr "5" #: kdecore/kcalendarsystemjalali.cpp:360 #, kde-format msgctxt "Jalali weekday 5 - KLocale::ShortName" msgid "Jom" msgstr "джо" #: kdecore/kcalendarsystemjalali.cpp:362 #, kde-format msgctxt "Jalali weekday 6 - KLocale::ShortName" msgid "Shn" msgstr "шан" #: kdecore/kcalendarsystemjalali.cpp:364 #, kde-format msgctxt "Jalali weekday 7 - KLocale::ShortName" msgid "1sh" msgstr "1" #: kdecore/kcalendarsystemjalali.cpp:371 #, kde-format msgctxt "Jalali weekday 1 - KLocale::LongName" msgid "Do shanbe" msgstr "Душанбе" #: kdecore/kcalendarsystemjalali.cpp:373 #, kde-format msgctxt "Jalali weekday 2 - KLocale::LongName" msgid "Se shanbe" msgstr "Сешанбе" #: kdecore/kcalendarsystemjalali.cpp:375 #, kde-format msgctxt "Jalali weekday 3 - KLocale::LongName" msgid "Chahar shanbe" msgstr "Чахаршанбе" #: kdecore/kcalendarsystemjalali.cpp:377 #, kde-format msgctxt "Jalali weekday 4 - KLocale::LongName" msgid "Panj shanbe" msgstr "Панджшанбе" #: kdecore/kcalendarsystemjalali.cpp:379 #, kde-format msgctxt "Jalali weekday 5 - KLocale::LongName" msgid "Jumee" msgstr "Джоме" #: kdecore/kcalendarsystemjalali.cpp:381 #, kde-format msgctxt "Jalali weekday 6 - KLocale::LongName" msgid "Shanbe" msgstr "Шанбе" #: kdecore/kcalendarsystemjalali.cpp:383 #, kde-format msgctxt "Jalali weekday 7 - KLocale::LongName" msgid "Yek-shanbe" msgstr "Йекшанбе" #: kdecore/kcalendarsystemjapanese.cpp:62 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" msgid "Meiji" msgstr "Мэйдзи" #: kdecore/kcalendarsystemjapanese.cpp:64 #, kde-format msgctxt "" "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, " "e.g. Meiji 1" msgid "%EC Gannen" msgstr "1 г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:66 #, kde-format msgctxt "" "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, " "e.g. Meiji 22" msgid "%EC %Ey" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:69 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" msgid "Taishō" msgstr "Тайсё" #: kdecore/kcalendarsystemjapanese.cpp:71 #, kde-format msgctxt "" "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = " "1, e.g. Taishō 1" msgid "%EC Gannen" msgstr "1 г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:73 #, kde-format msgctxt "" "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > " "1, e.g. Taishō 22" msgid "%EC %Ey" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:76 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" msgid "Shōwa" msgstr "Сёва" #: kdecore/kcalendarsystemjapanese.cpp:78 #, kde-format msgctxt "" "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, " "e.g. Shōwa 1" msgid "%EC Gannen" msgstr "1 г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:80 #, kde-format msgctxt "" "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, " "e.g. Shōwa 22" msgid "%EC %Ey" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:83 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" msgid "Heisei" msgstr "Хэйсэй" #: kdecore/kcalendarsystemjapanese.cpp:85 #, kde-format msgctxt "" "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = " "1, e.g. Heisei 1" msgid "%EC Gannen" msgstr "1 г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:87 #, kde-format msgctxt "" "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > " "1, e.g. Heisei 22" msgid "%EC %Ey" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemjapanese.cpp:164 #, kde-format msgctxt "Japanese year 1 of era" msgid "Gannen" msgstr "1 г." #: kdecore/kcalendarsystemjulian.cpp:73 #, kde-format msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" msgid "Before Common Era" msgstr "до нашей эры" #: kdecore/kcalendarsystemjulian.cpp:74 #, kde-format msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" msgid "BCE" msgstr "до н. э." #: kdecore/kcalendarsystemjulian.cpp:76 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" msgid "Before Christ" msgstr "до Рождества Христова" #: kdecore/kcalendarsystemjulian.cpp:77 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" msgid "BC" msgstr "до Р. Х." #: kdecore/kcalendarsystemjulian.cpp:79 #, kde-format msgctxt "" "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemjulian.cpp:83 #, kde-format msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" msgid "Common Era" msgstr "нашей эры" #: kdecore/kcalendarsystemjulian.cpp:84 #, kde-format msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" msgid "CE" msgstr "н. э." #: kdecore/kcalendarsystemjulian.cpp:86 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" msgid "Anno Domini" msgstr "от Рождества Христова" #: kdecore/kcalendarsystemjulian.cpp:87 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" msgid "AD" msgstr "Р. Х." #: kdecore/kcalendarsystemjulian.cpp:89 #, kde-format msgctxt "" "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemjulian.cpp:172 #, kde-format msgctxt "Julian month 1 - KLocale::NarrowName" msgid "J" msgstr "я" #: kdecore/kcalendarsystemjulian.cpp:174 #, kde-format msgctxt "Julian month 2 - KLocale::NarrowName" msgid "F" msgstr "ф" #: kdecore/kcalendarsystemjulian.cpp:176 #, kde-format msgctxt "Julian month 3 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemjulian.cpp:178 #, kde-format msgctxt "Julian month 4 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemjulian.cpp:180 #, kde-format msgctxt "Julian month 5 - KLocale::NarrowName" msgid "M" msgstr "м" #: kdecore/kcalendarsystemjulian.cpp:182 #, kde-format msgctxt "Julian month 6 - KLocale::NarrowName" msgid "J" msgstr "и" #: kdecore/kcalendarsystemjulian.cpp:184 #, kde-format msgctxt "Julian month 7 - KLocale::NarrowName" msgid "J" msgstr "и" #: kdecore/kcalendarsystemjulian.cpp:186 #, kde-format msgctxt "Julian month 8 - KLocale::NarrowName" msgid "A" msgstr "а" #: kdecore/kcalendarsystemjulian.cpp:188 #, kde-format msgctxt "Julian month 9 - KLocale::NarrowName" msgid "S" msgstr "с" #: kdecore/kcalendarsystemjulian.cpp:190 #, kde-format msgctxt "Julian month 10 - KLocale::NarrowName" msgid "O" msgstr "о" #: kdecore/kcalendarsystemjulian.cpp:192 #, kde-format msgctxt "Julian month 11 - KLocale::NarrowName" msgid "N" msgstr "н" #: kdecore/kcalendarsystemjulian.cpp:194 #, kde-format msgctxt "Julian month 12 - KLocale::NarrowName" msgid "D" msgstr "д" #: kdecore/kcalendarsystemjulian.cpp:203 #, kde-format msgctxt "Julian month 1 - KLocale::ShortName Possessive" msgid "of Jan" msgstr "янв" #: kdecore/kcalendarsystemjulian.cpp:205 #, kde-format msgctxt "Julian month 2 - KLocale::ShortName Possessive" msgid "of Feb" msgstr "фев" #: kdecore/kcalendarsystemjulian.cpp:207 #, kde-format msgctxt "Julian month 3 - KLocale::ShortName Possessive" msgid "of Mar" msgstr "мар" #: kdecore/kcalendarsystemjulian.cpp:209 #, kde-format msgctxt "Julian month 4 - KLocale::ShortName Possessive" msgid "of Apr" msgstr "апр" #: kdecore/kcalendarsystemjulian.cpp:211 #, kde-format msgctxt "Julian month 5 - KLocale::ShortName Possessive" msgid "of May" msgstr "мая" #: kdecore/kcalendarsystemjulian.cpp:213 #, kde-format msgctxt "Julian month 6 - KLocale::ShortName Possessive" msgid "of Jun" msgstr "июн" #: kdecore/kcalendarsystemjulian.cpp:215 #, kde-format msgctxt "Julian month 7 - KLocale::ShortName Possessive" msgid "of Jul" msgstr "июл" #: kdecore/kcalendarsystemjulian.cpp:217 #, kde-format msgctxt "Julian month 8 - KLocale::ShortName Possessive" msgid "of Aug" msgstr "авг" #: kdecore/kcalendarsystemjulian.cpp:219 #, kde-format msgctxt "Julian month 9 - KLocale::ShortName Possessive" msgid "of Sep" msgstr "сен" #: kdecore/kcalendarsystemjulian.cpp:221 #, kde-format msgctxt "Julian month 10 - KLocale::ShortName Possessive" msgid "of Oct" msgstr "окт" #: kdecore/kcalendarsystemjulian.cpp:223 #, kde-format msgctxt "Julian month 11 - KLocale::ShortName Possessive" msgid "of Nov" msgstr "ноя" #: kdecore/kcalendarsystemjulian.cpp:225 #, kde-format msgctxt "Julian month 12 - KLocale::ShortName Possessive" msgid "of Dec" msgstr "дек" #: kdecore/kcalendarsystemjulian.cpp:234 #, kde-format msgctxt "Julian month 1 - KLocale::ShortName" msgid "Jan" msgstr "Янв" #: kdecore/kcalendarsystemjulian.cpp:236 #, kde-format msgctxt "Julian month 2 - KLocale::ShortName" msgid "Feb" msgstr "Фев" #: kdecore/kcalendarsystemjulian.cpp:238 #, kde-format msgctxt "Julian month 3 - KLocale::ShortName" msgid "Mar" msgstr "Мар" #: kdecore/kcalendarsystemjulian.cpp:240 #, kde-format msgctxt "Julian month 4 - KLocale::ShortName" msgid "Apr" msgstr "Апр" #: kdecore/kcalendarsystemjulian.cpp:242 #, kde-format msgctxt "Julian month 5 - KLocale::ShortName" msgid "May" msgstr "Май" #: kdecore/kcalendarsystemjulian.cpp:244 #, kde-format msgctxt "Julian month 6 - KLocale::ShortName" msgid "Jun" msgstr "Июн" #: kdecore/kcalendarsystemjulian.cpp:246 #, kde-format msgctxt "Julian month 7 - KLocale::ShortName" msgid "Jul" msgstr "Июл" #: kdecore/kcalendarsystemjulian.cpp:248 #, kde-format msgctxt "Julian month 8 - KLocale::ShortName" msgid "Aug" msgstr "Авг" #: kdecore/kcalendarsystemjulian.cpp:250 #, kde-format msgctxt "Julian month 9 - KLocale::ShortName" msgid "Sep" msgstr "Сен" #: kdecore/kcalendarsystemjulian.cpp:252 #, kde-format msgctxt "Julian month 10 - KLocale::ShortName" msgid "Oct" msgstr "Окт" #: kdecore/kcalendarsystemjulian.cpp:254 #, kde-format msgctxt "Julian month 11 - KLocale::ShortName" msgid "Nov" msgstr "Ноя" #: kdecore/kcalendarsystemjulian.cpp:256 #, kde-format msgctxt "Julian month 12 - KLocale::ShortName" msgid "Dec" msgstr "Дек" #: kdecore/kcalendarsystemjulian.cpp:265 #, kde-format msgctxt "Julian month 1 - KLocale::LongName Possessive" msgid "of January" msgstr "января" #: kdecore/kcalendarsystemjulian.cpp:267 #, kde-format msgctxt "Julian month 2 - KLocale::LongName Possessive" msgid "of February" msgstr "февраля" #: kdecore/kcalendarsystemjulian.cpp:269 #, kde-format msgctxt "Julian month 3 - KLocale::LongName Possessive" msgid "of March" msgstr "марта" #: kdecore/kcalendarsystemjulian.cpp:271 #, kde-format msgctxt "Julian month 4 - KLocale::LongName Possessive" msgid "of April" msgstr "апреля" #: kdecore/kcalendarsystemjulian.cpp:273 #, kde-format msgctxt "Julian month 5 - KLocale::LongName Possessive" msgid "of May" msgstr "мая" #: kdecore/kcalendarsystemjulian.cpp:275 #, kde-format msgctxt "Julian month 6 - KLocale::LongName Possessive" msgid "of June" msgstr "июня" #: kdecore/kcalendarsystemjulian.cpp:277 #, kde-format msgctxt "Julian month 7 - KLocale::LongName Possessive" msgid "of July" msgstr "июля" #: kdecore/kcalendarsystemjulian.cpp:279 #, kde-format msgctxt "Julian month 8 - KLocale::LongName Possessive" msgid "of August" msgstr "августа" #: kdecore/kcalendarsystemjulian.cpp:281 #, kde-format msgctxt "Julian month 9 - KLocale::LongName Possessive" msgid "of September" msgstr "сентября" #: kdecore/kcalendarsystemjulian.cpp:283 #, kde-format msgctxt "Julian month 10 - KLocale::LongName Possessive" msgid "of October" msgstr "октября" #: kdecore/kcalendarsystemjulian.cpp:285 #, kde-format msgctxt "Julian month 11 - KLocale::LongName Possessive" msgid "of November" msgstr "ноября" #: kdecore/kcalendarsystemjulian.cpp:287 #, kde-format msgctxt "Julian month 12 - KLocale::LongName Possessive" msgid "of December" msgstr "декабря" #: kdecore/kcalendarsystemjulian.cpp:296 #, kde-format msgctxt "Julian month 1 - KLocale::LongName" msgid "January" msgstr "Январь" #: kdecore/kcalendarsystemjulian.cpp:298 #, kde-format msgctxt "Julian month 2 - KLocale::LongName" msgid "February" msgstr "Февраль" #: kdecore/kcalendarsystemjulian.cpp:300 #, kde-format msgctxt "Julian month 3 - KLocale::LongName" msgid "March" msgstr "Март" #: kdecore/kcalendarsystemjulian.cpp:302 #, kde-format msgctxt "Julian month 4 - KLocale::LongName" msgid "April" msgstr "Апрель" #: kdecore/kcalendarsystemjulian.cpp:304 #, kde-format msgctxt "Julian month 5 - KLocale::LongName" msgid "May" msgstr "Май" #: kdecore/kcalendarsystemjulian.cpp:306 #, kde-format msgctxt "Julian month 6 - KLocale::LongName" msgid "June" msgstr "Июнь" #: kdecore/kcalendarsystemjulian.cpp:308 #, kde-format msgctxt "Julian month 7 - KLocale::LongName" msgid "July" msgstr "Июль" #: kdecore/kcalendarsystemjulian.cpp:310 #, kde-format msgctxt "Julian month 8 - KLocale::LongName" msgid "August" msgstr "Август" #: kdecore/kcalendarsystemjulian.cpp:312 #, kde-format msgctxt "Julian month 9 - KLocale::LongName" msgid "September" msgstr "Сентябрь" #: kdecore/kcalendarsystemjulian.cpp:314 #, kde-format msgctxt "Julian month 10 - KLocale::LongName" msgid "October" msgstr "Октябрь" #: kdecore/kcalendarsystemjulian.cpp:316 #, kde-format msgctxt "Julian month 11 - KLocale::LongName" msgid "November" msgstr "Ноябрь" #: kdecore/kcalendarsystemjulian.cpp:318 #, kde-format msgctxt "Julian month 12 - KLocale::LongName" msgid "December" msgstr "Декабрь" #: kdecore/kcalendarsystemjulian.cpp:331 #, kde-format msgctxt "Julian weekday 1 - KLocale::NarrowName " msgid "M" msgstr "п" #: kdecore/kcalendarsystemjulian.cpp:333 #, kde-format msgctxt "Julian weekday 2 - KLocale::NarrowName " msgid "T" msgstr "в" #: kdecore/kcalendarsystemjulian.cpp:335 #, kde-format msgctxt "Julian weekday 3 - KLocale::NarrowName " msgid "W" msgstr "с" #: kdecore/kcalendarsystemjulian.cpp:337 #, kde-format msgctxt "Julian weekday 4 - KLocale::NarrowName " msgid "T" msgstr "ч" #: kdecore/kcalendarsystemjulian.cpp:339 #, kde-format msgctxt "Julian weekday 5 - KLocale::NarrowName " msgid "F" msgstr "п" #: kdecore/kcalendarsystemjulian.cpp:341 #, kde-format msgctxt "Julian weekday 6 - KLocale::NarrowName " msgid "S" msgstr "с" #: kdecore/kcalendarsystemjulian.cpp:343 #, kde-format msgctxt "Julian weekday 7 - KLocale::NarrowName " msgid "S" msgstr "в" #: kdecore/kcalendarsystemjulian.cpp:352 #, kde-format msgctxt "Julian weekday 1 - KLocale::ShortName" msgid "Mon" msgstr "Пн" #: kdecore/kcalendarsystemjulian.cpp:354 #, kde-format msgctxt "Julian weekday 2 - KLocale::ShortName" msgid "Tue" msgstr "Вт" #: kdecore/kcalendarsystemjulian.cpp:356 #, kde-format msgctxt "Julian weekday 3 - KLocale::ShortName" msgid "Wed" msgstr "Ср" #: kdecore/kcalendarsystemjulian.cpp:358 #, kde-format msgctxt "Julian weekday 4 - KLocale::ShortName" msgid "Thu" msgstr "Чт" #: kdecore/kcalendarsystemjulian.cpp:360 #, kde-format msgctxt "Julian weekday 5 - KLocale::ShortName" msgid "Fri" msgstr "Пт" #: kdecore/kcalendarsystemjulian.cpp:362 #, kde-format msgctxt "Julian weekday 6 - KLocale::ShortName" msgid "Sat" msgstr "Сб" #: kdecore/kcalendarsystemjulian.cpp:364 #, kde-format msgctxt "Julian weekday 7 - KLocale::ShortName" msgid "Sun" msgstr "Вс" #: kdecore/kcalendarsystemjulian.cpp:371 #, kde-format msgctxt "Julian weekday 1 - KLocale::LongName" msgid "Monday" msgstr "Понедельник" #: kdecore/kcalendarsystemjulian.cpp:373 #, kde-format msgctxt "Julian weekday 2 - KLocale::LongName" msgid "Tuesday" msgstr "Вторник" #: kdecore/kcalendarsystemjulian.cpp:375 #, kde-format msgctxt "Julian weekday 3 - KLocale::LongName" msgid "Wednesday" msgstr "Среда" #: kdecore/kcalendarsystemjulian.cpp:377 #, kde-format msgctxt "Julian weekday 4 - KLocale::LongName" msgid "Thursday" msgstr "Четверг" #: kdecore/kcalendarsystemjulian.cpp:379 #, kde-format msgctxt "Julian weekday 5 - KLocale::LongName" msgid "Friday" msgstr "Пятница" #: kdecore/kcalendarsystemjulian.cpp:381 #, kde-format msgctxt "Julian weekday 6 - KLocale::LongName" msgid "Saturday" msgstr "Суббота" #: kdecore/kcalendarsystemjulian.cpp:383 #, kde-format msgctxt "Julian weekday 7 - KLocale::LongName" msgid "Sunday" msgstr "Воскресенье" #: kdecore/kcalendarsystemminguo.cpp:57 #, kde-format msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" msgid "Republic of China Era" msgstr "эры Китайской Республики (Тайвань)" #: kdecore/kcalendarsystemminguo.cpp:58 #, kde-format msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" msgid "ROC" msgstr "эры КР" #: kdecore/kcalendarsystemminguo.cpp:59 #, kde-format msgctxt "" "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" msgid "%EC %Ey" msgstr "%Ey г. %EC" #: kdecore/kcalendarsystemthai.cpp:58 #, kde-format msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" msgid "Buddhist Era" msgstr "буддийской эры" #: kdecore/kcalendarsystemthai.cpp:59 #, kde-format msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" msgid "BE" msgstr "б. э." #: kdecore/kcalendarsystemthai.cpp:60 #, kde-format msgctxt "" "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" msgid "%Ey %EC" msgstr "%Ey г. %EC" #: kdecore/kcmdlineargs.cpp:278 #, kde-format msgid "Use the X-server display 'displayname'" msgstr "Использовать дисплей X-сервера «displayname»" #: kdecore/kcmdlineargs.cpp:281 #, kde-format msgid "Restore the application for the given 'sessionId'" msgstr "Восстановить сеанс приложения по ключу «sessionId»" #: kdecore/kcmdlineargs.cpp:282 #, kde-format msgid "" "Causes the application to install a private color\n" "map on an 8-bit display" msgstr "" "В случае 8-битного дисплея приложение\n" "будет использовать собственную таблицу\n" "цветов" #: kdecore/kcmdlineargs.cpp:283 #, kde-format msgid "" "Limits the number of colors allocated in the color\n" "cube on an 8-bit display, if the application is\n" "using the QApplication::ManyColor color\n" "specification" msgstr "" "Ограничить количество используемых \n" "цветов на 8-битном дисплее. Этот параметр \n" "работает только для приложений, \n" "использующих режим\n" "QApplication::ManyColor." #: kdecore/kcmdlineargs.cpp:284 #, kde-format msgid "tells Qt to never grab the mouse or the keyboard" msgstr "Запрещает Qt перехватывать мышь или клавиатуру" #: kdecore/kcmdlineargs.cpp:285 #, kde-format msgid "" "running under a debugger can cause an implicit\n" "-nograb, use -dograb to override" msgstr "" "при запуске в отладчике применять\n" "-nograb. Используйте -dograb, чтобы явно включить этот режим" #: kdecore/kcmdlineargs.cpp:286 #, kde-format msgid "switches to synchronous mode for debugging" msgstr "включает синхронный режим для отладки" #: kdecore/kcmdlineargs.cpp:288 #, kde-format msgid "defines the application font" msgstr "определяет шрифт приложения" #: kdecore/kcmdlineargs.cpp:290 #, kde-format msgid "" "sets the default background color and an\n" "application palette (light and dark shades are\n" "calculated)" msgstr "" "задаёт цвет фона по умолчанию и палитру\n" "приложения (светлые и тёмные тени\n" "вычисляются)." #: kdecore/kcmdlineargs.cpp:292 #, kde-format msgid "sets the default foreground color" msgstr "определяет цвет текста по умолчанию" #: kdecore/kcmdlineargs.cpp:294 #, kde-format msgid "sets the default button color" msgstr "определяет цвет кнопок по умолчанию" #: kdecore/kcmdlineargs.cpp:295 #, kde-format msgid "sets the application name" msgstr "определяет имя приложения" #: kdecore/kcmdlineargs.cpp:296 #, kde-format msgid "sets the application title (caption)" msgstr "устанавливает заголовок приложения" #: kdecore/kcmdlineargs.cpp:297 #, kde-format msgid "load the testability framework" msgstr "загрузить тестовое окружение" #: kdecore/kcmdlineargs.cpp:299 #, kde-format msgid "" "forces the application to use a TrueColor visual on\n" "an 8-bit display" msgstr "" "Приложение будет работать с 8-битным\n" "дисплеем как с полноцветным устройством." #: kdecore/kcmdlineargs.cpp:300 #, kde-format msgid "" "sets XIM (X Input Method) input style. Possible\n" "values are onthespot, overthespot, offthespot and\n" "root" msgstr "" "Устанавливает тип ввода XIM (X Input Method).\n" "Возможные значения: onthespot, overthespot, offthespot и \n" "root." #: kdecore/kcmdlineargs.cpp:301 #, kde-format msgid "set XIM server" msgstr "устанавливает сервер XIM" #: kdecore/kcmdlineargs.cpp:302 #, kde-format msgid "disable XIM" msgstr "запретить XIM" #: kdecore/kcmdlineargs.cpp:304 #, kde-format msgid "mirrors the whole layout of widgets" msgstr "отразить расположение виджетов" #: kdecore/kcmdlineargs.cpp:305 #, kde-format msgid "applies the Qt stylesheet to the application widgets" msgstr "применяет стиль Qt к графическим элементам приложения" #: kdecore/kcmdlineargs.cpp:306 #, kde-format msgid "" "use a different graphics system instead of the default one, options are " "raster and opengl (experimental)" msgstr "" "использовать указанную графическую подсистему для эффектов: raster или opengl" #: kdecore/kcmdlineargs.cpp:307 #, kde-format msgid "" "QML JS debugger information. Application must be\n" "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" "enabled" msgstr "" "Отладочная информация QML JS. Для включения\n" "отладчика приложение должно быть собрано с ключом\n" "-DQT_DECLARATIVE_DEBUG" #: kdecore/kcmdlineargs.cpp:308 #, kde-format msgid "The windowing system platform (e.g. xcb or wayland)" msgstr "Платформа графического сервера (например, xcb или wayland)" #: kdecore/kcmdlineargs.cpp:310 #, kde-format msgid "Use 'caption' as name in the titlebar" msgstr "Использовать имя «caption» в заголовке" #: kdecore/kcmdlineargs.cpp:311 #, kde-format msgid "Use 'icon' as the application icon" msgstr "Использовать «icon» как значок приложения" #: kdecore/kcmdlineargs.cpp:312 #, kde-format msgid "Use alternative configuration file" msgstr "Использовать альтернативный файл конфигурации" #: kdecore/kcmdlineargs.cpp:313 #, kde-format msgid "Disable crash handler, to get core dumps" msgstr "" "Отключить обработчик сбоев. Это позволит в случае сбоя получить core dump." #: kdecore/kcmdlineargs.cpp:315 #, kde-format msgid "Waits for a WM_NET compatible windowmanager" msgstr "Ожидать инициализации WM_NET-совместимого оконного менеджера" #: kdecore/kcmdlineargs.cpp:317 #, kde-format msgid "sets the application GUI style" msgstr "устанавливает стиль графического интерфейса приложения" #: kdecore/kcmdlineargs.cpp:318 #, kde-format msgid "" "sets the client geometry of the main widget - see man X for the argument " "format (usually WidthxHeight+XPos+YPos)" msgstr "" "устанавливает положение и размер главного окна приложения - формат аргумента " "см. в man X (обычно это ШИРИНА×ВЫСОТА+X+Y)" #: kdecore/kcmdlineargs.cpp:436 #, kde-format msgid "KDE Application" msgstr "Приложение KDE" #: kdecore/kcmdlineargs.cpp:497 #, kde-format msgid "Qt" msgstr "Qt" #: kdecore/kcmdlineargs.cpp:500 #, kde-format msgid "KDE" msgstr "KDE" #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 #, kde-format msgid "Unknown option '%1'." msgstr "Неизвестный параметр «%1»." #: kdecore/kcmdlineargs.cpp:841 #, kde-format msgctxt "@info:shell %1 is cmdoption name" msgid "'%1' missing." msgstr "Отсутствует %1." #: kdecore/kcmdlineargs.cpp:895 #, kde-format msgctxt "" "@info:shell message on appcmd --version; do not translate 'Development " "Platform'%3 application name, other %n version strings" msgid "" "Qt: %1\n" "KDE Frameworks: %2\n" "%3: %4\n" msgstr "" "Qt: %1\n" "KDE Frameworks: %2\n" "%3: %4\n" #: kdecore/kcmdlineargs.cpp:921 #, kde-format msgctxt "the 2nd argument is a list of name+address, one on each line" msgid "" "%1 was written by\n" "%2" msgstr "" "%1 написали:\n" "%2" #: kdecore/kcmdlineargs.cpp:924 #, kde-format msgid "This application was written by somebody who wants to remain anonymous." msgstr "Автор программы пожелал остаться неизвестным." #: kdecore/kcmdlineargs.cpp:929 #, kde-format msgid "Please use http://bugs.kde.org to report bugs.\n" msgstr "Используйте http://bugs.kde.org для отправки сообщений об ошибках.\n" #: kdecore/kcmdlineargs.cpp:931 #, kde-format msgid "Please report bugs to %1.\n" msgstr "Используйте %1 для отправки сообщений об ошибках.\n" #: kdecore/kcmdlineargs.cpp:961 #, kde-format msgid "Unexpected argument '%1'." msgstr "Недопустимый аргумент «%1»." #: kdecore/kcmdlineargs.cpp:1074 #, kde-format msgid "Use --help to get a list of available command line options." msgstr "Используйте --help для вывода списка доступных параметров." #: kdecore/kcmdlineargs.cpp:1096 #, kde-format msgid "[options] " msgstr "[параметры] " #: kdecore/kcmdlineargs.cpp:1101 #, kde-format msgid "[%1-options]" msgstr "[параметры %1]" #: kdecore/kcmdlineargs.cpp:1122 #, kde-format msgid "Usage: %1 %2\n" msgstr "Использование: %1 %2\n" #: kdecore/kcmdlineargs.cpp:1125 #, kde-format msgid "" "\n" "Generic options:\n" msgstr "" "\n" "Общие параметры:\n" #: kdecore/kcmdlineargs.cpp:1127 #, kde-format msgid "Show help about options" msgstr "Показать справку о параметрах." #: kdecore/kcmdlineargs.cpp:1133 #, kde-format msgid "Show %1 specific options" msgstr "Показать специфические параметры %1." #: kdecore/kcmdlineargs.cpp:1140 #, kde-format msgid "Show all options" msgstr "Показать список всех параметров." #: kdecore/kcmdlineargs.cpp:1141 #, kde-format msgid "Show author information" msgstr "Показать сведения об авторе." #: kdecore/kcmdlineargs.cpp:1142 #, kde-format msgid "Show version information" msgstr "Показать сведения о версии." #: kdecore/kcmdlineargs.cpp:1143 #, kde-format msgid "Show license information" msgstr "Показать сведения о лицензии." #: kdecore/kcmdlineargs.cpp:1144 #, kde-format msgid "End of options" msgstr "Конец параметров." #: kdecore/kcmdlineargs.cpp:1164 #, kde-format msgid "" "\n" "%1 options:\n" msgstr "" "\n" "Параметры %1:\n" #: kdecore/kcmdlineargs.cpp:1166 #, kde-format msgid "" "\n" "Options:\n" msgstr "" "\n" "Параметры:\n" #: kdecore/kcmdlineargs.cpp:1219 #, kde-format msgid "" "\n" "Arguments:\n" msgstr "" "\n" "Аргументы:\n" #: kdecore/kcmdlineargs.cpp:1580 #, kde-format msgid "The files/URLs opened by the application will be deleted after use" msgstr "" "Файлы или ссылки, открытые приложением, будут удалены после использования" #: kdecore/kcmdlineargs.cpp:1581 #, kde-format msgid "KDE-tempfile" msgstr "KDE-tempfile" #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 #: kdecore/kdatetime.cpp:2985 #, kde-format msgid "am" msgstr "д.п." #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 #: kdecore/kdatetime.cpp:2990 #, kde-format msgid "pm" msgstr "п.п." #: kdecore/klibloader.cpp:101 #, kde-format msgid "Library \"%1\" not found" msgstr "Библиотека «%1» не найдена" #: kdecore/klocale_kde.cpp:785 #, kde-format msgctxt "digit set" msgid "Arabic-Indic" msgstr "Арабские цифры, используемые в арабских странах" #: kdecore/klocale_kde.cpp:788 #, kde-format msgctxt "digit set" msgid "Bengali" msgstr "Бенгальские цифры" #: kdecore/klocale_kde.cpp:791 #, kde-format msgctxt "digit set" msgid "Devanagari" msgstr "Цифры деванагари" #: kdecore/klocale_kde.cpp:794 #, kde-format msgctxt "digit set" msgid "Eastern Arabic-Indic" msgstr "Персидские цифры" #: kdecore/klocale_kde.cpp:797 #, kde-format msgctxt "digit set" msgid "Gujarati" msgstr "Цифры гуджарати" #: kdecore/klocale_kde.cpp:800 #, kde-format msgctxt "digit set" msgid "Gurmukhi" msgstr "Цифры гурмукхи" #: kdecore/klocale_kde.cpp:803 #, kde-format msgctxt "digit set" msgid "Kannada" msgstr "Цифры каннада" #: kdecore/klocale_kde.cpp:806 #, kde-format msgctxt "digit set" msgid "Khmer" msgstr "Кхмерские цифры" #: kdecore/klocale_kde.cpp:809 #, kde-format msgctxt "digit set" msgid "Malayalam" msgstr "Цифры малаялам" #: kdecore/klocale_kde.cpp:812 #, kde-format msgctxt "digit set" msgid "Oriya" msgstr "Цифры ория" #: kdecore/klocale_kde.cpp:815 #, kde-format msgctxt "digit set" msgid "Tamil" msgstr "Тамильские цифры" #: kdecore/klocale_kde.cpp:818 #, kde-format msgctxt "digit set" msgid "Telugu" msgstr "Цифры телугу" #: kdecore/klocale_kde.cpp:821 #, kde-format msgctxt "digit set" msgid "Thai" msgstr "Тайские цифры" #: kdecore/klocale_kde.cpp:824 #, kde-format msgctxt "digit set" msgid "Arabic" msgstr "Арабские цифры" #: kdecore/klocale_kde.cpp:829 #, kde-format msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" msgid "%1 (%2)" msgstr "%1 (%2)" #. i18n: comments below, they are used by the #. translators. #. This prefix is shared by all current dialects. #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1327 #, kde-format msgctxt "size in bytes" msgid "%1 B" msgstr "%1 Б" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1332 #, kde-format msgctxt "size in 1000 bytes" msgid "%1 kB" msgstr "%1 КБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1334 #, kde-format msgctxt "size in 10^6 bytes" msgid "%1 MB" msgstr "%1 МБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1336 #, kde-format msgctxt "size in 10^9 bytes" msgid "%1 GB" msgstr "%1 ГБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1338 #, kde-format msgctxt "size in 10^12 bytes" msgid "%1 TB" msgstr "%1 ТБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1340 #, kde-format msgctxt "size in 10^15 bytes" msgid "%1 PB" msgstr "%1 ПБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1342 #, kde-format msgctxt "size in 10^18 bytes" msgid "%1 EB" msgstr "%1 ЭБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1344 #, kde-format msgctxt "size in 10^21 bytes" msgid "%1 ZB" msgstr "%1 ЗБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1346 #, kde-format msgctxt "size in 10^24 bytes" msgid "%1 YB" msgstr "%1 ЙБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1351 #, kde-format msgctxt "memory size in 1024 bytes" msgid "%1 KB" msgstr "%1 КБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1353 #, kde-format msgctxt "memory size in 2^20 bytes" msgid "%1 MB" msgstr "%1 МБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1355 #, kde-format msgctxt "memory size in 2^30 bytes" msgid "%1 GB" msgstr "%1 ГБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1357 #, kde-format msgctxt "memory size in 2^40 bytes" msgid "%1 TB" msgstr "%1 ТБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1359 #, kde-format msgctxt "memory size in 2^50 bytes" msgid "%1 PB" msgstr "%1 ПБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1361 #, kde-format msgctxt "memory size in 2^60 bytes" msgid "%1 EB" msgstr "%1 ЭБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1363 #, kde-format msgctxt "memory size in 2^70 bytes" msgid "%1 ZB" msgstr "%1 ЗБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1365 #, kde-format msgctxt "memory size in 2^80 bytes" msgid "%1 YB" msgstr "%1 ЙБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1371 #, kde-format msgctxt "size in 1024 bytes" msgid "%1 KiB" msgstr "%1 КиБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1373 #, kde-format msgctxt "size in 2^20 bytes" msgid "%1 MiB" msgstr "%1 МиБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1375 #, kde-format msgctxt "size in 2^30 bytes" msgid "%1 GiB" msgstr "%1 ГиБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1377 #, kde-format msgctxt "size in 2^40 bytes" msgid "%1 TiB" msgstr "%1 ТиБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1379 #, kde-format msgctxt "size in 2^50 bytes" msgid "%1 PiB" msgstr "%1 ПиБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1381 #, kde-format msgctxt "size in 2^60 bytes" msgid "%1 EiB" msgstr "%1 ЭиБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1383 #, kde-format msgctxt "size in 2^70 bytes" msgid "%1 ZiB" msgstr "%1 ЗиБ" #. i18n: Dumb message, avoid any markup or scripting. #: kdecore/klocale_kde.cpp:1385 #, kde-format msgctxt "size in 2^80 bytes" msgid "%1 YiB" msgstr "%1 ЙиБ" #: kdecore/klocale_kde.cpp:1472 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" msgid "%1 days" msgstr "%1 дня" #: kdecore/klocale_kde.cpp:1475 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" msgid "%1 hours" msgstr "%1 часа" #: kdecore/klocale_kde.cpp:1478 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" msgid "%1 minutes" msgstr "%1 минуты" #: kdecore/klocale_kde.cpp:1481 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" msgid "%1 seconds" msgstr "%1 секунды" #: kdecore/klocale_kde.cpp:1484 #, kde-format msgctxt "@item:intext" msgid "%1 millisecond" msgid_plural "%1 milliseconds" msgstr[0] "%1 миллисекунда" msgstr[1] "%1 миллисекунды" msgstr[2] "%1 миллисекунд" msgstr[3] "%1 миллисекунда" #: kdecore/klocale_kde.cpp:1491 #, kde-format msgctxt "@item:intext" msgid "1 day" msgid_plural "%1 days" msgstr[0] "%1 день" msgstr[1] "%1 дня" msgstr[2] "%1 дней" msgstr[3] "%1 день" #: kdecore/klocale_kde.cpp:1493 #, kde-format msgctxt "@item:intext" msgid "1 hour" msgid_plural "%1 hours" msgstr[0] "%1 час" msgstr[1] "%1 часа" msgstr[2] "%1 часов" msgstr[3] "%1 час" #: kdecore/klocale_kde.cpp:1495 #, kde-format msgctxt "@item:intext" msgid "1 minute" msgid_plural "%1 minutes" msgstr[0] "%1 минута" msgstr[1] "%1 минуты" msgstr[2] "%1 минут" msgstr[3] "%1 минута" #: kdecore/klocale_kde.cpp:1497 #, kde-format msgctxt "@item:intext" msgid "1 second" msgid_plural "%1 seconds" msgstr[0] "%1 секунда" msgstr[1] "%1 секунды" msgstr[2] "%1 секунд" msgstr[3] "%1 секунда" #: kdecore/klocale_kde.cpp:1521 #, kde-format msgctxt "" "@item:intext days and hours. This uses the previous item:intext messages. If " "this does not fit the grammar of your language please contact the i18n team " "to solve the problem" msgid "%1 and %2" msgstr "%1 %2" #: kdecore/klocale_kde.cpp:1527 #, kde-format msgctxt "" "@item:intext hours and minutes. This uses the previous item:intext messages. " "If this does not fit the grammar of your language please contact the i18n " "team to solve the problem" msgid "%1 and %2" msgstr "%1 %2" #: kdecore/klocale_kde.cpp:1534 #, kde-format msgctxt "" "@item:intext minutes and seconds. This uses the previous item:intext " "messages. If this does not fit the grammar of your language please contact " "the i18n team to solve the problem" msgid "%1 and %2" msgstr "%1 %2" #: kdecore/klocale_kde.cpp:2153 #, kde-format msgctxt "Before Noon KLocale::LongName" msgid "Ante Meridiem" msgstr "до полудня" #: kdecore/klocale_kde.cpp:2154 #, kde-format msgctxt "Before Noon KLocale::ShortName" msgid "AM" msgstr "д.п." #: kdecore/klocale_kde.cpp:2155 #, kde-format msgctxt "Before Noon KLocale::NarrowName" msgid "A" msgstr "д." #: kdecore/klocale_kde.cpp:2158 #, kde-format msgctxt "After Noon KLocale::LongName" msgid "Post Meridiem" msgstr "после полудня" #: kdecore/klocale_kde.cpp:2159 #, kde-format msgctxt "After Noon KLocale::ShortName" msgid "PM" msgstr "п.п." #: kdecore/klocale_kde.cpp:2160 #, kde-format msgctxt "After Noon KLocale::NarrowName" msgid "P" msgstr "п." #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 #, kde-format msgctxt "concatenation of dates and time" msgid "%1 %2" msgstr "%1 %2" #: kdecore/klocale_kde.cpp:2267 #, kde-format msgctxt "concatenation of date/time and time zone" msgid "%1 %2" msgstr "%1 %2" #: kdecore/ksavefile.cpp:99 #, kde-format msgid "No target filename has been given." msgstr "Не указан целевой файл." #: kdecore/ksavefile.cpp:106 #, kde-format msgid "Already opened." msgstr "Файл уже открыт." #: kdecore/ksavefile.cpp:135 #, kde-format msgid "Insufficient permissions in target directory." msgstr "Недостаточно прав для записи в целевую папку." #: kdecore/ksavefile.cpp:139 #, kde-format msgid "Unable to open temporary file." msgstr "Не удалось открыть временный файл." #: kdecore/ksavefile.cpp:249 #, kde-format msgid "Synchronization to disk failed" msgstr "Не удалось записать буферы операционной системы на диск." #: kdecore/ksavefile.cpp:280 #, kde-format msgid "Error during rename." msgstr "Не удалось переименовать файл." #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 #, kde-format msgid "Timed out trying to connect to remote host" msgstr "Истекло время ожидания ответа от удалённого узла" #: kdecore/netsupp.cpp:869 #, kde-format msgid "address family for nodename not supported" msgstr "семейство адресов для не поддерживается для данного nodename" #: kdecore/netsupp.cpp:871 #, kde-format msgid "invalid value for 'ai_flags'" msgstr "неверное значение для «ai_flags»" #: kdecore/netsupp.cpp:873 #, kde-format msgid "'ai_family' not supported" msgstr "семейство «ai_family» не поддерживается" #: kdecore/netsupp.cpp:875 #, kde-format msgid "no address associated with nodename" msgstr "с данным узлом (nodename) не связан никакой адрес" #: kdecore/netsupp.cpp:877 #, kde-format msgid "servname not supported for ai_socktype" msgstr "servname не поддерживается для типа ai_socktype" #: kdecore/netsupp.cpp:878 #, kde-format msgid "'ai_socktype' not supported" msgstr "тип «ai_socktype» не поддерживается" #: kdecore/netsupp.cpp:879 #, kde-format msgid "system error" msgstr "системная ошибка" #: kdecore/qtest_kde.h:82 kdecore/qtest_kde.h:133 #, kde-format msgid "KDE Test Program" msgstr "Тестовая программа KDE" #: kdecore/TIMEZONES:1 #, kde-format msgid "Africa/Abidjan" msgstr "Африка/Абиджан" #: kdecore/TIMEZONES:2 #, kde-format msgid "Africa/Accra" msgstr "Африка/Аккра" #: kdecore/TIMEZONES:3 #, kde-format msgid "Africa/Addis_Ababa" msgstr "Африка/Аддис-Абеба" #: kdecore/TIMEZONES:4 #, kde-format msgid "Africa/Algiers" msgstr "Африка/Алжир" #: kdecore/TIMEZONES:5 #, kde-format msgid "Africa/Asmara" msgstr "Африка/Асмара" #: kdecore/TIMEZONES:6 #, kde-format msgid "Africa/Asmera" msgstr "Африка/Асмара" #: kdecore/TIMEZONES:7 #, kde-format msgid "Africa/Bamako" msgstr "Африка/Бамако" #: kdecore/TIMEZONES:8 #, kde-format msgid "Africa/Bangui" msgstr "Африка/Банги" #: kdecore/TIMEZONES:9 #, kde-format msgid "Africa/Banjul" msgstr "Африка/Банжул" #: kdecore/TIMEZONES:10 #, kde-format msgid "Africa/Bissau" msgstr "Африка/Бисау" #: kdecore/TIMEZONES:11 #, kde-format msgid "Africa/Blantyre" msgstr "Африка/Блантир" #: kdecore/TIMEZONES:12 #, kde-format msgid "Africa/Brazzaville" msgstr "Африка/Браззавиль" #: kdecore/TIMEZONES:13 #, kde-format msgid "Africa/Bujumbura" msgstr "Африка/Бужумбура" #: kdecore/TIMEZONES:14 #, kde-format msgid "Africa/Cairo" msgstr "Африка/Каир" #: kdecore/TIMEZONES:15 #, kde-format msgid "Africa/Casablanca" msgstr "Африка/Касабланка" #: kdecore/TIMEZONES:16 #, kde-format msgid "Africa/Ceuta" msgstr "Африка/Сеута" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:18 #, kde-format msgid "Ceuta & Melilla" msgstr "Сеута и Мелилья" #: kdecore/TIMEZONES:19 #, kde-format msgid "Africa/Conakry" msgstr "Африка/Конакри" #: kdecore/TIMEZONES:20 #, kde-format msgid "Africa/Dakar" msgstr "Африка/Дакар" #: kdecore/TIMEZONES:21 #, kde-format msgid "Africa/Dar_es_Salaam" msgstr "Африка/Дар-эс-Салам" #: kdecore/TIMEZONES:22 #, kde-format msgid "Africa/Djibouti" msgstr "Африка/Джибути" #: kdecore/TIMEZONES:23 #, kde-format msgid "Africa/Douala" msgstr "Африка/Дуала" #: kdecore/TIMEZONES:24 #, kde-format msgid "Africa/El_Aaiun" msgstr "Африка/Эль-Ааиун" #: kdecore/TIMEZONES:25 #, kde-format msgid "Africa/Freetown" msgstr "Африка/Фритаун" #: kdecore/TIMEZONES:26 #, kde-format msgid "Africa/Gaborone" msgstr "Африка/Габороне" #: kdecore/TIMEZONES:27 #, kde-format msgid "Africa/Harare" msgstr "Африка/Хараре" #: kdecore/TIMEZONES:28 #, kde-format msgid "Africa/Johannesburg" msgstr "Африка/Йоханнесбург" #: kdecore/TIMEZONES:29 #, kde-format msgid "Africa/Juba" msgstr "Африка/Джуба" #: kdecore/TIMEZONES:30 #, kde-format msgid "Africa/Kampala" msgstr "Африка/Кампала" #: kdecore/TIMEZONES:31 #, kde-format msgid "Africa/Khartoum" msgstr "Африка/Хартум" #: kdecore/TIMEZONES:32 #, kde-format msgid "Africa/Kigali" msgstr "Африка/Кигали" #: kdecore/TIMEZONES:33 #, kde-format msgid "Africa/Kinshasa" msgstr "Африка/Киншаса" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:35 #, kde-format msgid "west Dem. Rep. of Congo" msgstr "Запад Демократической республики Конго" #: kdecore/TIMEZONES:36 #, kde-format msgid "Africa/Lagos" msgstr "Африка/Лагос" #: kdecore/TIMEZONES:37 #, kde-format msgid "Africa/Libreville" msgstr "Африка/Либревиль" #: kdecore/TIMEZONES:38 #, kde-format msgid "Africa/Lome" msgstr "Африка/Ломе" #: kdecore/TIMEZONES:39 #, kde-format msgid "Africa/Luanda" msgstr "Африка/Луанда" #: kdecore/TIMEZONES:40 #, kde-format msgid "Africa/Lubumbashi" msgstr "Африка/Лубумбаши" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:42 #, kde-format msgid "east Dem. Rep. of Congo" msgstr "Восток Демократической республики Конго" #: kdecore/TIMEZONES:43 #, kde-format msgid "Africa/Lusaka" msgstr "Африка/Лусака" #: kdecore/TIMEZONES:44 #, kde-format msgid "Africa/Malabo" msgstr "Африка/Малабо" #: kdecore/TIMEZONES:45 #, kde-format msgid "Africa/Maputo" msgstr "Африка/Мапуту" #: kdecore/TIMEZONES:46 #, kde-format msgid "Africa/Maseru" msgstr "Африка/Масеру" #: kdecore/TIMEZONES:47 #, kde-format msgid "Africa/Mbabane" msgstr "Африка/Мбабане" #: kdecore/TIMEZONES:48 #, kde-format msgid "Africa/Mogadishu" msgstr "Африка/Могадишо" #: kdecore/TIMEZONES:49 #, kde-format msgid "Africa/Monrovia" msgstr "Африка/Монровия" #: kdecore/TIMEZONES:50 #, kde-format msgid "Africa/Nairobi" msgstr "Африка/Найроби" #: kdecore/TIMEZONES:51 #, kde-format msgid "Africa/Ndjamena" msgstr "Африка/Нджамена" #: kdecore/TIMEZONES:52 #, kde-format msgid "Africa/Niamey" msgstr "Африка/Ниамей" #: kdecore/TIMEZONES:53 #, kde-format msgid "Africa/Nouakchott" msgstr "Африка/Нуакшот" #: kdecore/TIMEZONES:54 #, kde-format msgid "Africa/Ouagadougou" msgstr "Африка/Уагадугу" #: kdecore/TIMEZONES:55 #, kde-format msgid "Africa/Porto-Novo" msgstr "Африка/Порто-Ново" #: kdecore/TIMEZONES:56 #, kde-format msgid "Africa/Pretoria" msgstr "Африка/Претория" #: kdecore/TIMEZONES:57 #, kde-format msgid "Africa/Sao_Tome" msgstr "Африка/Сан-Томе" #: kdecore/TIMEZONES:58 #, kde-format msgid "Africa/Timbuktu" msgstr "Африка/Тимбукту" #: kdecore/TIMEZONES:59 #, kde-format msgid "Africa/Tripoli" msgstr "Африка/Триполи" #: kdecore/TIMEZONES:60 #, kde-format msgid "Africa/Tunis" msgstr "Африка/Тунис" #: kdecore/TIMEZONES:61 #, kde-format msgid "Africa/Windhoek" msgstr "Африка/Виндхук" #: kdecore/TIMEZONES:62 #, kde-format msgid "America/Adak" msgstr "Америка/Адак" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:64 kdecore/TIMEZONES:121 kdecore/TIMEZONES:1068 #, kde-format msgid "Aleutian Islands" msgstr "Алеутские острова" #: kdecore/TIMEZONES:65 #, kde-format msgid "America/Anchorage" msgstr "Америка/Анкоридж" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:67 kdecore/TIMEZONES:1065 #, kde-format msgid "Alaska Time" msgstr "Часовой пояс Аляски" #: kdecore/TIMEZONES:68 #, kde-format msgid "America/Anguilla" msgstr "Америка/Ангилья" #: kdecore/TIMEZONES:69 #, kde-format msgid "America/Antigua" msgstr "Америка/Антигуа" #: kdecore/TIMEZONES:70 #, kde-format msgid "America/Araguaina" msgstr "Америка/Арагуари" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:72 #, kde-format msgid "Tocantins" msgstr "Токантинс" #: kdecore/TIMEZONES:73 #, kde-format msgid "America/Argentina/Buenos_Aires" msgstr "Америка/Аргентина/Буэнос-Айрес" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:75 kdecore/TIMEZONES:145 #, kde-format msgid "Buenos Aires (BA, CF)" msgstr "Буэнос-Айрес (BA, CF)" #: kdecore/TIMEZONES:76 #, kde-format msgid "America/Argentina/Catamarca" msgstr "Америка/Аргентина/Катамарка" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:78 kdecore/TIMEZONES:81 kdecore/TIMEZONES:161 #, kde-format msgid "Catamarca (CT), Chubut (CH)" msgstr "Катамарка (CT), Чубут (CH)" #: kdecore/TIMEZONES:79 #, kde-format msgid "America/Argentina/ComodRivadavia" msgstr "Америка/Аргентина/Комодривадавия" #: kdecore/TIMEZONES:82 #, kde-format msgid "America/Argentina/Cordoba" msgstr "Америка/Аргентина/Кордова" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:84 kdecore/TIMEZONES:177 kdecore/TIMEZONES:419 #, kde-format msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" msgstr "большая часть (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:86 #, kde-format msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" msgstr "большая часть (CB, CC, CN, ER, FM, MN, SE, SF)" #: kdecore/TIMEZONES:87 #, kde-format msgid "America/Argentina/Jujuy" msgstr "Америка/Аргентина/Хухуи" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:89 kdecore/TIMEZONES:285 #, kde-format msgid "Jujuy (JY)" msgstr "Жужуй (JY)" #: kdecore/TIMEZONES:90 #, kde-format msgid "America/Argentina/La_Rioja" msgstr "Америка/Аргентина/Ла-Риоха" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:92 #, kde-format msgid "La Rioja (LR)" msgstr "Ла-Риоха (LR)" #: kdecore/TIMEZONES:93 #, kde-format msgid "America/Argentina/Mendoza" msgstr "Америка/Аргентина/Мендоса" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:95 kdecore/TIMEZONES:325 #, kde-format msgid "Mendoza (MZ)" msgstr "Мендоса (MZ)" #: kdecore/TIMEZONES:96 #, kde-format msgid "America/Argentina/Rio_Gallegos" msgstr "Америка/Аргентина/Рио-Гальегос" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:98 #, kde-format msgid "Santa Cruz (SC)" msgstr "Санта-Крус (SC)" #: kdecore/TIMEZONES:99 #, kde-format msgid "America/Argentina/Salta" msgstr "Америка/Аргентина/Сальта" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:101 #, kde-format msgid "(SA, LP, NQ, RN)" msgstr "(SA, LP, NQ, RN)" #: kdecore/TIMEZONES:102 #, kde-format msgid "America/Argentina/San_Juan" msgstr "Америка/Аргентина/Сан-Хуан" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:104 #, kde-format msgid "San Juan (SJ)" msgstr "Сан-Хуан (SJ)" #: kdecore/TIMEZONES:105 #, kde-format msgid "America/Argentina/San_Luis" msgstr "Америка/Аргентина/Сан-Луис" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:107 #, kde-format msgid "San Luis (SL)" msgstr "Сан Луис (SL)" #: kdecore/TIMEZONES:108 #, kde-format msgid "America/Argentina/Tucuman" msgstr "Америка/Аргентина/Тукуман" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:110 #, kde-format msgid "Tucuman (TM)" msgstr "Тукуман (TM)" #: kdecore/TIMEZONES:111 #, kde-format msgid "America/Argentina/Ushuaia" msgstr "Америка/Аргентина/Ушуая" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:113 #, kde-format msgid "Tierra del Fuego (TF)" msgstr "Огненная Земля (TF)" #: kdecore/TIMEZONES:114 #, kde-format msgid "America/Aruba" msgstr "Америка/Аруба" #: kdecore/TIMEZONES:115 #, kde-format msgid "America/Asuncion" msgstr "Америка/Асунсьон" #: kdecore/TIMEZONES:116 #, kde-format msgid "America/Atikokan" msgstr "Америка/Атикокан" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:118 kdecore/TIMEZONES:174 #, kde-format msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" msgstr "" "Стандартное восточное время — Атикокан, Онтарио и остров Саутгемптон, Нунавут" #: kdecore/TIMEZONES:119 #, kde-format msgid "America/Atka" msgstr "Америка/Атка" #: kdecore/TIMEZONES:122 #, kde-format msgid "America/Bahia" msgstr "Америка/Байя" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:124 #, kde-format msgid "Bahia" msgstr "Баия" #: kdecore/TIMEZONES:125 #, kde-format msgid "America/Bahia_Banderas" msgstr "Америка/Баия-де-Бандерас" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:127 #, kde-format msgid "Mexican Central Time - Bahia de Banderas" msgstr "Мексиканское центральное поясное время — Баия-де-Бандерас" #: kdecore/TIMEZONES:128 #, kde-format msgid "America/Barbados" msgstr "Америка/Барбадос" #: kdecore/TIMEZONES:129 #, kde-format msgid "America/Belem" msgstr "Америка/Белем" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:131 #, kde-format msgid "Amapa, E Para" msgstr "Амапа" #: kdecore/TIMEZONES:132 #, kde-format msgid "America/Belize" msgstr "Америка/Белиз" #: kdecore/TIMEZONES:133 #, kde-format msgid "America/Blanc-Sablon" msgstr "Америка/Бланк-Саблон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:135 #, kde-format msgid "Atlantic Standard Time - Quebec - Lower North Shore" msgstr "Стандартное атлантическое время — Квебек, низовье Северного Побережья" #: kdecore/TIMEZONES:136 #, kde-format msgid "America/Boa_Vista" msgstr "Америка/Боа Виста" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:138 #, kde-format msgid "Roraima" msgstr "Рорайма" #: kdecore/TIMEZONES:139 #, kde-format msgid "America/Bogota" msgstr "Америка/Богота" #: kdecore/TIMEZONES:140 #, kde-format msgid "America/Boise" msgstr "Америка/Бойсе" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:142 #, kde-format msgid "Mountain Time - south Idaho & east Oregon" msgstr "Зимнее время — южный Айдахо и восточный Орегон" #: kdecore/TIMEZONES:143 #, kde-format msgid "America/Buenos_Aires" msgstr "Америка/Буэнос-Айрес" #: kdecore/TIMEZONES:146 #, kde-format msgid "America/Calgary" msgstr "Америка/Калгари" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:148 kdecore/TIMEZONES:204 kdecore/TIMEZONES:824 #, kde-format msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" msgstr "" "Зимнее время — Альберта, восточная Британская Колумбия и западный Саскачеван" #: kdecore/TIMEZONES:149 #, kde-format msgid "America/Cambridge_Bay" msgstr "Америка/Кембридж-Бей" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:151 #, kde-format msgid "Mountain Time - west Nunavut" msgstr "Зимнее время — западный Нунавут" #: kdecore/TIMEZONES:152 #, kde-format msgid "America/Campo_Grande" msgstr "Америка/Кампо-Гранде" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:154 #, kde-format msgid "Mato Grosso do Sul" msgstr "Мату-Гросу-ду-Сул" #: kdecore/TIMEZONES:155 #, kde-format msgid "America/Cancun" msgstr "Америка/Канкун" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:157 #, kde-format msgid "Central Time - Quintana Roo" msgstr "Центральное поясное время — Кинтана-Роо" #: kdecore/TIMEZONES:158 #, kde-format msgid "America/Caracas" msgstr "Америка/Каракас" #: kdecore/TIMEZONES:159 #, kde-format msgid "America/Catamarca" msgstr "Америка/Катамарка" #: kdecore/TIMEZONES:162 #, kde-format msgid "America/Cayenne" msgstr "Америка/Кайенна" #: kdecore/TIMEZONES:163 #, kde-format msgid "America/Cayman" msgstr "Америка/Кайман" #: kdecore/TIMEZONES:164 #, kde-format msgid "America/Chicago" msgstr "Америка/Чикаго" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:166 kdecore/TIMEZONES:1074 #, kde-format msgid "Central Time" msgstr "Центральное поясное время" #: kdecore/TIMEZONES:167 #, kde-format msgid "America/Chihuahua" msgstr "Америка/Чиуауа" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:169 #, kde-format msgid "Mountain Time - Chihuahua" msgstr "Зимнее время — Чиуауа" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:171 #, kde-format msgid "Mexican Mountain Time - Chihuahua away from US border" msgstr "Мексиканское зимнее время — Чиуауа за границей США" #: kdecore/TIMEZONES:172 #, kde-format msgid "America/Coral_Harbour" msgstr "Америка/Корал-Харбор" #: kdecore/TIMEZONES:175 #, kde-format msgid "America/Cordoba" msgstr "Америка/Кордоба" #: kdecore/TIMEZONES:178 #, kde-format msgid "America/Costa_Rica" msgstr "Америка/Коста-Рика" #: kdecore/TIMEZONES:179 #, kde-format msgid "America/Creston" msgstr "Америка/Крестон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:181 #, kde-format msgid "Mountain Standard Time - Creston, British Columbia" msgstr "Стандартное зимнее время — Крестон, Британская Колумбия" #: kdecore/TIMEZONES:182 #, kde-format msgid "America/Cuiaba" msgstr "Америка/Куяба" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:184 #, kde-format msgid "Mato Grosso" msgstr "Мату-Гросу" #: kdecore/TIMEZONES:185 #, kde-format msgid "America/Curacao" msgstr "Америка/Кюрасао" #: kdecore/TIMEZONES:186 #, kde-format msgid "America/Danmarkshavn" msgstr "Америка/Денмаркшавн" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:188 #, kde-format msgid "east coast, north of Scoresbysund" msgstr "восточное побережье, север Скоресбисунда" #: kdecore/TIMEZONES:189 #, kde-format msgid "America/Dawson" msgstr "Америка/Доусон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:191 #, kde-format msgid "Pacific Time - north Yukon" msgstr "Тихоокеанское время — север Юкона" #: kdecore/TIMEZONES:192 #, kde-format msgid "America/Dawson_Creek" msgstr "Америка/Доусон-Крик" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:194 #, kde-format msgid "" "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" msgstr "" "Стандартное зимнее время — Доусон-Крик и Форт-Сент-Джон, Британская Колумбия" #: kdecore/TIMEZONES:195 #, kde-format msgid "America/Denver" msgstr "Америка/Денвер" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:197 kdecore/TIMEZONES:965 kdecore/TIMEZONES:1092 #, kde-format msgid "Mountain Time" msgstr "Зимнее время" #: kdecore/TIMEZONES:198 #, kde-format msgid "America/Detroit" msgstr "Америка/Детройт" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:200 kdecore/TIMEZONES:1089 #, kde-format msgid "Eastern Time - Michigan - most locations" msgstr "Восточное время — Мичиган (большая часть)" #: kdecore/TIMEZONES:201 #, kde-format msgid "America/Dominica" msgstr "Америка/Доминика" #: kdecore/TIMEZONES:202 #, kde-format msgid "America/Edmonton" msgstr "Америка/Эдмонтон" #: kdecore/TIMEZONES:205 #, kde-format msgid "America/Eirunepe" msgstr "Америка/Эйрунепе" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:207 #, kde-format msgid "W Amazonas" msgstr "Запад штата Амазонас" #: kdecore/TIMEZONES:208 #, kde-format msgid "America/El_Salvador" msgstr "Америка/Сальвадор" #: kdecore/TIMEZONES:209 #, kde-format msgid "America/Ensenada" msgstr "Америка/Энсенада" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:211 kdecore/TIMEZONES:303 kdecore/TIMEZONES:465 #: kdecore/TIMEZONES:950 kdecore/TIMEZONES:1095 #, kde-format msgid "Pacific Time" msgstr "Тихоокеанское время" #: kdecore/TIMEZONES:212 #, kde-format msgid "America/Fort_Wayne" msgstr "Америка/Форт_Уэйн" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:214 kdecore/TIMEZONES:247 kdecore/TIMEZONES:275 #: kdecore/TIMEZONES:1077 #, kde-format msgid "Eastern Time - Indiana - most locations" msgstr "Восточное время — Индиана (большая часть)" #: kdecore/TIMEZONES:215 #, kde-format msgid "America/Fortaleza" msgstr "Америка/Форталеза" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:217 #, kde-format msgid "NE Brazil (MA, PI, CE, RN, PB)" msgstr "Северо-восток Бразилии (MA, PI, CE, RN, PB)" #: kdecore/TIMEZONES:218 #, kde-format msgid "America/Fredericton" msgstr "Америка/Фредериктон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:220 kdecore/TIMEZONES:240 kdecore/TIMEZONES:812 #, kde-format msgid "Atlantic Time - Nova Scotia (most places), PEI" msgstr "Атлантическое время — Новая Шотландия, остров Принца Эдуарда" #: kdecore/TIMEZONES:221 #, kde-format msgid "America/Glace_Bay" msgstr "Америка/Глейс-Бей" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:223 #, kde-format msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" msgstr "" "Атлантическое время — Новая Шотландия, места, не попавшие под Акт о едином " "времени (1966)" #: kdecore/TIMEZONES:224 #, kde-format msgid "America/Godthab" msgstr "Америка/Готхоб" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:226 kdecore/TIMEZONES:428 kdecore/TIMEZONES:527 #: kdecore/TIMEZONES:691 kdecore/TIMEZONES:694 kdecore/TIMEZONES:839 #: kdecore/TIMEZONES:870 kdecore/TIMEZONES:959 kdecore/TIMEZONES:972 #: kdecore/TIMEZONES:1014 #, kde-format msgid "most locations" msgstr "большая часть" #: kdecore/TIMEZONES:227 #, kde-format msgid "America/Goose_Bay" msgstr "Америка/Гус-Бей" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:229 #, kde-format msgid "Atlantic Time - Labrador - most locations" msgstr "Атлантическое время — Лабрадор (большая часть)" #: kdecore/TIMEZONES:230 #, kde-format msgid "America/Grand_Turk" msgstr "Америка/Гранд-Терк" #: kdecore/TIMEZONES:231 #, kde-format msgid "America/Grenada" msgstr "Америка/Гренада" #: kdecore/TIMEZONES:232 #, kde-format msgid "America/Guadeloupe" msgstr "Америка/Гваделупа" #: kdecore/TIMEZONES:233 #, kde-format msgid "America/Guatemala" msgstr "Америка/Гватемала" #: kdecore/TIMEZONES:234 #, kde-format msgid "America/Guayaquil" msgstr "Америка/Гуаякиль" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:236 kdecore/TIMEZONES:873 kdecore/TIMEZONES:879 #: kdecore/TIMEZONES:1058 #, kde-format msgid "mainland" msgstr "Суша" #: kdecore/TIMEZONES:237 #, kde-format msgid "America/Guyana" msgstr "Америка/Гайана" #: kdecore/TIMEZONES:238 #, kde-format msgid "America/Halifax" msgstr "Америка/Галифакс" #: kdecore/TIMEZONES:241 #, kde-format msgid "America/Havana" msgstr "Америка/Гавана" #: kdecore/TIMEZONES:242 #, kde-format msgid "America/Hermosillo" msgstr "Америка/Эрмосильо" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:244 #, kde-format msgid "Mountain Standard Time - Sonora" msgstr "Стандартное зимнее время — Сонора" #: kdecore/TIMEZONES:245 #, kde-format msgid "America/Indiana/Indianapolis" msgstr "Америка/Индиана/Индианаполис" #: kdecore/TIMEZONES:248 #, kde-format msgid "America/Indiana/Knox" msgstr "Америка/Индиана/Нокс" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:250 kdecore/TIMEZONES:297 kdecore/TIMEZONES:1086 #, kde-format msgid "Eastern Time - Indiana - Starke County" msgstr "Восточное время — Индиана, округ Старк" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:252 #, kde-format msgid "Central Time - Indiana - Starke County" msgstr "Центральное поясное время — Индиана, округ Старк" #: kdecore/TIMEZONES:253 #, kde-format msgid "America/Indiana/Marengo" msgstr "Америка/Индиана/Маренго" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:255 #, kde-format msgid "Eastern Time - Indiana - Crawford County" msgstr "Восточное время — Индиана, округ Кроуфорд" #: kdecore/TIMEZONES:256 #, kde-format msgid "America/Indiana/Petersburg" msgstr "Америка/Индиана/Петербург" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:258 #, kde-format msgid "Central Time - Indiana - Pike County" msgstr "Центральное поясное время — Индиана, округ Пайк" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:260 #, kde-format msgid "Eastern Time - Indiana - Pike County" msgstr "Восточное время — Индиана, округ Пайк" #: kdecore/TIMEZONES:261 #, kde-format msgid "America/Indiana/Tell_City" msgstr "Америка/Индиана/Телл-Сити" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:263 #, kde-format msgid "Central Time - Indiana - Perry County" msgstr "Центральное поясное время — Индиана, округ Перри" #: kdecore/TIMEZONES:264 #, kde-format msgid "America/Indiana/Vevay" msgstr "Америка/Индиана/Вивей" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:266 #, kde-format msgid "Eastern Time - Indiana - Switzerland County" msgstr "Восточное время — Индиана, округ Швейцария" #: kdecore/TIMEZONES:267 #, kde-format msgid "America/Indiana/Vincennes" msgstr "Америка/Индиана/Винсеннс" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:269 #, kde-format msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" msgstr "Восточное время — Индиана, Округа Дейвиесс, Дюбуа, Нокс, Мартин" #: kdecore/TIMEZONES:270 #, kde-format msgid "America/Indiana/Winamac" msgstr "Америка/Индиана/Винамак" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:272 #, kde-format msgid "Eastern Time - Indiana - Pulaski County" msgstr "Восточное время — Индиана, округ Пуласки" #: kdecore/TIMEZONES:273 #, kde-format msgid "America/Indianapolis" msgstr "Америка/Индианаполис" #: kdecore/TIMEZONES:276 #, kde-format msgid "America/Inuvik" msgstr "Америка/Инувик" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:278 #, kde-format msgid "Mountain Time - west Northwest Territories" msgstr "Зимнее время — запад Северо-Западных территорий" #: kdecore/TIMEZONES:279 #, kde-format msgid "America/Iqaluit" msgstr "Америка/Икалуит" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:281 #, kde-format msgid "Eastern Time - east Nunavut - most locations" msgstr "Восточное время — восточный Нунавут (большая часть)" #: kdecore/TIMEZONES:282 #, kde-format msgid "America/Jamaica" msgstr "Америка/Ямайка" #: kdecore/TIMEZONES:283 #, kde-format msgid "America/Jujuy" msgstr "Америка/Хухуи" #: kdecore/TIMEZONES:286 #, kde-format msgid "America/Juneau" msgstr "Америка/Джуно" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:288 #, kde-format msgid "Alaska Time - Alaska panhandle" msgstr "Аляска (юго-восточная часть)" #: kdecore/TIMEZONES:289 #, kde-format msgid "America/Kentucky/Louisville" msgstr "Америка/Кентукки/Луисвилль" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:291 kdecore/TIMEZONES:306 #, kde-format msgid "Eastern Time - Kentucky - Louisville area" msgstr "Восточное время — Кентукки, Луисвилль" #: kdecore/TIMEZONES:292 #, kde-format msgid "America/Kentucky/Monticello" msgstr "Америка/Кентуки/Монтицелло" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:294 #, kde-format msgid "Eastern Time - Kentucky - Wayne County" msgstr "Восточное время — Кентукки, округ Уэйн" #: kdecore/TIMEZONES:295 #, kde-format msgid "America/Knox_IN" msgstr "Америка/Нокс" #: kdecore/TIMEZONES:298 #, kde-format msgid "America/Kralendijk" msgstr "Америка/Кралендейк" #: kdecore/TIMEZONES:299 #, kde-format msgid "America/La_Paz" msgstr "Америка/Ла-Пас" #: kdecore/TIMEZONES:300 #, kde-format msgid "America/Lima" msgstr "Америка/Лима" #: kdecore/TIMEZONES:301 #, kde-format msgid "America/Los_Angeles" msgstr "Америка/Лос-Анджелес" #: kdecore/TIMEZONES:304 #, kde-format msgid "America/Louisville" msgstr "Америка/Луисвиль" #: kdecore/TIMEZONES:307 #, kde-format msgid "America/Lower_Princes" msgstr "Америка/водопад Нижняя Принцесса, Онтарио" #: kdecore/TIMEZONES:308 #, kde-format msgid "America/Maceio" msgstr "Америка/Масейо" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:310 #, kde-format msgid "Alagoas, Sergipe" msgstr "Алагоас, Сержипи" #: kdecore/TIMEZONES:311 #, kde-format msgid "America/Managua" msgstr "Америка/Манагуа" #: kdecore/TIMEZONES:312 #, kde-format msgid "America/Manaus" msgstr "Америка/Манаус" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:314 kdecore/TIMEZONES:809 #, kde-format msgid "E Amazonas" msgstr "Восток штата Амазонас" #: kdecore/TIMEZONES:315 #, kde-format msgid "America/Marigot" msgstr "Америка/Мариго" #: kdecore/TIMEZONES:316 #, kde-format msgid "America/Martinique" msgstr "Америка/Мартиника" #: kdecore/TIMEZONES:317 #, kde-format msgid "America/Matamoros" msgstr "Америка/Матаморос" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:319 #, kde-format msgid "" "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" msgstr "" "Центральное поясное время США — Коауила, Дуранго, Нуэво-Леон, Тамаулипас " "(вблизи границы США)" #: kdecore/TIMEZONES:320 #, kde-format msgid "America/Mazatlan" msgstr "Америка/Масатлан" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:322 kdecore/TIMEZONES:953 #, kde-format msgid "Mountain Time - S Baja, Nayarit, Sinaloa" msgstr "Зимнее время — С Баха, Наярит, Синалоа" #: kdecore/TIMEZONES:323 #, kde-format msgid "America/Mendoza" msgstr "Америка/Мендоса" #: kdecore/TIMEZONES:326 #, kde-format msgid "America/Menominee" msgstr "Америка/Меномини" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:328 #, kde-format msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" msgstr "" "Центральное поясное время — Мичиган — округа Дикинсон, Гогибик, Айрон и " "Миномини" #: kdecore/TIMEZONES:329 #, kde-format msgid "America/Merida" msgstr "Америка/Мерида" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:331 #, kde-format msgid "Central Time - Campeche, Yucatan" msgstr "Центральное поясное время — Кампече, Юкатан" #: kdecore/TIMEZONES:332 #, kde-format msgid "America/Metlakatla" msgstr "Америка/Метлакатла" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:334 #, kde-format msgid "Metlakatla Time - Annette Island" msgstr "Время Метлакатла — Аннет-Айленд" #: kdecore/TIMEZONES:335 #, kde-format msgid "America/Mexico_City" msgstr "Америка/Мехико" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:337 kdecore/TIMEZONES:956 #, kde-format msgid "Central Time - most locations" msgstr "Центральное поясное время — большинство локаций" #: kdecore/TIMEZONES:338 #, kde-format msgid "America/Miquelon" msgstr "Америка/Микелон" #: kdecore/TIMEZONES:339 #, kde-format msgid "America/Moncton" msgstr "Америка/Монктон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:341 #, kde-format msgid "Atlantic Time - New Brunswick" msgstr "Атлантическое время — Нью-Брансуик" #: kdecore/TIMEZONES:342 #, kde-format msgid "America/Monterrey" msgstr "Америка/Монтерей" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:344 #, kde-format msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" msgstr "Центральное поясное время — Коауила, Дуранго, Нуэво-Леон, Тамаулипас" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:346 #, kde-format msgid "" "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from " "US border" msgstr "" "Мексиканское центральное поясное время — Коауила, Дуранго, Нуэво-Леон, " "Тамаулипас вдали от границы США" #: kdecore/TIMEZONES:347 #, kde-format msgid "America/Montevideo" msgstr "Америка/Монтевидео" #: kdecore/TIMEZONES:348 #, kde-format msgid "America/Montreal" msgstr "Америка/Монреаль" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:350 kdecore/TIMEZONES:379 #, kde-format msgid "Eastern Time - Quebec - most locations" msgstr "Восточное время — Квебек (большая часть)" #: kdecore/TIMEZONES:351 #, kde-format msgid "America/Montserrat" msgstr "Америка/Монтсеррат" #: kdecore/TIMEZONES:352 #, kde-format msgid "America/Nassau" msgstr "Америка/Нассау" #: kdecore/TIMEZONES:353 #, kde-format msgid "America/New_York" msgstr "Америка/Нью-Йорк" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:355 kdecore/TIMEZONES:1080 #, kde-format msgid "Eastern Time" msgstr "Восточное время" #: kdecore/TIMEZONES:356 #, kde-format msgid "America/Nipigon" msgstr "Америка/Нипигон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:358 #, kde-format msgid "" "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" msgstr "" "Восточное время — Онтарио и Квебек, места, не попавшие под Акт о едином " "времени (1966)" #: kdecore/TIMEZONES:359 #, kde-format msgid "America/Nome" msgstr "Америка/Ном" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:361 #, kde-format msgid "Alaska Time - west Alaska" msgstr "Аляска (западная часть)" #: kdecore/TIMEZONES:362 #, kde-format msgid "America/Noronha" msgstr "Америка/Норонха" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:364 kdecore/TIMEZONES:803 #, kde-format msgid "Atlantic islands" msgstr "Острова в Атлантическом океане" #: kdecore/TIMEZONES:365 #, kde-format msgid "America/North_Dakota/Beulah" msgstr "Америка/Северная_Дакота/Бьюла" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:367 #, kde-format msgid "Central Time - North Dakota - Mercer County" msgstr "Центральное поясное время — Северная Дакота, округ Мерсер" #: kdecore/TIMEZONES:368 #, kde-format msgid "America/North_Dakota/Center" msgstr "Америка/Северная_Дакота/Центр" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:370 #, kde-format msgid "Central Time - North Dakota - Oliver County" msgstr "Центральное поясное время — Северная Дакота, округ Оливер" #: kdecore/TIMEZONES:371 #, kde-format msgid "America/North_Dakota/New_Salem" msgstr "Америка/Северная_Дакота/Нью-Салем" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:373 #, kde-format msgid "Central Time - North Dakota - Morton County (except Mandan area)" msgstr "" "Центральное поясное время — Северная Дакота, округ Мортон (кроме Мандана)" #: kdecore/TIMEZONES:374 #, kde-format msgid "America/Ojinaga" msgstr "Америка/Охинага" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:376 #, kde-format msgid "US Mountain Time - Chihuahua near US border" msgstr "Зимнее время США — Чиуауа вблизи границы США" #: kdecore/TIMEZONES:377 #, kde-format msgid "America/Ontario" msgstr "Америка/Онтарио" #: kdecore/TIMEZONES:380 #, kde-format msgid "America/Panama" msgstr "Америка/Панама" #: kdecore/TIMEZONES:381 #, kde-format msgid "America/Pangnirtung" msgstr "Америка/Пангниртанг" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:383 #, kde-format msgid "Eastern Time - Pangnirtung, Nunavut" msgstr "Восточное время — Пангниртунг, Нунавут" #: kdecore/TIMEZONES:384 #, kde-format msgid "America/Paramaribo" msgstr "Америка/Парамарибо" #: kdecore/TIMEZONES:385 #, kde-format msgid "America/Phoenix" msgstr "Америка/Феникс" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:387 kdecore/TIMEZONES:1071 #, kde-format msgid "Mountain Standard Time - Arizona" msgstr "Стандартное зимнее время — Аризона" #: kdecore/TIMEZONES:388 #, kde-format msgid "America/Port-au-Prince" msgstr "Америка/Порт-о-Пренс" #: kdecore/TIMEZONES:389 #, kde-format msgid "America/Port_of_Spain" msgstr "Америка/Порт-оф-Спейн" #: kdecore/TIMEZONES:390 #, kde-format msgid "America/Porto_Acre" msgstr "Америка/Порту-Акри" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:392 kdecore/TIMEZONES:416 kdecore/TIMEZONES:800 #, kde-format msgid "Acre" msgstr "Акри" #: kdecore/TIMEZONES:393 #, kde-format msgid "America/Porto_Velho" msgstr "Америка/Порту-Велью" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:395 #, kde-format msgid "Rondonia" msgstr "Рондония" #: kdecore/TIMEZONES:396 #, kde-format msgid "America/Puerto_Rico" msgstr "Америка/Пуэрто-Рико" #: kdecore/TIMEZONES:397 #, kde-format msgid "America/Rainy_River" msgstr "Америка/Рэйни-Ривер" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:399 #, kde-format msgid "Central Time - Rainy River & Fort Frances, Ontario" msgstr "Центральное поясное время — Онтарио, Рейни Ривер и Форт Франс" #: kdecore/TIMEZONES:400 #, kde-format msgid "America/Rankin_Inlet" msgstr "Америка/Рэнкин-Инлет" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:402 #, kde-format msgid "Central Time - central Nunavut" msgstr "Центральное поясное время — центральный Нунавут" #: kdecore/TIMEZONES:403 #, kde-format msgid "America/Recife" msgstr "Америка/Ресифи" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:405 #, kde-format msgid "Pernambuco" msgstr "Пернамбуку" #: kdecore/TIMEZONES:406 #, kde-format msgid "America/Regina" msgstr "Америка/Регина" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:408 kdecore/TIMEZONES:435 kdecore/TIMEZONES:818 #: kdecore/TIMEZONES:833 #, kde-format msgid "Central Standard Time - Saskatchewan - most locations" msgstr "Стандартное центральное время — Саскачеван — большинство локаций" #: kdecore/TIMEZONES:409 #, kde-format msgid "America/Resolute" msgstr "Америка/Резолют" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:411 #, kde-format msgid "Eastern Time - Resolute, Nunavut" msgstr "Восточное время — Резольют, Нунавут" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:413 #, kde-format msgid "Central Standard Time - Resolute, Nunavut" msgstr "Стандартное центральное время— Резольют, Нунавут" #: kdecore/TIMEZONES:414 #, kde-format msgid "America/Rio_Branco" msgstr "Америка/Рио-Бранко" #: kdecore/TIMEZONES:417 #, kde-format msgid "America/Rosario" msgstr "Америка/Розарио" #: kdecore/TIMEZONES:420 #, kde-format msgid "America/Santa_Isabel" msgstr "Америка/Санта-Исабель" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:422 #, kde-format msgid "Mexican Pacific Time - Baja California away from US border" msgstr "" "Мексиканское тихоокеанское поясное время — Баха Калифорния за границей США" #: kdecore/TIMEZONES:423 #, kde-format msgid "America/Santarem" msgstr "Америка/Сантарен" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:425 #, kde-format msgid "W Para" msgstr "Запад штата Пара" #: kdecore/TIMEZONES:426 #, kde-format msgid "America/Santiago" msgstr "Америка/Сантьяго" #: kdecore/TIMEZONES:429 #, kde-format msgid "America/Santo_Domingo" msgstr "Америка/Санто-Доминго" #: kdecore/TIMEZONES:430 #, kde-format msgid "America/Sao_Paulo" msgstr "Америка/Сан-Пауло" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:432 kdecore/TIMEZONES:806 #, kde-format msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" msgstr "Юг и юго-восток Бразилии (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" #: kdecore/TIMEZONES:433 #, kde-format msgid "America/Saskatoon" msgstr "Америка/Саскатун" #: kdecore/TIMEZONES:436 #, kde-format msgid "America/Scoresbysund" msgstr "Америка/Скорсбисунн" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:438 #, kde-format msgid "Scoresbysund / Ittoqqortoormiit" msgstr "Иттоккортоормиит (дат. Скоресбисунд)" #: kdecore/TIMEZONES:439 #, kde-format msgid "America/Shiprock" msgstr "Америка/Шипрок" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:441 #, kde-format msgid "Mountain Time - Navajo" msgstr "Зимнее время — Навахо" #: kdecore/TIMEZONES:442 #, kde-format msgid "America/Sitka" msgstr "Америка/Ситка" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:444 #, kde-format msgid "Alaska Time - southeast Alaska panhandle" msgstr "Часовой пояс Аляски — Юго-Восточная Аляска (Аляска Панхэндл)" #: kdecore/TIMEZONES:445 #, kde-format msgid "America/St_Barthelemy" msgstr "Америка/Сен-Бартельми" #: kdecore/TIMEZONES:446 #, kde-format msgid "America/St_Johns" msgstr "Америка/Сент-Джонс" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:448 kdecore/TIMEZONES:827 #, kde-format msgid "Newfoundland Time, including SE Labrador" msgstr "Часовой пояс Ньюфаундленда, включая юго-восток Лабрадора" #: kdecore/TIMEZONES:449 #, kde-format msgid "America/St_Kitts" msgstr "Америка/Сент-Китс и Невис" #: kdecore/TIMEZONES:450 #, kde-format msgid "America/St_Lucia" msgstr "Америка/Сент-Люсия" #: kdecore/TIMEZONES:451 #, kde-format msgid "America/St_Thomas" msgstr "Америка/Сент-Томас" #: kdecore/TIMEZONES:452 #, kde-format msgid "America/St_Vincent" msgstr "Америка/Сент-Винсент" #: kdecore/TIMEZONES:453 #, kde-format msgid "America/Swift_Current" msgstr "Америка/Свифт-Карент" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:455 #, kde-format msgid "Central Standard Time - Saskatchewan - midwest" msgstr "Стандартное центральное время — Саскачеван — Средний Запад" #: kdecore/TIMEZONES:456 #, kde-format msgid "America/Tegucigalpa" msgstr "Америка/Тегусигальпа" #: kdecore/TIMEZONES:457 #, kde-format msgid "America/Thule" msgstr "Америка/Туле" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:459 #, kde-format msgid "Thule / Pituffik" msgstr "Туле" #: kdecore/TIMEZONES:460 #, kde-format msgid "America/Thunder_Bay" msgstr "Америка/Сандер-Бэй" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:462 #, kde-format msgid "Eastern Time - Thunder Bay, Ontario" msgstr "Восточное время — Тандер-Бей, Онтарио" #: kdecore/TIMEZONES:463 #, kde-format msgid "America/Tijuana" msgstr "Америка/Тихуана" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:467 #, kde-format msgid "US Pacific Time - Baja California near US border" msgstr "Тихоокеанское поясное время США — Баха Калифорния вблизи границы США" #: kdecore/TIMEZONES:468 #, kde-format msgid "America/Toronto" msgstr "Америка/Торонто" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:470 kdecore/TIMEZONES:821 #, kde-format msgid "Eastern Time - Ontario - most locations" msgstr "Восточное время — Онтарио (большая часть)" #: kdecore/TIMEZONES:471 #, kde-format msgid "America/Tortola" msgstr "Америка/Тортола" #: kdecore/TIMEZONES:472 #, kde-format msgid "America/Vancouver" msgstr "Америка/Ванкувер" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:474 kdecore/TIMEZONES:830 #, kde-format msgid "Pacific Time - west British Columbia" msgstr "Тихоокеанское время — запад Британской Колумбии" #: kdecore/TIMEZONES:475 #, kde-format msgid "America/Virgin" msgstr "Америка/Виргинские_острова" #: kdecore/TIMEZONES:476 #, kde-format msgid "America/Whitehorse" msgstr "Америка/Вайтхорс" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:478 kdecore/TIMEZONES:836 #, kde-format msgid "Pacific Time - south Yukon" msgstr "Тихоокеанское время — юг Юкона" #: kdecore/TIMEZONES:479 #, kde-format msgid "America/Winnipeg" msgstr "Америка/Виннипег" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:481 kdecore/TIMEZONES:815 #, kde-format msgid "Central Time - Manitoba & west Ontario" msgstr "Центральное поясное время — Манитоба и западный Онтарио" #: kdecore/TIMEZONES:482 #, kde-format msgid "America/Yakutat" msgstr "Америка/Якутат" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:484 #, kde-format msgid "Alaska Time - Alaska panhandle neck" msgstr "Аляска (центральная часть)" #: kdecore/TIMEZONES:485 #, kde-format msgid "America/Yellowknife" msgstr "Америка/Йеллоунайф" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:487 #, kde-format msgid "Mountain Time - central Northwest Territories" msgstr "Зимнее время — центр Северо-Западных территорий" #: kdecore/TIMEZONES:488 #, kde-format msgid "Antarctica/Casey" msgstr "Антарктида/Кейси" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:490 #, kde-format msgid "Casey Station, Bailey Peninsula" msgstr "Станция Кейси, полуостров Бэйли" #: kdecore/TIMEZONES:491 #, kde-format msgid "Antarctica/Davis" msgstr "Антарктида/Дейвис" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:493 #, kde-format msgid "Davis Station, Vestfold Hills" msgstr "Станция Дейвис, Вестфолд-Хиллз" #: kdecore/TIMEZONES:494 #, kde-format msgid "Antarctica/DumontDUrville" msgstr "Антарктида/Дюмон_д'Юрвиль" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:496 #, kde-format msgid "Dumont-d'Urville Station, Terre Adelie" msgstr "Станция Дюмон д'Юрвиль, Земля Адели" #: kdecore/TIMEZONES:497 #, kde-format msgid "Antarctica/Macquarie" msgstr "Антарктида/Маккуори" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:499 #, kde-format msgid "Macquarie Island Station, Macquarie Island" msgstr "Станция Маккуори, остров Маккуори" #: kdecore/TIMEZONES:500 #, kde-format msgid "Antarctica/Mawson" msgstr "Антарктида/Моусон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:502 #, kde-format msgid "Mawson Station, Holme Bay" msgstr "Станция Моусон, залив Холм" #: kdecore/TIMEZONES:503 #, kde-format msgid "Antarctica/McMurdo" msgstr "Антарктида/Мак-Мёрдо" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:505 #, kde-format msgid "McMurdo Station, Ross Island" msgstr "Станция Мак-Мёрдо, остров Росса" #: kdecore/TIMEZONES:506 #, kde-format msgid "Antarctica/Palmer" msgstr "Антарктида/Палмер" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:508 #, kde-format msgid "Palmer Station, Anvers Island" msgstr "Станция Палмер, остров Анверс" #: kdecore/TIMEZONES:509 #, kde-format msgid "Antarctica/Rothera" msgstr "Антарктида/Ротера" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:511 #, kde-format msgid "Rothera Station, Adelaide Island" msgstr "Станция Ротера, остров Аделаида" #: kdecore/TIMEZONES:512 #, kde-format msgid "Antarctica/South_Pole" msgstr "Антарктида/Южный полюс" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:514 #, kde-format msgid "Amundsen-Scott Station, South Pole" msgstr "Станция Амундсен-Скотт, Южный Полюс" #: kdecore/TIMEZONES:515 #, kde-format msgid "Antarctica/Syowa" msgstr "Антарктида/Сёва" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:517 #, kde-format msgid "Syowa Station, E Ongul I" msgstr "Станция Сёва, остров Ист-Онгуль" #: kdecore/TIMEZONES:518 #, kde-format msgid "Antarctica/Vostok" msgstr "Антарктида/Восток" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:520 #, kde-format msgid "Vostok Station, S Magnetic Pole" msgstr "Станция Восток, Южный магнитный полюс" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:522 #, kde-format msgid "Vostok Station, Lake Vostok" msgstr "Станция Восток, озеро Восток" #: kdecore/TIMEZONES:523 #, kde-format msgid "Arctic/Longyearbyen" msgstr "Арктика/Лонгйербиен" #: kdecore/TIMEZONES:524 #, kde-format msgid "Asia/Aden" msgstr "Азия/Аден" #: kdecore/TIMEZONES:525 #, kde-format msgid "Asia/Almaty" msgstr "Азия/Алма-Ата" #: kdecore/TIMEZONES:528 #, kde-format msgid "Asia/Amman" msgstr "Азия/Амман" #: kdecore/TIMEZONES:529 #, kde-format msgid "Asia/Anadyr" msgstr "Азия/Анадырь" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:531 #, kde-format msgid "Moscow+10 - Bering Sea" msgstr "Московское время+10 — Берингово море" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:533 #, kde-format msgid "Moscow+08 - Bering Sea" msgstr "Московское время+08 — Берингово море" #: kdecore/TIMEZONES:534 #, kde-format msgid "Asia/Aqtau" msgstr "Азия/Актау" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:536 #, kde-format msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" msgstr "Атырауская (Атырау) и Мангистауская (Актау) области" #: kdecore/TIMEZONES:537 #, kde-format msgid "Asia/Aqtobe" msgstr "Азия/Актобе" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:539 #, kde-format msgid "Aqtobe (Aktobe)" msgstr "Актюбинская область (Актобе)" #: kdecore/TIMEZONES:540 #, kde-format msgid "Asia/Ashgabat" msgstr "Азия/Ашхабад" #: kdecore/TIMEZONES:541 #, kde-format msgid "Asia/Ashkhabad" msgstr "Азия/Ашхабад" #: kdecore/TIMEZONES:542 #, kde-format msgid "Asia/Baghdad" msgstr "Азия/Багдад" #: kdecore/TIMEZONES:543 #, kde-format msgid "Asia/Bahrain" msgstr "Азия/Бахрейн" #: kdecore/TIMEZONES:544 #, kde-format msgid "Asia/Baku" msgstr "Азия/Баку" #: kdecore/TIMEZONES:545 #, kde-format msgid "Asia/Bangkok" msgstr "Азия/Бангкок" #: kdecore/TIMEZONES:546 #, kde-format msgid "Asia/Beijing" msgstr "Азия/Пекин" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:548 kdecore/TIMEZONES:672 kdecore/TIMEZONES:968 #, kde-format msgid "east China - Beijing, Guangdong, Shanghai, etc." msgstr "Западный Китай — Пекин, Гуандун, Шанхай и тд" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:550 #, kde-format msgid "China Standard Time" msgstr "Китайское стандартное время" #: kdecore/TIMEZONES:551 #, kde-format msgid "Asia/Beirut" msgstr "Азия/Бейрут" #: kdecore/TIMEZONES:552 #, kde-format msgid "Asia/Bishkek" msgstr "Азия/Бишкек" #: kdecore/TIMEZONES:553 #, kde-format msgid "Asia/Brunei" msgstr "Азия/Бруней" #: kdecore/TIMEZONES:554 #, kde-format msgid "Asia/Calcutta" msgstr "Азия/Калькутта" #: kdecore/TIMEZONES:555 #, kde-format msgid "Asia/Choibalsan" msgstr "Азия/Чойбалсан" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:557 #, kde-format msgid "Dornod, Sukhbaatar" msgstr "Сухэ-Батор" #: kdecore/TIMEZONES:558 #, kde-format msgid "Asia/Chongqing" msgstr "Азия/Чунцин" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:560 kdecore/TIMEZONES:565 #, kde-format msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." msgstr "Центральный Китай — Сычуань, Юньнань, Гуанси, Шэньси, Гуйчжоу и тд" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:562 #, kde-format msgid "China mountains" msgstr "Горный Китай" #: kdecore/TIMEZONES:563 #, kde-format msgid "Asia/Chungking" msgstr "Азия/Чунцин" #: kdecore/TIMEZONES:566 #, kde-format msgid "Asia/Colombo" msgstr "Азия/Коломбо" #: kdecore/TIMEZONES:567 #, kde-format msgid "Asia/Dacca" msgstr "Азия/Дакка" #: kdecore/TIMEZONES:568 #, kde-format msgid "Asia/Damascus" msgstr "Азия/Дамаск" #: kdecore/TIMEZONES:569 #, kde-format msgid "Asia/Dhaka" msgstr "Азия/Дакка" #: kdecore/TIMEZONES:570 #, kde-format msgid "Asia/Dili" msgstr "Азия/Дили" #: kdecore/TIMEZONES:571 #, kde-format msgid "Asia/Dubai" msgstr "Азия/Дубай" #: kdecore/TIMEZONES:572 #, kde-format msgid "Asia/Dushanbe" msgstr "Азия/Душанбе" #: kdecore/TIMEZONES:573 #, kde-format msgid "Asia/Gaza" msgstr "Азия/Газа" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:575 #, kde-format msgid "Gaza Strip" msgstr "Сектор Газа" #: kdecore/TIMEZONES:576 #, kde-format msgid "Asia/Harbin" msgstr "Азия/Харбин" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:578 #, kde-format msgid "Heilongjiang (except Mohe), Jilin" msgstr "Хэйлунцзян (кроме Мохе), Цзилинь" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:580 #, kde-format msgid "China north" msgstr "Северный Китай" #: kdecore/TIMEZONES:581 #, kde-format msgid "Asia/Hebron" msgstr "Азия/Хеврон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:583 #, kde-format msgid "West Bank" msgstr "Западный берег р.Иордан" #: kdecore/TIMEZONES:584 #, kde-format msgid "Asia/Ho_Chi_Minh" msgstr "Азия/Хо_Ши_Мин" #: kdecore/TIMEZONES:585 #, kde-format msgid "Asia/Hong_Kong" msgstr "Азия/Гонконг" #: kdecore/TIMEZONES:586 #, kde-format msgid "Asia/Hovd" msgstr "Азия/Ховд" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:588 #, kde-format msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" msgstr "" "Баян-Улэгэйский, Гоби-Алтайский, Кобдоский, Убсунурский и Дзабханский аймаки" #: kdecore/TIMEZONES:589 #, kde-format msgid "Asia/Irkutsk" msgstr "Азия/Иркутск" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:591 #, kde-format msgid "Moscow+05 - Lake Baikal" msgstr "Московское время+05 — озеро Байкал" #: kdecore/TIMEZONES:592 #, kde-format msgid "Asia/Jakarta" msgstr "Азия/Джакарта" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:594 #, kde-format msgid "Java & Sumatra" msgstr "Ява и Суматра" #: kdecore/TIMEZONES:595 #, kde-format msgid "Asia/Jayapura" msgstr "Азия/Джаяпур" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:597 #, kde-format msgid "Irian Jaya & the Moluccas" msgstr "Молуккские острова и Ириан-Джая" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:599 #, kde-format msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" msgstr "Западное Папуа (Ириан-Джая) и Молуккские острова" #: kdecore/TIMEZONES:600 #, kde-format msgid "Asia/Jerusalem" msgstr "Азия/Иерусалим" #: kdecore/TIMEZONES:601 #, kde-format msgid "Asia/Kabul" msgstr "Азия/Кабул" #: kdecore/TIMEZONES:602 #, kde-format msgid "Asia/Kamchatka" msgstr "Азия/Камчатка" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:604 #, kde-format msgid "Moscow+09 - Kamchatka" msgstr "Московское время+09 — Камчатка" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:606 #, kde-format msgid "Moscow+08 - Kamchatka" msgstr "Московское время+08 — Камчатка" #: kdecore/TIMEZONES:607 #, kde-format msgid "Asia/Karachi" msgstr "Азия/Карачи" #: kdecore/TIMEZONES:608 #, kde-format msgid "Asia/Kashgar" msgstr "Азия/Кашгар" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:610 #, kde-format msgid "west Tibet & Xinjiang" msgstr "Западная часть Тибета и Синьцзян-Уйгурского автономного района" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:612 #, kde-format msgid "China west Xinjiang" msgstr "Китай, западный Синьцзян" #: kdecore/TIMEZONES:613 #, kde-format msgid "Asia/Kathmandu" msgstr "Азия/Катманду" #: kdecore/TIMEZONES:614 #, kde-format msgid "Asia/Katmandu" msgstr "Азия/Катманду" #: kdecore/TIMEZONES:615 #, kde-format msgid "Asia/Kolkata" msgstr "Азия/Калькутта" #: kdecore/TIMEZONES:616 #, kde-format msgid "Asia/Krasnoyarsk" msgstr "Азия/Красноярск" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:618 #, kde-format msgid "Moscow+04 - Yenisei River" msgstr "Московское время+04 — река Енисей" #: kdecore/TIMEZONES:619 #, kde-format msgid "Asia/Kuala_Lumpur" msgstr "Азия/Куала-Лумпур" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:621 #, kde-format msgid "peninsular Malaysia" msgstr "Западная Малайзия" #: kdecore/TIMEZONES:622 #, kde-format msgid "Asia/Kuching" msgstr "Азия/Кучинг" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:624 #, kde-format msgid "Sabah & Sarawak" msgstr "Сабах и Саравак" #: kdecore/TIMEZONES:625 #, kde-format msgid "Asia/Kuwait" msgstr "Азия/Кувейт" #: kdecore/TIMEZONES:626 #, kde-format msgid "Asia/Macao" msgstr "Азия/Макао" #: kdecore/TIMEZONES:627 #, kde-format msgid "Asia/Macau" msgstr "Азия/Макао" #: kdecore/TIMEZONES:628 #, kde-format msgid "Asia/Magadan" msgstr "Азия/Магадан" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:630 #, kde-format msgid "Moscow+08 - Magadan" msgstr "Московское время+08 — Магадан" #: kdecore/TIMEZONES:631 #, kde-format msgid "Asia/Makassar" msgstr "Азия/Макассар" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:688 #, kde-format msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" msgstr "" "Восточный и Южный Калимантан, Сулавеси, Бали, Малые Зондские острова, " "Западный Тимор" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:635 #, kde-format msgid "" "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" msgstr "" "Восточный и Южный Калимантан, Сулавеси, Бали, Малые Зондские острова, " "Западный Тимор" #: kdecore/TIMEZONES:636 #, kde-format msgid "Asia/Manila" msgstr "Азия/Манила" #: kdecore/TIMEZONES:637 #, kde-format msgid "Asia/Muscat" msgstr "Азия/Мускат" #: kdecore/TIMEZONES:638 #, kde-format msgid "Asia/Nicosia" msgstr "Азия/Никосия" #: kdecore/TIMEZONES:639 #, kde-format msgid "Asia/Novokuznetsk" msgstr "Азия/Новокузнецк" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:641 #, kde-format msgid "Moscow+03 - Novokuznetsk" msgstr "Московское время+03 — Новокузнецк" #: kdecore/TIMEZONES:642 #, kde-format msgid "Asia/Novosibirsk" msgstr "Азия/Новосибирск" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:644 #, kde-format msgid "Moscow+03 - Novosibirsk" msgstr "Московское время+03 — Новосибирск" #: kdecore/TIMEZONES:645 #, kde-format msgid "Asia/Omsk" msgstr "Азия/Омск" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:647 #, kde-format msgid "Moscow+03 - west Siberia" msgstr "Московское время+03 — Западная Сибирь" #: kdecore/TIMEZONES:648 #, kde-format msgid "Asia/Oral" msgstr "Азия/Орал" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:650 #, kde-format msgid "West Kazakhstan" msgstr "Западный Казахстан" #: kdecore/TIMEZONES:651 #, kde-format msgid "Asia/Phnom_Penh" msgstr "Азия/Пномпень" #: kdecore/TIMEZONES:652 #, kde-format msgid "Asia/Pontianak" msgstr "Азия/Понтианак" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:654 #, kde-format msgid "west & central Borneo" msgstr "Западный и Центральный Калимантан" #: kdecore/TIMEZONES:655 #, kde-format msgid "Asia/Pyongyang" msgstr "Азия/Пхеньян" #: kdecore/TIMEZONES:656 #, kde-format msgid "Asia/Qatar" msgstr "Азия/Катар" #: kdecore/TIMEZONES:657 #, kde-format msgid "Asia/Qyzylorda" msgstr "Азия/Кзыл-Орда" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:659 #, kde-format msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" msgstr "Кызылорда" # Renamed to http://ru.wikipedia.org/wiki/Янгон --aspotashev # BUGME: rename in the source code #: kdecore/TIMEZONES:660 #, kde-format msgid "Asia/Rangoon" msgstr "Азия/Янгон" #: kdecore/TIMEZONES:661 #, kde-format msgid "Asia/Riyadh" msgstr "Азия/Эр-Рияд" #: kdecore/TIMEZONES:662 #, kde-format msgid "Asia/Saigon" msgstr "Азия/Сайгон" #: kdecore/TIMEZONES:663 #, kde-format msgid "Asia/Sakhalin" msgstr "Азия/Сахалин" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:665 #, kde-format msgid "Moscow+07 - Sakhalin Island" msgstr "Московское время+07 — остров Сахалин" #: kdecore/TIMEZONES:666 #, kde-format msgid "Asia/Samarkand" msgstr "Азия/Самарканд" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:668 #, kde-format msgid "west Uzbekistan" msgstr "Западный Узбекистан" #: kdecore/TIMEZONES:669 #, kde-format msgid "Asia/Seoul" msgstr "Азия/Сеул" #: kdecore/TIMEZONES:670 #, kde-format msgid "Asia/Shanghai" msgstr "Азия/Шанхай" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:674 #, kde-format msgid "China east" msgstr "Восточный Китай" #: kdecore/TIMEZONES:675 #, kde-format msgid "Asia/Singapore" msgstr "Азия/Сингапур" #: kdecore/TIMEZONES:676 #, kde-format msgid "Asia/Taipei" msgstr "Азия/Тайпей" #: kdecore/TIMEZONES:677 #, kde-format msgid "Asia/Tashkent" msgstr "Азия/Ташкент" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:679 #, kde-format msgid "east Uzbekistan" msgstr "Восточный Узбекистан" #: kdecore/TIMEZONES:680 #, kde-format msgid "Asia/Tbilisi" msgstr "Азия/Тбилиси" #: kdecore/TIMEZONES:681 #, kde-format msgid "Asia/Tehran" msgstr "Азия/Тегеран" #: kdecore/TIMEZONES:682 #, kde-format msgid "Asia/Tel_Aviv" msgstr "Азия/Тель-Авив" #: kdecore/TIMEZONES:683 #, kde-format msgid "Asia/Thimbu" msgstr "Азия/Тхимпху" #: kdecore/TIMEZONES:684 #, kde-format msgid "Asia/Thimphu" msgstr "Азия/Тхимпху" #: kdecore/TIMEZONES:685 #, kde-format msgid "Asia/Tokyo" msgstr "Азия/Токио" #: kdecore/TIMEZONES:686 #, kde-format msgid "Asia/Ujung_Pandang" msgstr "Азия/Уджунг-Панданг" #: kdecore/TIMEZONES:689 #, kde-format msgid "Asia/Ulaanbaatar" msgstr "Азия/Улан-Батор" #: kdecore/TIMEZONES:692 #, kde-format msgid "Asia/Ulan_Bator" msgstr "Азия/Улан-Батор" #: kdecore/TIMEZONES:695 #, kde-format msgid "Asia/Urumqi" msgstr "Азия/Урумчи" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:697 #, kde-format msgid "most of Tibet & Xinjiang" msgstr "Большая часть Тибета и Синьцзян-Уйгурского автономного района" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:699 #, kde-format msgid "China Xinjiang-Tibet" msgstr "Китай, Синьцзян-Тибет" #: kdecore/TIMEZONES:700 #, kde-format msgid "Asia/Vientiane" msgstr "Азия/Вьентьян" #: kdecore/TIMEZONES:701 #, kde-format msgid "Asia/Vladivostok" msgstr "Азия/Владивосток" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:703 #, kde-format msgid "Moscow+07 - Amur River" msgstr "Московское время+07 — река Амур" #: kdecore/TIMEZONES:704 #, kde-format msgid "Asia/Yakutsk" msgstr "Азия/Якутск" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:706 #, kde-format msgid "Moscow+06 - Lena River" msgstr "Московское время+06 — река Лена" #: kdecore/TIMEZONES:707 #, kde-format msgid "Asia/Yekaterinburg" msgstr "Азия/Екатеринбург" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:709 #, kde-format msgid "Moscow+02 - Urals" msgstr "Московское время+02 — Урал" #: kdecore/TIMEZONES:710 #, kde-format msgid "Asia/Yerevan" msgstr "Азия/Ереван" #: kdecore/TIMEZONES:711 #, kde-format msgid "Atlantic/Azores" msgstr "Атлантика/Азоры" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:713 #, kde-format msgid "Azores" msgstr "Азорские острова" #: kdecore/TIMEZONES:714 #, kde-format msgid "Atlantic/Bermuda" msgstr "Атлантика/Бермуды" #: kdecore/TIMEZONES:715 #, kde-format msgid "Atlantic/Canary" msgstr "Атлантика/Канары" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:717 #, kde-format msgid "Canary Islands" msgstr "Канарские острова" #: kdecore/TIMEZONES:718 #, kde-format msgid "Atlantic/Cape_Verde" msgstr "Атлантика/Капо-Верде" #: kdecore/TIMEZONES:719 #, kde-format msgid "Atlantic/Faeroe" msgstr "Атлантика/Фаэро" #: kdecore/TIMEZONES:720 #, kde-format msgid "Atlantic/Faroe" msgstr "Атлантика/Фаэро" #: kdecore/TIMEZONES:721 #, kde-format msgid "Atlantic/Jan_Mayen" msgstr "Атлантика/Ян-Майен" #: kdecore/TIMEZONES:722 #, kde-format msgid "Atlantic/Madeira" msgstr "Атлантика/Мадейра" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:724 #, kde-format msgid "Madeira Islands" msgstr "Мадейра" #: kdecore/TIMEZONES:725 #, kde-format msgid "Atlantic/Reykjavik" msgstr "Атлантика/Рейкъявик" #: kdecore/TIMEZONES:726 #, kde-format msgid "Atlantic/South_Georgia" msgstr "Атлантика/Южная Георгия" #: kdecore/TIMEZONES:727 #, kde-format msgid "Atlantic/St_Helena" msgstr "Атлантика/Св.Елена" #: kdecore/TIMEZONES:728 #, kde-format msgid "Atlantic/Stanley" msgstr "Атлантика/Стэнли" #: kdecore/TIMEZONES:729 #, kde-format msgid "Australia/ACT" msgstr "Австралия/Австралийская_столичная_территория" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:731 kdecore/TIMEZONES:743 kdecore/TIMEZONES:770 #: kdecore/TIMEZONES:785 #, kde-format msgid "New South Wales - most locations" msgstr "Новый Южный Уэльс (большая часть)" #: kdecore/TIMEZONES:732 #, kde-format msgid "Australia/Adelaide" msgstr "Австралия/Аделаида" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:734 kdecore/TIMEZONES:782 #, kde-format msgid "South Australia" msgstr "Южная Австралия" #: kdecore/TIMEZONES:735 #, kde-format msgid "Australia/Brisbane" msgstr "Австралия/Брисбен" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:737 kdecore/TIMEZONES:779 #, kde-format msgid "Queensland - most locations" msgstr "Квинсленд (большая часть)" #: kdecore/TIMEZONES:738 #, kde-format msgid "Australia/Broken_Hill" msgstr "Австралия/Брокен-Хилл" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:740 kdecore/TIMEZONES:797 #, kde-format msgid "New South Wales - Yancowinna" msgstr "Новый Южный Уэльс (Янковинна)" #: kdecore/TIMEZONES:741 #, kde-format msgid "Australia/Canberra" msgstr "Австралия/Канберра" #: kdecore/TIMEZONES:744 #, kde-format msgid "Australia/Currie" msgstr "Австралия/Курри" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:746 #, kde-format msgid "Tasmania - King Island" msgstr "Остров Кинг (Тасмания)" #: kdecore/TIMEZONES:747 #, kde-format msgid "Australia/Darwin" msgstr "Австралия/Дарвин" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:749 kdecore/TIMEZONES:773 #, kde-format msgid "Northern Territory" msgstr "Северная территория" #: kdecore/TIMEZONES:750 #, kde-format msgid "Australia/Eucla" msgstr "Австралия/Юкла" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:752 #, kde-format msgid "Western Australia - Eucla area" msgstr "Юкла (Западная Австралия)" #: kdecore/TIMEZONES:753 #, kde-format msgid "Australia/Hobart" msgstr "Австралия/Хобарт" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:755 kdecore/TIMEZONES:788 #, kde-format msgid "Tasmania - most locations" msgstr "Тасмания (большая часть)" #: kdecore/TIMEZONES:756 #, kde-format msgid "Australia/LHI" msgstr "Австралия/Лорд-Хау" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:758 kdecore/TIMEZONES:764 #, kde-format msgid "Lord Howe Island" msgstr "Лорд-Хау" #: kdecore/TIMEZONES:759 #, kde-format msgid "Australia/Lindeman" msgstr "Австралия/Линдеман" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:761 #, kde-format msgid "Queensland - Holiday Islands" msgstr "Квинсленд" #: kdecore/TIMEZONES:762 #, kde-format msgid "Australia/Lord_Howe" msgstr "Австралия/Лорд-Хау" #: kdecore/TIMEZONES:765 #, kde-format msgid "Australia/Melbourne" msgstr "Австралия/Мельбурн" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:767 kdecore/TIMEZONES:791 #, kde-format msgid "Victoria" msgstr "Виктория" #: kdecore/TIMEZONES:768 #, kde-format msgid "Australia/NSW" msgstr "Австралия/Северная_территория" #: kdecore/TIMEZONES:771 #, kde-format msgid "Australia/North" msgstr "Австралия/Северная_территория" #: kdecore/TIMEZONES:774 #, kde-format msgid "Australia/Perth" msgstr "Австралия/Перт" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:776 kdecore/TIMEZONES:794 #, kde-format msgid "Western Australia - most locations" msgstr "Западная Австралия (большая часть)" #: kdecore/TIMEZONES:777 #, kde-format msgid "Australia/Queensland" msgstr "Австралия/Квинсленд" #: kdecore/TIMEZONES:780 #, kde-format msgid "Australia/South" msgstr "Австралия/Южная_Австралия" #: kdecore/TIMEZONES:783 #, kde-format msgid "Australia/Sydney" msgstr "Австралия/Сидней" #: kdecore/TIMEZONES:786 #, kde-format msgid "Australia/Tasmania" msgstr "Австралия/Тасмания" #: kdecore/TIMEZONES:789 #, kde-format msgid "Australia/Victoria" msgstr "Австралия/Виктория" #: kdecore/TIMEZONES:792 #, kde-format msgid "Australia/West" msgstr "Австралия/Западная_Австралия" #: kdecore/TIMEZONES:795 #, kde-format msgid "Australia/Yancowinna" msgstr "Австралия/Новый_Южный_Уэльс" #: kdecore/TIMEZONES:798 #, kde-format msgid "Brazil/Acre" msgstr "Бразилия/Акри" #: kdecore/TIMEZONES:801 #, kde-format msgid "Brazil/DeNoronha" msgstr "Brazil/Фернанду-ди-Норонья" #: kdecore/TIMEZONES:804 #, kde-format msgid "Brazil/East" msgstr "Brazil/Восточная_часть" #: kdecore/TIMEZONES:807 #, kde-format msgid "Brazil/West" msgstr "Brazil/Западная_часть" #: kdecore/TIMEZONES:810 #, kde-format msgid "Canada/Atlantic" msgstr "Канада/Атлантическое_время" #: kdecore/TIMEZONES:813 #, kde-format msgid "Canada/Central" msgstr "Канада/Среднеамериканское_время" #: kdecore/TIMEZONES:816 #, kde-format msgid "Canada/East-Saskatchewan" msgstr "Канада/Восточный_Саскачеван" #: kdecore/TIMEZONES:819 #, kde-format msgid "Canada/Eastern" msgstr "Канада/Восточное_время" #: kdecore/TIMEZONES:822 #, kde-format msgid "Canada/Mountain" msgstr "Канада/Горное_время" #: kdecore/TIMEZONES:825 #, kde-format msgid "Canada/Newfoundland" msgstr "Канада/Ньюфаундленд" #: kdecore/TIMEZONES:828 #, kde-format msgid "Canada/Pacific" msgstr "Канада/Тихоокеанское_время" #: kdecore/TIMEZONES:831 #, kde-format msgid "Canada/Saskatchewan" msgstr "Канада/Саскачеван" #: kdecore/TIMEZONES:834 #, kde-format msgid "Canada/Yukon" msgstr "Канада/Юкон" #: kdecore/TIMEZONES:837 #, kde-format msgid "Chile/Continental" msgstr "Чили/Континентальная_часть" # BUGME: зачем здесь нужно подчеркивание? --aspotashev #: kdecore/TIMEZONES:840 #, kde-format msgid "Chile/EasterIsland" msgstr "Чили/Остров_Пасхи" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:842 kdecore/TIMEZONES:981 #, kde-format msgid "Easter Island & Sala y Gomez" msgstr "Острова Пасхи и Сала-и-Гомес" #: kdecore/TIMEZONES:843 #, kde-format msgid "Cuba" msgstr "Куба" #: kdecore/TIMEZONES:844 #, kde-format msgid "Egypt" msgstr "Египет" #: kdecore/TIMEZONES:845 #, kde-format msgid "Eire" msgstr "Ирландия" #: kdecore/TIMEZONES:846 #, kde-format msgid "Europe/Amsterdam" msgstr "Европа/Амстердам" #: kdecore/TIMEZONES:847 #, kde-format msgid "Europe/Andorra" msgstr "Европа/Андорра" #: kdecore/TIMEZONES:848 #, kde-format msgid "Europe/Athens" msgstr "Европа/Афины" #: kdecore/TIMEZONES:849 #, kde-format msgid "Europe/Belfast" msgstr "Европа/Белфаст" #: kdecore/TIMEZONES:850 #, kde-format msgid "Europe/Belgrade" msgstr "Европа/Белград" #: kdecore/TIMEZONES:851 #, kde-format msgid "Europe/Berlin" msgstr "Европа/Берлин" #: kdecore/TIMEZONES:852 #, kde-format msgid "Europe/Bratislava" msgstr "Европа/Братислава" #: kdecore/TIMEZONES:853 #, kde-format msgid "Europe/Brussels" msgstr "Европа/Брюссель" #: kdecore/TIMEZONES:854 #, kde-format msgid "Europe/Bucharest" msgstr "Европа/Бухарест" #: kdecore/TIMEZONES:855 #, kde-format msgid "Europe/Budapest" msgstr "Европа/Будапешт" #: kdecore/TIMEZONES:856 #, kde-format msgid "Europe/Chisinau" msgstr "Европа/Кишинёв" #: kdecore/TIMEZONES:857 #, kde-format msgid "Europe/Copenhagen" msgstr "Европа/Копенгаген" #: kdecore/TIMEZONES:858 #, kde-format msgid "Europe/Dublin" msgstr "Европа/Дублин" #: kdecore/TIMEZONES:859 #, kde-format msgid "Europe/Gibraltar" msgstr "Европа/Гибралтар" #: kdecore/TIMEZONES:860 #, kde-format msgid "Europe/Guernsey" msgstr "Европа/Гернси" #: kdecore/TIMEZONES:861 #, kde-format msgid "Europe/Helsinki" msgstr "Европа/Хельсинки" #: kdecore/TIMEZONES:862 #, kde-format msgid "Europe/Isle_of_Man" msgstr "Европа/Остров_Мэн" #: kdecore/TIMEZONES:863 #, kde-format msgid "Europe/Istanbul" msgstr "Европа/Стамбул" #: kdecore/TIMEZONES:864 #, kde-format msgid "Europe/Jersey" msgstr "Европа/Джерси" #: kdecore/TIMEZONES:865 #, kde-format msgid "Europe/Kaliningrad" msgstr "Европа/Калининград" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:867 #, kde-format msgid "Moscow-01 - Kaliningrad" msgstr "Московское время-01 — Калининград" #: kdecore/TIMEZONES:868 #, kde-format msgid "Europe/Kiev" msgstr "Европа/Киев" #: kdecore/TIMEZONES:871 #, kde-format msgid "Europe/Lisbon" msgstr "Европа/Лиссабон" #: kdecore/TIMEZONES:874 #, kde-format msgid "Europe/Ljubljana" msgstr "Европа/Любляна" #: kdecore/TIMEZONES:875 #, kde-format msgid "Europe/London" msgstr "Европа/Лондон" #: kdecore/TIMEZONES:876 #, kde-format msgid "Europe/Luxembourg" msgstr "Европа/Люксембург" #: kdecore/TIMEZONES:877 #, kde-format msgid "Europe/Madrid" msgstr "Европа/Мадрид" #: kdecore/TIMEZONES:880 #, kde-format msgid "Europe/Malta" msgstr "Европа/Мальта" #: kdecore/TIMEZONES:881 #, kde-format msgid "Europe/Mariehamn" msgstr "Европа/Мариехамн" #: kdecore/TIMEZONES:882 #, kde-format msgid "Europe/Minsk" msgstr "Европа/Минск" #: kdecore/TIMEZONES:883 #, kde-format msgid "Europe/Monaco" msgstr "Европа/Монако" #: kdecore/TIMEZONES:884 #, kde-format msgid "Europe/Moscow" msgstr "Европа/Москва" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:886 kdecore/TIMEZONES:1099 #, kde-format msgid "Moscow+00 - west Russia" msgstr "Московское время+00 — европейская часть России" #: kdecore/TIMEZONES:887 #, kde-format msgid "Europe/Oslo" msgstr "Европа/Осло" #: kdecore/TIMEZONES:888 #, kde-format msgid "Europe/Paris" msgstr "Европа/Париж" #: kdecore/TIMEZONES:889 #, kde-format msgid "Europe/Podgorica" msgstr "Европа/Подгорица" #: kdecore/TIMEZONES:890 #, kde-format msgid "Europe/Prague" msgstr "Европа/Прага" #: kdecore/TIMEZONES:891 #, kde-format msgid "Europe/Riga" msgstr "Европа/Рига" #: kdecore/TIMEZONES:892 #, kde-format msgid "Europe/Rome" msgstr "Европа/Рим" #: kdecore/TIMEZONES:893 #, kde-format msgid "Europe/Samara" msgstr "Европа/Самара" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:895 #, kde-format msgid "Moscow+01 - Samara, Udmurtia" msgstr "Московское время+01 — Самара, Удмуртия" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:897 #, kde-format msgid "Moscow+00 - Samara, Udmurtia" msgstr "Московское время+00 — Самара, Удмуртия" #: kdecore/TIMEZONES:898 #, kde-format msgid "Europe/San_Marino" msgstr "Европа/Сан-Марино" #: kdecore/TIMEZONES:899 #, kde-format msgid "Europe/Sarajevo" msgstr "Европа/Сараево" #: kdecore/TIMEZONES:900 #, kde-format msgid "Europe/Simferopol" msgstr "Европа/Симферополь" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:902 #, kde-format msgid "central Crimea" msgstr "Центральный Крым" #: kdecore/TIMEZONES:903 #, kde-format msgid "Europe/Skopje" msgstr "Европа/Скопье" #: kdecore/TIMEZONES:904 #, kde-format msgid "Europe/Sofia" msgstr "Европа/София" #: kdecore/TIMEZONES:905 #, kde-format msgid "Europe/Stockholm" msgstr "Европа/Стокгольм" #: kdecore/TIMEZONES:906 #, kde-format msgid "Europe/Tallinn" msgstr "Европа/Таллинн" #: kdecore/TIMEZONES:907 #, kde-format msgid "Europe/Tirane" msgstr "Европа/Тирана" #: kdecore/TIMEZONES:908 #, kde-format msgid "Europe/Tiraspol" msgstr "Европа/Тирасполь" #: kdecore/TIMEZONES:909 #, kde-format msgid "Europe/Uzhgorod" msgstr "Европа/Ужгород" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:911 #, kde-format msgid "Ruthenia" msgstr "Русь" #: kdecore/TIMEZONES:912 #, kde-format msgid "Europe/Vaduz" msgstr "Европа/Вадуц" #: kdecore/TIMEZONES:913 #, kde-format msgid "Europe/Vatican" msgstr "Европа/Ватикан" #: kdecore/TIMEZONES:914 #, kde-format msgid "Europe/Vienna" msgstr "Европа/Вена" #: kdecore/TIMEZONES:915 #, kde-format msgid "Europe/Vilnius" msgstr "Европа/Вильнюс" #: kdecore/TIMEZONES:916 #, kde-format msgid "Europe/Volgograd" msgstr "Европа/Волгоград" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:918 #, kde-format msgid "Moscow+00 - Caspian Sea" msgstr "Московское время+00 — Каспийское море" #: kdecore/TIMEZONES:919 #, kde-format msgid "Europe/Warsaw" msgstr "Европа/Варшава" #: kdecore/TIMEZONES:920 #, kde-format msgid "Europe/Zagreb" msgstr "Европа/Загреб" #: kdecore/TIMEZONES:921 #, kde-format msgid "Europe/Zaporozhye" msgstr "Европа/Запорожье" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:923 #, kde-format msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" msgstr "Запорожье, Луганск" #: kdecore/TIMEZONES:924 #, kde-format msgid "Europe/Zurich" msgstr "Европа/Цюрих" #: kdecore/TIMEZONES:925 #, kde-format msgid "GB" msgstr "Великобритания" #: kdecore/TIMEZONES:926 #, kde-format msgid "GB-Eire" msgstr "Ирландия (Великобритания)" #: kdecore/TIMEZONES:927 #, kde-format msgid "Hongkong" msgstr "Гонконг" #: kdecore/TIMEZONES:928 #, kde-format msgid "Iceland" msgstr "Исландия" #: kdecore/TIMEZONES:929 #, kde-format msgid "Indian/Antananarivo" msgstr "Индийский океан/Антананариву" #: kdecore/TIMEZONES:930 #, kde-format msgid "Indian/Chagos" msgstr "Индийский океан/арх. Чагос" #: kdecore/TIMEZONES:931 #, kde-format msgid "Indian/Christmas" msgstr "Индийский океан/о. Рождества" #: kdecore/TIMEZONES:932 #, kde-format msgid "Indian/Cocos" msgstr "Индийский океан/Кокосовые острова" #: kdecore/TIMEZONES:933 #, kde-format msgid "Indian/Comoro" msgstr "Индийский океан/Коморские острова" #: kdecore/TIMEZONES:934 #, kde-format msgid "Indian/Kerguelen" msgstr "Индийский океан/Кергелен" #: kdecore/TIMEZONES:935 #, kde-format msgid "Indian/Mahe" msgstr "Индийский океан/Маэ" #: kdecore/TIMEZONES:936 #, kde-format msgid "Indian/Maldives" msgstr "Индийский океан/Мальдивские острова" #: kdecore/TIMEZONES:937 #, kde-format msgid "Indian/Mauritius" msgstr "Индийский океан/Маврикий" #: kdecore/TIMEZONES:938 #, kde-format msgid "Indian/Mayotte" msgstr "Индийский океан/Майотта" #: kdecore/TIMEZONES:939 #, kde-format msgid "Indian/Reunion" msgstr "Индийский океан/Реюньон" #: kdecore/TIMEZONES:940 #, kde-format msgid "Iran" msgstr "Иран" #: kdecore/TIMEZONES:941 #, kde-format msgid "Israel" msgstr "Израиль" #: kdecore/TIMEZONES:942 #, kde-format msgid "Jamaica" msgstr "Ямайка" #: kdecore/TIMEZONES:943 #, kde-format msgid "Japan" msgstr "Япония" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:944 kdecore/TIMEZONES:946 kdecore/TIMEZONES:1011 #, kde-format msgid "Kwajalein" msgstr "Квайалейн" #: kdecore/TIMEZONES:947 #, kde-format msgid "Libya" msgstr "Ливия" #: kdecore/TIMEZONES:948 #, kde-format msgid "Mexico/BajaNorte" msgstr "Мексика/Нижняя_Калифорния" #: kdecore/TIMEZONES:951 #, kde-format msgid "Mexico/BajaSur" msgstr "Мексика/Южная_Нижняя_Калифорния" #: kdecore/TIMEZONES:954 #, kde-format msgid "Mexico/General" msgstr "Мексика/Основная_территория" #: kdecore/TIMEZONES:957 #, kde-format msgid "NZ" msgstr "Новая Зеландия" #: kdecore/TIMEZONES:960 #, kde-format msgid "NZ-CHAT" msgstr "Чатем (Новая Зеландия)" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:962 kdecore/TIMEZONES:975 #, kde-format msgid "Chatham Islands" msgstr "Острова Чатем" #: kdecore/TIMEZONES:963 #, kde-format msgid "Navajo" msgstr "Навахо" #: kdecore/TIMEZONES:966 #, kde-format msgid "PRC" msgstr "Китай" #: kdecore/TIMEZONES:969 #, kde-format msgid "Pacific/Apia" msgstr "Тихий океан/Апиа" #: kdecore/TIMEZONES:970 #, kde-format msgid "Pacific/Auckland" msgstr "Тихий океан/Окленд" #: kdecore/TIMEZONES:973 #, kde-format msgid "Pacific/Chatham" msgstr "Тихий океан/Чатем" #: kdecore/TIMEZONES:976 #, kde-format msgid "Pacific/Chuuk" msgstr "Тихий океан/острова Чуук (Трук)" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:978 #, kde-format msgid "Chuuk (Truk) and Yap" msgstr "Острова Чуук (Трук) и Яп" #: kdecore/TIMEZONES:979 #, kde-format msgid "Pacific/Easter" msgstr "Тихий океан/Пасхи" #: kdecore/TIMEZONES:982 #, kde-format msgid "Pacific/Efate" msgstr "Тихий океан/Эфате" #: kdecore/TIMEZONES:983 #, kde-format msgid "Pacific/Enderbury" msgstr "Тихий океан/Эндербери" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:985 #, kde-format msgid "Phoenix Islands" msgstr "Острова Феникс" #: kdecore/TIMEZONES:986 #, kde-format msgid "Pacific/Fakaofo" msgstr "Тихий океан/Факаофо" #: kdecore/TIMEZONES:987 #, kde-format msgid "Pacific/Fiji" msgstr "Тихий океан/Фиджи" #: kdecore/TIMEZONES:988 #, kde-format msgid "Pacific/Funafuti" msgstr "Тихий океан/Фунафути" #: kdecore/TIMEZONES:989 #, kde-format msgid "Pacific/Galapagos" msgstr "Тихий океан/Галапагосские острова" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:991 #, kde-format msgid "Galapagos Islands" msgstr "Галапагосские острова" #: kdecore/TIMEZONES:992 #, kde-format msgid "Pacific/Gambier" msgstr "Тихий океан/острова Гамбье" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:994 #, kde-format msgid "Gambier Islands" msgstr "Острова Гамбье" #: kdecore/TIMEZONES:995 #, kde-format msgid "Pacific/Guadalcanal" msgstr "Тихий океан/Гуадалканал" #: kdecore/TIMEZONES:996 #, kde-format msgid "Pacific/Guam" msgstr "Тихий океан/Гуам" #: kdecore/TIMEZONES:997 #, kde-format msgid "Pacific/Honolulu" msgstr "Тихий океан/Гонолулу" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:999 kdecore/TIMEZONES:1083 #, kde-format msgid "Hawaii" msgstr "Гавайи" #: kdecore/TIMEZONES:1000 #, kde-format msgid "Pacific/Johnston" msgstr "Тихий океан/Джонстон" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1002 #, kde-format msgid "Johnston Atoll" msgstr "Атолл Джонстон" #: kdecore/TIMEZONES:1003 #, kde-format msgid "Pacific/Kiritimati" msgstr "Тихий океан/Киритимати" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1005 #, kde-format msgid "Line Islands" msgstr "Острова Лайн" #: kdecore/TIMEZONES:1006 #, kde-format msgid "Pacific/Kosrae" msgstr "Тихий океан/Косрае" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1008 #, kde-format msgid "Kosrae" msgstr "Косрае" #: kdecore/TIMEZONES:1009 #, kde-format msgid "Pacific/Kwajalein" msgstr "Тихий океан/Квайалейн" #: kdecore/TIMEZONES:1012 #, kde-format msgid "Pacific/Majuro" msgstr "Тихий океан/Маджуро" #: kdecore/TIMEZONES:1015 #, kde-format msgid "Pacific/Marquesas" msgstr "Тихий океан/Маркизские острова" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1017 #, kde-format msgid "Marquesas Islands" msgstr "Маркизские острова" #: kdecore/TIMEZONES:1018 #, kde-format msgid "Pacific/Midway" msgstr "Тихий океан/Мидуэй" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1020 #, kde-format msgid "Midway Islands" msgstr "Острова Мидуэй" #: kdecore/TIMEZONES:1021 #, kde-format msgid "Pacific/Nauru" msgstr "Тихий океан/Науру" #: kdecore/TIMEZONES:1022 #, kde-format msgid "Pacific/Niue" msgstr "Тихий океан/Нуе" #: kdecore/TIMEZONES:1023 #, kde-format msgid "Pacific/Norfolk" msgstr "Тихий океан/Норфолк" #: kdecore/TIMEZONES:1024 #, kde-format msgid "Pacific/Noumea" msgstr "Тихий океан/Нумеа" #: kdecore/TIMEZONES:1025 #, kde-format msgid "Pacific/Pago_Pago" msgstr "Тихий океан/Паго-Паго" #: kdecore/TIMEZONES:1026 #, kde-format msgid "Pacific/Palau" msgstr "Тихий океан/Палау" #: kdecore/TIMEZONES:1027 #, kde-format msgid "Pacific/Pitcairn" msgstr "Тихий океан/Питкэрн" #: kdecore/TIMEZONES:1028 #, kde-format msgid "Pacific/Pohnpei" msgstr "Тихий океан/Понпеи" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1030 #, kde-format msgid "Pohnpei (Ponape)" msgstr "Понпеи (Понапе)" #: kdecore/TIMEZONES:1031 #, kde-format msgid "Pacific/Ponape" msgstr "Тихий океан/Понапе" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1033 #, kde-format msgid "Ponape (Pohnpei)" msgstr "Понпеи (Понапе)" #: kdecore/TIMEZONES:1034 #, kde-format msgid "Pacific/Port_Moresby" msgstr "Тихий океан/Порт-Морсби" #: kdecore/TIMEZONES:1035 #, kde-format msgid "Pacific/Rarotonga" msgstr "Тихий океан/Раротонга" #: kdecore/TIMEZONES:1036 #, kde-format msgid "Pacific/Saipan" msgstr "Тихий океан/Сайпан" #: kdecore/TIMEZONES:1037 #, kde-format msgid "Pacific/Samoa" msgstr "Тихий океан/Самоа" #: kdecore/TIMEZONES:1038 #, kde-format msgid "Pacific/Tahiti" msgstr "Тихий океан/Таити" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1040 #, kde-format msgid "Society Islands" msgstr "Острова Общества" #: kdecore/TIMEZONES:1041 #, kde-format msgid "Pacific/Tarawa" msgstr "Тихий океан/Тарава" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1043 #, kde-format msgid "Gilbert Islands" msgstr "Острова Гилберта и Эллис" #: kdecore/TIMEZONES:1044 #, kde-format msgid "Pacific/Tongatapu" msgstr "Тихий океан/Тонгатапу" #: kdecore/TIMEZONES:1045 #, kde-format msgid "Pacific/Truk" msgstr "Тихий океан/острова Трук" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1047 kdecore/TIMEZONES:1054 #, kde-format msgid "Truk (Chuuk) and Yap" msgstr "Острова Чуук" #: kdecore/TIMEZONES:1048 #, kde-format msgid "Pacific/Wake" msgstr "Тихий океан/Уэйк" #. i18n: comment to the previous timezone #: kdecore/TIMEZONES:1050 #, kde-format msgid "Wake Island" msgstr "Остров Уэйк" #: kdecore/TIMEZONES:1051 #, kde-format msgid "Pacific/Wallis" msgstr "Тихий океан/Уоллис" #: kdecore/TIMEZONES:1052 #, kde-format msgid "Pacific/Yap" msgstr "Тихий океан/Яп" #: kdecore/TIMEZONES:1055 #, kde-format msgid "Poland" msgstr "Польша" #: kdecore/TIMEZONES:1056 #, kde-format msgid "Portugal" msgstr "Португалия" #: kdecore/TIMEZONES:1059 #, kde-format msgid "ROC" msgstr "Тайвань" #: kdecore/TIMEZONES:1060 #, kde-format msgid "ROK" msgstr "Южная Корея" #: kdecore/TIMEZONES:1061 #, kde-format msgid "Singapore" msgstr "Сингапур" #: kdecore/TIMEZONES:1062 #, kde-format msgid "Turkey" msgstr "Турция" #: kdecore/TIMEZONES:1063 #, kde-format msgid "US/Alaska" msgstr "США/Аляска" #: kdecore/TIMEZONES:1066 #, kde-format msgid "US/Aleutian" msgstr "США/Алеутские_острова" #: kdecore/TIMEZONES:1069 #, kde-format msgid "US/Arizona" msgstr "США/Аризона" #: kdecore/TIMEZONES:1072 #, kde-format msgid "US/Central" msgstr "США/Среднеамериканское_время" #: kdecore/TIMEZONES:1075 #, kde-format msgid "US/East-Indiana" msgstr "США/Восточная_Индиана" #: kdecore/TIMEZONES:1078 #, kde-format msgid "US/Eastern" msgstr "США/Восточное_время" #: kdecore/TIMEZONES:1081 #, kde-format msgid "US/Hawaii" msgstr "США/Гавайи" #: kdecore/TIMEZONES:1084 #, kde-format msgid "US/Indiana-Starke" msgstr "США/Индиана-Старк" #: kdecore/TIMEZONES:1087 #, kde-format msgid "US/Michigan" msgstr "США/Мичиган" #: kdecore/TIMEZONES:1090 #, kde-format msgid "US/Mountain" msgstr "США/Горное_время" #: kdecore/TIMEZONES:1093 #, kde-format msgid "US/Pacific" msgstr "США/Тихоокеанское_время" #: kdecore/TIMEZONES:1096 #, kde-format msgid "US/Samoa" msgstr "США/Самоа" #: kdecore/TIMEZONES:1097 #, kde-format msgid "W-SU" msgstr "Европейская часть России" #. i18n: Generic sans serif font presented in font choosers. When selected, #. the system will choose a real font, mandated by distro settings. #: kdeui/fonthelpers.cpp:29 #, kde-format msgctxt "@item Font name" msgid "Sans Serif" msgstr "Sans Serif" #. i18n: Generic serif font presented in font choosers. When selected, #. the system will choose a real font, mandated by distro settings. #: kdeui/fonthelpers.cpp:32 #, kde-format msgctxt "@item Font name" msgid "Serif" msgstr "Serif" #. i18n: Generic monospace font presented in font choosers. When selected, #. the system will choose a real font, mandated by distro settings. #: kdeui/fonthelpers.cpp:35 #, kde-format msgctxt "@item Font name" msgid "Monospace" msgstr "Monospace" #: kdeui/k4timezonewidget.cpp:62 #, kde-format msgctxt "Define an area in the time zone, like a town area" msgid "Area" msgstr "Регион" #: kdeui/k4timezonewidget.cpp:62 #, kde-format msgctxt "Time zone" msgid "Region" msgstr "Область" #: kdeui/k4timezonewidget.cpp:62 #, kde-format msgid "Comment" msgstr "Комментарий" #: kdeui/kapplication.cpp:746 #, kde-format msgid "The style '%1' was not found" msgstr "Стиль «%1» не найден" #: kdeui/kcolordialog.cpp:102 #, kde-format msgctxt "palette name" msgid "* Recent Colors *" msgstr "* Последние цвета *" #: kdeui/kcolordialog.cpp:103 #, kde-format msgctxt "palette name" msgid "* Custom Colors *" msgstr "* Собственные цвета *" #: kdeui/kcolordialog.cpp:104 #, kde-format msgctxt "palette name" msgid "Forty Colors" msgstr "Сорок основных цветов" #: kdeui/kcolordialog.cpp:105 #, kde-format msgctxt "palette name" msgid "Oxygen Colors" msgstr "Цвета Oxygen" #: kdeui/kcolordialog.cpp:106 #, kde-format msgctxt "palette name" msgid "Rainbow Colors" msgstr "Радужные цвета" #: kdeui/kcolordialog.cpp:107 #, kde-format msgctxt "palette name" msgid "Royal Colors" msgstr "Королевские цвета" #: kdeui/kcolordialog.cpp:108 #, kde-format msgctxt "palette name" msgid "Web Colors" msgstr "Цвета веб" #: kdeui/kcolordialog.cpp:572 #, kde-format msgid "Named Colors" msgstr "Именованные цвета" #: kdeui/kcolordialog.cpp:746 #, kde-format msgctxt "" "%1 is the number of paths, %2 is the list of paths (with newlines between " "them)" msgid "" "Unable to read X11 RGB color strings. The following file location was " "examined:\n" "%2" msgid_plural "" "Unable to read X11 RGB color strings. The following file locations were " "examined:\n" "%2" msgstr[0] "" "Не удалось получить определения цветов X11 ни из одного из следующих " "расположений:\n" "%2" msgstr[1] "" "Не удалось получить определения цветов X11 ни из одного из следующих " "расположений:\n" "%2" msgstr[2] "" "Не удалось получить определения цветов X11 ни из одного из следующих " "расположений:\n" "%2" msgstr[3] "" "Не удалось получить определения цветов X11 из следующего расположения:\n" "%2" #: kdeui/kcolordialog.cpp:997 #, kde-format msgid "Select Color" msgstr "Выбор цвета" #: kdeui/kcolordialog.cpp:1077 #, kde-format msgid "Hue:" msgstr "Тон:" #: kdeui/kcolordialog.cpp:1083 #, kde-format msgctxt "The angular degree unit (for hue)" msgid "°" msgstr "°" #: kdeui/kcolordialog.cpp:1088 #, kde-format msgid "Saturation:" msgstr "Насыщенность:" #: kdeui/kcolordialog.cpp:1098 #, kde-format msgctxt "This is the V of HSV" msgid "Value:" msgstr "Значение:" #: kdeui/kcolordialog.cpp:1111 #, kde-format msgid "Red:" msgstr "Красный:" #: kdeui/kcolordialog.cpp:1121 #, kde-format msgid "Green:" msgstr "Зелёный:" #: kdeui/kcolordialog.cpp:1131 #, kde-format msgid "Blue:" msgstr "Синий:" #: kdeui/kcolordialog.cpp:1152 #, kde-format msgid "Alpha:" msgstr "Альфа-канал:" #: kdeui/kcolordialog.cpp:1206 #, kde-format msgid "&Add to Custom Colors" msgstr "&Добавить в собственные цвета" #: kdeui/kcolordialog.cpp:1234 #, kde-format msgid "Name:" msgstr "Название:" #: kdeui/kcolordialog.cpp:1241 #, kde-format msgid "HTML:" msgstr "HTML:" #: kdeui/kcolordialog.cpp:1328 #, kde-format msgid "Default color" msgstr "Цвет по умолчанию" #: kdeui/kcolordialog.cpp:1393 #, kde-format msgid "-default-" msgstr "-по умолчанию-" #: kdeui/kcolordialog.cpp:1668 #, kde-format msgid "-unnamed-" msgstr "-безымянный-" #: kdeui/kdeprintdialog.cpp:40 #, kde-format msgctxt "@title:window" msgid "Print" msgstr "Печать" #: kdeui/kdialog.cpp:271 #, kde-format msgid "&Try" msgstr "&Попробовать" #: kdeui/kdialog.cpp:484 #, kde-format msgid "modified" msgstr "изменён" #: kdeui/kdialog.cpp:495 #, kde-format msgctxt "Document/application separator in titlebar" msgid " – " msgstr " — " #: kdeui/kdialog.cpp:896 #, kde-format msgid "&Details" msgstr "&Подробности" #: kdeui/kdialog.cpp:1054 #, kde-format msgid "Get help..." msgstr "Справка..." #: kdeui/keditlistbox.cpp:324 #, kde-format msgid "&Add" msgstr "Доб&авить" #: kdeui/keditlistbox.cpp:336 #, kde-format msgid "&Remove" msgstr "&Удалить" #: kdeui/keditlistbox.cpp:348 #, kde-format msgid "Move &Up" msgstr "Переместить вв&ерх" #: kdeui/keditlistbox.cpp:353 #, kde-format msgid "Move &Down" msgstr "Переместить &вниз" # BUGME: make it shorter in Russian! --aspotashev #. i18n: A shorter version of the alphabet test phrase translated in #. another message. It is displayed in the dropdown list of font previews #. (the font selection combo box), so keep it under the length equivalent #. to 60 or so proportional Latin characters. #: kdeui/kfontcombobox.cpp:48 #, kde-format msgctxt "short" msgid "The Quick Brown Fox Jumps Over The Lazy Dog" msgstr "" "Широкая электрификация южных губерний даст мощный толчок подъёму сельского " "хозяйства" # QFontDatabase::Cyrillic = 3 # --aspotashev #. i18n: Integer which indicates the script you used in the sample text #. for font previews in your language. For the possible values, see #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum #. If the sample text contains several scripts, their IDs can be given #. as a comma-separated list (e.g. for Japanese it is "1,27"). #: kdeui/kfontcombobox.cpp:119 #, kde-format msgctxt "Numeric IDs of scripts for font previews" msgid "1" msgstr "3" #: kdeui/kfontdialog.cpp:51 #, kde-format msgid "Select Font" msgstr "Выбор шрифта" #: kdeui/kprintpreview.cpp:119 #, kde-format msgid "Could not load print preview part" msgstr "Не удалось загрузить компонент предварительного просмотра" #: kdeui/kprintpreview.cpp:136 #, kde-format msgid "Print Preview" msgstr "Предварительный просмотр" #: kdeui/ksystemtrayicon.cpp:153 #, kde-format msgid "Minimize" msgstr "Свернуть" #: kdeui/ksystemtrayicon.cpp:205 #, kde-format msgid "&Minimize" msgstr "&Свернуть" #: kdeui/ksystemtrayicon.cpp:207 #, kde-format msgid "&Restore" msgstr "Восст&ановить" #: kdeui/ksystemtrayicon.cpp:226 #, kde-format msgid "Are you sure you want to quit %1?" msgstr "Выйти из программы %1?" #: kdeui/ksystemtrayicon.cpp:229 #, kde-format msgid "Confirm Quit From System Tray" msgstr "Подтверждение выхода из программы" #: kdeui/kundostack.cpp:47 #, kde-format msgid "Redo" msgstr "Повторить" #: kdeui/kundostack.cpp:66 #, kde-format msgid "Undo" msgstr "Отменить" #: kdeui/kuniqueapplication.cpp:79 #, kde-format msgid "Do not run in the background." msgstr "Не запускать в фоновом режиме." #: kdeui/kuniqueapplication.cpp:81 #, kde-format msgid "Internally added if launched from Finder" msgstr "Добавлено изнутри, если запущено из Finder" #: kio/kcommentwidget.cpp:68 #, kde-format msgctxt "@label" msgid "Add Comment..." msgstr "Добавить..." #: kio/kcommentwidget.cpp:74 #, kde-format msgctxt "@label" msgid "Change..." msgstr "Изменить..." #: kio/kcommentwidget.cpp:128 #, kde-format msgctxt "@title:window" msgid "Change Comment" msgstr "Изменение комментария" #: kio/kcommentwidget.cpp:129 #, kde-format msgctxt "@title:window" msgid "Add Comment" msgstr "Добавление комментария" #: kio/kdevicelistmodel.cpp:116 #, kde-format msgid "Device name" msgstr "Имя устройства" #: kio/kdirselectdialog.cpp:136 #, kde-format msgctxt "folder name" msgid "New Folder" msgstr "Новая папка" #: kio/kdirselectdialog.cpp:141 #, kde-format msgctxt "@title:window" msgid "New Folder" msgstr "Новая папка" #: kio/kdirselectdialog.cpp:142 #, kde-format msgctxt "@label:textbox" msgid "" "Create new folder in:\n" "%1" msgstr "" "Создать новую папку в:\n" "%1" #: kio/kdirselectdialog.cpp:172 #, kde-format msgid "A file or folder named %1 already exists." msgstr "Файл или папка с именем %1 уже существует." #: kio/kdirselectdialog.cpp:175 #, kde-format msgid "You do not have permission to create that folder." msgstr "У вас нет прав для создания этой папки." #: kio/kdirselectdialog.cpp:290 #, kde-format msgctxt "@title:window" msgid "Select Folder" msgstr "Выбор папки" #: kio/kdirselectdialog.cpp:299 #, kde-format msgctxt "@action:button" msgid "New Folder..." msgstr "Создать папку..." #: kio/kdirselectdialog.cpp:345 #, kde-format msgctxt "@action:inmenu" msgid "New Folder..." msgstr "Создать папку..." #: kio/kdirselectdialog.cpp:352 #, kde-format msgctxt "@action:inmenu" msgid "Move to Trash" msgstr "Удалить в корзину" #: kio/kdirselectdialog.cpp:359 #, kde-format msgctxt "@action:inmenu" msgid "Delete" msgstr "Удалить" #: kio/kdirselectdialog.cpp:368 #, kde-format msgctxt "@option:check" msgid "Show Hidden Folders" msgstr "Показывать скрытые папки" #: kio/kdirselectdialog.cpp:375 #, kde-format msgctxt "@action:inmenu" msgid "Properties" msgstr "Свойства" #: kio/kfiledialog.cpp:132 #, kde-format msgid "*|All files" msgstr "*|Все файлы" #: kio/kfiledialog.cpp:332 #, kde-format msgid "All Supported Files" msgstr "Все поддерживаемые файлы" #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:490 #: kio/kfiledialog.cpp:514 kio/kfiledialog.cpp:524 kio/kfiledialog.cpp:552 #: kio/kfiledialog.cpp:590 kio/kfiledialog.cpp:642 #, kde-format msgid "Open" msgstr "Открыть" #: kio/kfiledialog.cpp:733 kio/kfiledialog.cpp:753 kio/kfiledialog.cpp:792 #: kio/kfiledialog.cpp:836 #, kde-format msgid "Save As" msgstr "Сохранить как" #: kio/kfilemetadataprovider.cpp:245 #, kde-format msgctxt "@item:intable" msgid "%1 item" msgid_plural "%1 items" msgstr[0] "%1 объект" msgstr[1] "%1 объекта" msgstr[2] "%1 объектов" msgstr[3] "%1 объект" #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 #, kde-format msgctxt "@label" msgid "Comment" msgstr "Комментарий" #: kio/kfilemetadataprovider.cpp:447 #, kde-format msgctxt "@label" msgid "Modified" msgstr "Дата изменения" #: kio/kfilemetadataprovider.cpp:448 #, kde-format msgctxt "@label" msgid "Owner" msgstr "Владелец" #: kio/kfilemetadataprovider.cpp:449 #, kde-format msgctxt "@label" msgid "Permissions" msgstr "Права доступа" #: kio/kfilemetadataprovider.cpp:450 #, kde-format msgctxt "@label" msgid "Rating" msgstr "Оценка" #: kio/kfilemetadataprovider.cpp:451 #, kde-format msgctxt "@label" msgid "Size" msgstr "Размер" #: kio/kfilemetadataprovider.cpp:452 #, kde-format msgctxt "@label" msgid "Tags" msgstr "Метки" #: kio/kfilemetadataprovider.cpp:453 #, kde-format msgctxt "@label" msgid "Total Size" msgstr "Общий размер" #: kio/kfilemetadataprovider.cpp:454 #, kde-format msgctxt "@label" msgid "Type" msgstr "Тип" #: kio/kfilemetadatareaderprocess.cpp:234 #, kde-format msgid "KFileMetaDataReader" msgstr "KFileMetaDataReader" #: kio/kfilemetadatareaderprocess.cpp:236 #, kde-format msgid "KFileMetaDataReader can be used to read metadata from a file" msgstr "KFileMetaDataReader предназначен для чтения метаданных из файлов" #: kio/kfilemetadatareaderprocess.cpp:238 #, kde-format msgid "(C) 2011, Peter Penz" msgstr "© Peter Penz, 2011" #: kio/kfilemetadatareaderprocess.cpp:239 #, kde-format msgid "Peter Penz" msgstr "Peter Penz" #: kio/kfilemetadatareaderprocess.cpp:239 #, kde-format msgid "Current maintainer" msgstr "Сопровождающий" #: kio/kfilemetadatareaderprocess.cpp:244 #, kde-format msgid "Only the meta data that is part of the file is read" msgstr "Читать только метаданные, которые являются частью файла" #: kio/kfilemetadatareaderprocess.cpp:245 #, kde-format msgid "List of URLs where the meta-data should be read from" msgstr "Список адресов (URL) файлов, из которых следует прочитать метаданные" #: kio/kfilemetainfowidget.cpp:161 #, kde-format msgid "" msgstr "<Ошибка>" #: kio/kfiletreeview.cpp:192 #, kde-format msgid "Show Hidden Folders" msgstr "Показывать скрытые папки" #: kio/kimageio.cpp:46 #, kde-format msgid "All Pictures" msgstr "Все изображения" #: kio/kmetaprops.cpp:57 #, kde-format msgctxt "@title:window" msgid "Configure Shown Data" msgstr "Выбор показываемых сведений" #: kio/kmetaprops.cpp:60 #, kde-format msgctxt "@label::textbox" msgid "Select which data should be shown:" msgstr "Выберите сведения, которые вы хотите видеть:" #: kio/kmetaprops.cpp:123 #, kde-format msgctxt "@action:button" msgid "Configure..." msgstr "Настроить..." #: kio/kmetaprops.cpp:133 #, kde-format msgctxt "@title:tab" msgid "Information" msgstr "Сведения" #: kio/knfotranslator.cpp:40 #, kde-format msgctxt "@label creation date" msgid "Created" msgstr "Создано" #: kio/knfotranslator.cpp:41 #, kde-format msgctxt "@label file content size" msgid "Size" msgstr "Размер" #: kio/knfotranslator.cpp:42 #, kde-format msgctxt "@label file depends from" msgid "Depends" msgstr "Зависимости" #: kio/knfotranslator.cpp:43 #, kde-format msgctxt "@label" msgid "Description" msgstr "Описание" #: kio/knfotranslator.cpp:44 #, kde-format msgctxt "@label Software used to generate content" msgid "Generator" msgstr "Программа" #: kio/knfotranslator.cpp:45 #, kde-format msgctxt "" "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" msgid "Has Part" msgstr "Является частью" #: kio/knfotranslator.cpp:46 #, kde-format msgctxt "" "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/" "nie#hasLogicalPart" msgid "Has Logical Part" msgstr "Является частью" #: kio/knfotranslator.cpp:47 #, kde-format msgctxt "@label parent directory" msgid "Part of" msgstr "В папке" #: kio/knfotranslator.cpp:48 #, kde-format msgctxt "@label" msgid "Keyword" msgstr "Ключевое слово" #: kio/knfotranslator.cpp:49 #, kde-format msgctxt "@label modified date of file" msgid "Modified" msgstr "Дата изменения" #: kio/knfotranslator.cpp:50 #, kde-format msgctxt "@label" msgid "MIME Type" msgstr "Тип MIME" #: kio/knfotranslator.cpp:51 #, kde-format msgctxt "@label" msgid "Content" msgstr "Содержимое" #: kio/knfotranslator.cpp:52 #, kde-format msgctxt "@label" msgid "Related To" msgstr "Относится к" #: kio/knfotranslator.cpp:53 #, kde-format msgctxt "@label" msgid "Subject" msgstr "Тема" #: kio/knfotranslator.cpp:54 #, kde-format msgctxt "@label music title" msgid "Title" msgstr "Название" #: kio/knfotranslator.cpp:55 #, kde-format msgctxt "@label file URL" msgid "File Location" msgstr "Расположение файла" #: kio/knfotranslator.cpp:56 #, kde-format msgctxt "@label" msgid "Creator" msgstr "Автор" #: kio/knfotranslator.cpp:57 #, kde-format msgctxt "@label" msgid "Average Bitrate" msgstr "Средний битрейт" #: kio/knfotranslator.cpp:58 #, kde-format msgctxt "@label" msgid "Channels" msgstr "Число каналов" #: kio/knfotranslator.cpp:59 #, kde-format msgctxt "@label number of characters" msgid "Characters" msgstr "Символов" #: kio/knfotranslator.cpp:60 #, kde-format msgctxt "@label" msgid "Codec" msgstr "Кодек" #: kio/knfotranslator.cpp:61 #, kde-format msgctxt "@label" msgid "Color Depth" msgstr "Глубина цвета" #: kio/knfotranslator.cpp:62 #, kde-format msgctxt "@label" msgid "Duration" msgstr "Длительность" #: kio/knfotranslator.cpp:63 #, kde-format msgctxt "@label" msgid "Filename" msgstr "Имя файла" #: kio/knfotranslator.cpp:64 #, kde-format msgctxt "@label" msgid "Hash" msgstr "Хэш" #: kio/knfotranslator.cpp:65 #, kde-format msgctxt "@label" msgid "Height" msgstr "Высота" #: kio/knfotranslator.cpp:66 #, kde-format msgctxt "@label" msgid "Interlace Mode" msgstr "Чересстрочность" #: kio/knfotranslator.cpp:67 #, kde-format msgctxt "@label number of lines" msgid "Lines" msgstr "Строк" #: kio/knfotranslator.cpp:68 #, kde-format msgctxt "@label" msgid "Programming Language" msgstr "Язык программирования" #: kio/knfotranslator.cpp:69 #, kde-format msgctxt "@label" msgid "Sample Rate" msgstr "Частота дискретизации" #: kio/knfotranslator.cpp:70 #, kde-format msgctxt "@label" msgid "Width" msgstr "Ширина" #: kio/knfotranslator.cpp:71 #, kde-format msgctxt "@label number of words" msgid "Words" msgstr "Слов" #: kio/knfotranslator.cpp:72 #, kde-format msgctxt "@label EXIF aperture value" msgid "Aperture" msgstr "Диафрагма" #: kio/knfotranslator.cpp:73 #, kde-format msgctxt "@label EXIF" msgid "Exposure Bias Value" msgstr "Экспокоррекция" #: kio/knfotranslator.cpp:74 #, kde-format msgctxt "@label EXIF" msgid "Exposure Time" msgstr "Длительность выдержки" #: kio/knfotranslator.cpp:75 #, kde-format msgctxt "@label EXIF" msgid "Flash" msgstr "Вспышка" #: kio/knfotranslator.cpp:76 #, kde-format msgctxt "@label EXIF" msgid "Focal Length" msgstr "Фокусное расстояние" #: kio/knfotranslator.cpp:77 #, kde-format msgctxt "@label EXIF" msgid "Focal Length 35 mm" msgstr "Фокусное расстояние в 35 мм эквиваленте" #: kio/knfotranslator.cpp:78 #, kde-format msgctxt "@label EXIF" msgid "ISO Speed Ratings" msgstr "Чувствительность (ISO)" #: kio/knfotranslator.cpp:79 #, kde-format msgctxt "@label EXIF" msgid "Make" msgstr "Производитель" #: kio/knfotranslator.cpp:80 #, kde-format msgctxt "@label EXIF" msgid "Metering Mode" msgstr "Экспозамер" #: kio/knfotranslator.cpp:81 #, kde-format msgctxt "@label EXIF" msgid "Model" msgstr "Модель" #: kio/knfotranslator.cpp:82 #, kde-format msgctxt "@label EXIF" msgid "Orientation" msgstr "Ориентация" #: kio/knfotranslator.cpp:83 #, kde-format msgctxt "@label EXIF" msgid "White Balance" msgstr "Баланс белого" #: kio/knfotranslator.cpp:84 #, kde-format msgctxt "@label video director" msgid "Director" msgstr "Режиссёр" #: kio/knfotranslator.cpp:85 #, kde-format msgctxt "@label music genre" msgid "Genre" msgstr "Жанр" #: kio/knfotranslator.cpp:86 #, kde-format msgctxt "@label music album" msgid "Album" msgstr "Альбом" #: kio/knfotranslator.cpp:87 #, kde-format msgctxt "@label" msgid "Performer" msgstr "Исполнитель" #: kio/knfotranslator.cpp:88 #, kde-format msgctxt "@label" msgid "Release Date" msgstr "Дата выпуска" #: kio/knfotranslator.cpp:89 #, kde-format msgctxt "@label music track number" msgid "Track" msgstr "Номер дорожки" #: kio/knfotranslator.cpp:90 #, kde-format msgctxt "@label resource created time" msgid "Resource Created" msgstr "Создание ресурса" #: kio/knfotranslator.cpp:91 #, kde-format msgctxt "@label" msgid "Sub Resource" msgstr "Подресурс" #: kio/knfotranslator.cpp:92 #, kde-format msgctxt "@label resource last modified" msgid "Resource Modified" msgstr "Изменение ресурса" #: kio/knfotranslator.cpp:93 #, kde-format msgctxt "@label" msgid "Numeric Rating" msgstr "Числовая оценка" #: kio/knfotranslator.cpp:94 #, kde-format msgctxt "@label" msgid "Copied From" msgstr "Источник копирования" #: kio/knfotranslator.cpp:95 #, kde-format msgctxt "@label" msgid "First Usage" msgstr "Первое использование" #: kio/knfotranslator.cpp:96 #, kde-format msgctxt "@label" msgid "Last Usage" msgstr "Последнее использование" #: kio/knfotranslator.cpp:97 #, kde-format msgctxt "@label" msgid "Usage Count" msgstr "Количество использований" #: kio/knfotranslator.cpp:98 #, kde-format msgctxt "@label" msgid "Unix File Group" msgstr "Группа файла в Unix" #: kio/knfotranslator.cpp:99 #, kde-format msgctxt "@label" msgid "Unix File Mode" msgstr "Режим файла Unix" #: kio/knfotranslator.cpp:100 #, kde-format msgctxt "@label" msgid "Unix File Owner" msgstr "Владелец файла в Unix" #: kio/knfotranslator.cpp:101 #, kde-format msgctxt "@label file type" msgid "Type" msgstr "Тип" #: kio/knfotranslator.cpp:102 #, kde-format msgctxt "@label Number of fuzzy translations" msgid "Fuzzy Translations" msgstr "Неготовых переводов" #: kio/knfotranslator.cpp:103 #, kde-format msgctxt "@label Name of last translator" msgid "Last Translator" msgstr "Последний переводчик" #: kio/knfotranslator.cpp:104 #, kde-format msgctxt "@label Number of obsolete translations" msgid "Obsolete Translations" msgstr "Устаревших переводов" #: kio/knfotranslator.cpp:105 #, kde-format msgctxt "@label" msgid "Translation Source Date" msgstr "Дата оригинала" #: kio/knfotranslator.cpp:106 #, kde-format msgctxt "@label Number of total translations" msgid "Total Translations" msgstr "Всего переводов" #: kio/knfotranslator.cpp:107 #, kde-format msgctxt "@label Number of translated strings" msgid "Translated" msgstr "Переведено" #: kio/knfotranslator.cpp:108 #, kde-format msgctxt "@label" msgid "Translation Date" msgstr "Дата перевода" #: kio/knfotranslator.cpp:109 #, kde-format msgctxt "@label Number of untranslated strings" msgid "Untranslated" msgstr "Без перевода" #: kio/kpreviewprops.cpp:51 #, kde-format msgid "P&review" msgstr "П&редварительный просмотр" #: kio/kscan.cpp:49 #, kde-format msgid "Acquire Image" msgstr "Сканировать изображение" #: kio/kscan.cpp:97 #, kde-format msgid "OCR Image" msgstr "Распознать текст" #: kio/netaccess.cpp:103 #, kde-format msgid "File '%1' is not readable" msgstr "Файл «%1» недоступен для чтения" #: kio/netaccess.cpp:437 #, kde-format msgid "ERROR: Unknown protocol '%1'" msgstr "Ошибка: неизвестный протокол «%1»." #: kio/passworddialog.cpp:56 #, kde-format msgid "Authorization Dialog" msgstr "Диалог авторизации" #: kioslave/metainfo/metainfo.cpp:91 #, kde-format msgid "No metainfo for %1" msgstr "Нет метаданных для %1" #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) #: kssl/kcm/cacertificates.ui:24 #, kde-format msgid "Organization / Common Name" msgstr "Организация/общее имя (CN)" #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) #: kssl/kcm/cacertificates.ui:29 #, kde-format msgid "Organizational Unit" msgstr "Подразделение (OU)" #. i18n: ectx: property (text), widget (QPushButton, displaySelection) #: kssl/kcm/cacertificates.ui:42 #, kde-format msgid "Display..." msgstr "Свойства" #. i18n: ectx: property (text), widget (QPushButton, disableSelection) #: kssl/kcm/cacertificates.ui:68 #, kde-format msgid "Disable" msgstr "Не использовать" #. i18n: ectx: property (text), widget (QPushButton, enableSelection) #: kssl/kcm/cacertificates.ui:78 #, kde-format msgid "Enable" msgstr "Использовать" #. i18n: ectx: property (text), widget (QPushButton, removeSelection) #: kssl/kcm/cacertificates.ui:104 #, kde-format msgid "Remove" msgstr "Удалить" #. i18n: ectx: property (text), widget (QPushButton, add) #: kssl/kcm/cacertificates.ui:111 #, kde-format msgid "Add..." msgstr "Добавить..." #: kssl/kcm/cacertificatespage.cpp:140 #, kde-format msgid "System certificates" msgstr "Системные сертификаты" #: kssl/kcm/cacertificatespage.cpp:147 #, kde-format msgid "User-added certificates" msgstr "Сертификаты пользователя" #: kssl/kcm/cacertificatespage.cpp:302 #, kde-format msgid "Pick Certificates" msgstr "Выберите сертификаты" #. i18n: ectx: property (text), widget (QLabel, subjectHeading) #: kssl/kcm/displaycert.ui:23 #, kde-format msgid "Subject Information" msgstr "Кому выдано" #. i18n: ectx: property (text), widget (QLabel, issuerHeading) #: kssl/kcm/displaycert.ui:39 #, kde-format msgid "Issuer Information" msgstr "Кем выдано" #. i18n: ectx: property (text), widget (QLabel, label) #: kssl/kcm/displaycert.ui:55 #, kde-format msgid "Other" msgstr "Разное" #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) #: kssl/kcm/displaycert.ui:64 #, kde-format msgid "Validity period" msgstr "Срок действия:" #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) #: kssl/kcm/displaycert.ui:78 #, kde-format msgid "Serial number" msgstr "Серийный номер:" #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) #: kssl/kcm/displaycert.ui:92 #, kde-format msgid "MD5 digest" msgstr "Контрольная сумма MD5:" #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) #: kssl/kcm/displaycert.ui:106 #, kde-format msgid "SHA1 digest" msgstr "Контрольная сумма SHA1:" #: kssl/kcm/displaycertdialog.cpp:73 #, kde-format msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" msgid "%1 to %2" msgstr "с %1 по %2" #: kssl/kcm/kcmssl.cpp:37 #, kde-format msgid "SSL Configuration Module" msgstr "Модуль настройки SSL" #: kssl/kcm/kcmssl.cpp:39 #, kde-format msgid "Copyright 2010 Andreas Hartmetz" msgstr "© Andreas Hartmetz, 2010" #: kssl/kcm/kcmssl.cpp:40 #, kde-format msgid "Andreas Hartmetz" msgstr "Andreas Hartmetz" #: kssl/kcm/kcmssl.cpp:52 #, kde-format msgid "SSL Signers" msgstr "Центры сертификации SSL" #: kssl/ksslcertificate.cpp:202 #, kde-format msgid "Signature Algorithm: " msgstr "Алгоритм подписи: " #: kssl/ksslcertificate.cpp:203 #, kde-format msgid "Unknown" msgstr "неизвестный" #: kssl/ksslcertificate.cpp:206 #, kde-format msgid "Signature Contents:" msgstr "Подпись содержит:" #: kssl/ksslcertificate.cpp:341 #, kde-format msgctxt "Unknown" msgid "Unknown key algorithm" msgstr "Неизвестный алгоритм ключа" #: kssl/ksslcertificate.cpp:347 #, kde-format msgid "Key type: RSA (%1 bit)" msgstr "Тип ключа: RSA (%1 бит)" #: kssl/ksslcertificate.cpp:349 #, kde-format msgid "Modulus: " msgstr "Modulus: " #: kssl/ksslcertificate.cpp:362 #, kde-format msgid "Exponent: 0x" msgstr "Exponent: 0x" #: kssl/ksslcertificate.cpp:374 #, kde-format msgid "Key type: DSA (%1 bit)" msgstr "Тип ключа: DSA (%1 бит)" #: kssl/ksslcertificate.cpp:376 #, kde-format msgid "Prime: " msgstr "Prime: " #: kssl/ksslcertificate.cpp:389 #, kde-format msgid "160 bit prime factor: " msgstr "160 bit prime factor: " #: kssl/ksslcertificate.cpp:417 #, kde-format msgid "Public key: " msgstr "Публичный ключ: " #: kssl/ksslcertificate.cpp:1065 #, kde-format msgid "The certificate is valid." msgstr "Сертификат действителен." #: kssl/ksslcertificate.cpp:1067 #, kde-format msgid "" "Retrieval of the issuer certificate failed. This means the CA's (Certificate " "Authority) certificate can not be found." msgstr "" "Ошибка получения центра выдачи: не найден сертификат удостоверяющего центра." #: kssl/ksslcertificate.cpp:1069 #, kde-format msgid "" "Retrieval of the CRL (Certificate Revocation List) failed. This means the " "CA's (Certificate Authority) CRL can not be found." msgstr "" "Ошибка получения списка отозванных сертификатов: не найден сертификат " "удостоверяющего центра." #: kssl/ksslcertificate.cpp:1071 #, kde-format msgid "" "The decryption of the certificate's signature failed. This means it could " "not even be calculated as opposed to just not matching the expected result." msgstr "Ошибка расшифровки подписи сертификата." #: kssl/ksslcertificate.cpp:1073 #, kde-format msgid "" "The decryption of the CRL's (Certificate Revocation List) signature failed. " "This means it could not even be calculated as opposed to just not matching " "the expected result." msgstr "Ошибка расшифровки списка отозванных сертификатов." #: kssl/ksslcertificate.cpp:1075 #, kde-format msgid "" "The decoding of the public key of the issuer failed. This means that the " "CA's (Certificate Authority) certificate can not be used to verify the " "certificate you wanted to use." msgstr "" "Ошибка расшифровки открытого ключа центра выдачи: невозможно использовать " "сертификат удостоверяющего центра для проверки этого сертификата." #: kssl/ksslcertificate.cpp:1077 #, kde-format msgid "" "The certificate's signature is invalid. This means that the certificate can " "not be verified." msgstr "" "Ошибка в подписи сертификата. Это означает, что сертификат не может быть " "проверен." #: kssl/ksslcertificate.cpp:1079 #, kde-format msgid "" "The CRL's (Certificate Revocation List) signature is invalid. This means " "that the CRL can not be verified." msgstr "" "Ошибка в списке отозванных сертификатов. Это означает, что сертификат не " "может быть проверен." #: kssl/ksslcertificate.cpp:1081 #, kde-format msgid "The certificate is not valid, yet." msgstr "Сертификат ещё не действителен." #: kssl/ksslcertificate.cpp:1083 #, kde-format msgid "The certificate is not valid, any more." msgstr "Сертификат уже не действителен." #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 #, kde-format msgid "The CRL (Certificate Revocation List) is not valid, yet." msgstr "Ошибка в списке отозванных сертификатов." #: kssl/ksslcertificate.cpp:1089 #, kde-format msgid "The time format of the certificate's 'notBefore' field is invalid." msgstr "" "Ошибка указания времени в поле «notBefore» (использовать не раньше) " "сертификата." #: kssl/ksslcertificate.cpp:1091 #, kde-format msgid "The time format of the certificate's 'notAfter' field is invalid." msgstr "" "Ошибка указания времени в поле «notAfter» (использовать не позднее) " "сертификата." #: kssl/ksslcertificate.cpp:1093 #, kde-format msgid "" "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' " "field is invalid." msgstr "" "Ошибка указания времени в поле «lastUpdate» (последнее обновление) списка " "отозванных сертификатов." #: kssl/ksslcertificate.cpp:1095 #, kde-format msgid "" "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' " "field is invalid." msgstr "" "Ошибка указания времени в поле «nextUpdate» (следующее обновление) списка " "отозванных сертификатов." #: kssl/ksslcertificate.cpp:1097 #, kde-format msgid "The OpenSSL process ran out of memory." msgstr "Процессу OpenSSL не хватает памяти." #: kssl/ksslcertificate.cpp:1099 #, kde-format msgid "" "The certificate is self-signed and not in the list of trusted certificates. " "If you want to accept this certificate, import it into the list of trusted " "certificates." msgstr "" "Сертификат самоподписан и не находится в списке доверяемых сертификатов. Для " "того, чтобы принять этот сертификат, импортируйте его в список доверяемых." #: kssl/ksslcertificate.cpp:1102 #, kde-format msgid "" "The certificate is self-signed. While the trust chain could be built up, the " "root CA's (Certificate Authority) certificate can not be found." msgstr "" "Сертификат самоподписан. Цепочка доверия сертификатам может быть построена, " "однако сертификат удостоверяющего центра не обнаружен." #: kssl/ksslcertificate.cpp:1104 #, kde-format msgid "" "The CA's (Certificate Authority) certificate can not be found. Most likely, " "your trust chain is broken." msgstr "Не найден сертификат удостоверяющего центра." #: kssl/ksslcertificate.cpp:1106 #, kde-format msgid "" "The certificate can not be verified as it is the only certificate in the " "trust chain and not self-signed. If you self-sign the certificate, make sure " "to import it into the list of trusted certificates." msgstr "" "Сертификат не может быть проверен, так как он не находится в доверяемой " "цепочке или самоподписан. Если сертификат самоподписан, убедитесь, что он " "импортирован в список доверяемых сертификатов." #: kssl/ksslcertificate.cpp:1108 #, kde-format msgid "The certificate chain is longer than the maximum depth specified." msgstr "Цепочка сертификата длиннее максимально допустимой глубины." #: kssl/ksslcertificate.cpp:1111 #, kde-format msgid "The certificate has been revoked." msgstr "Сертификат был отозван." #: kssl/ksslcertificate.cpp:1113 #, kde-format msgid "The certificate's CA (Certificate Authority) is invalid." msgstr "Неверный удостоверяющий центр у сертификата." #: kssl/ksslcertificate.cpp:1115 #, kde-format msgid "" "The length of the trust chain exceeded one of the CA's (Certificate " "Authority) 'pathlength' parameters, making all subsequent signatures invalid." msgstr "" "Длина доверяемой цепочки превышает параметр «pathlength», заданный " "удостоверяющим центром." #: kssl/ksslcertificate.cpp:1117 #, kde-format msgid "" "The certificate has not been signed for the purpose you tried to use it for. " "This means the CA (Certificate Authority) does not allow this usage." msgstr "" "Сертификат не соответствует деятельности, в которой вы хотите его применить. " "Удостоверяющий центр не разрешает такое использование." #: kssl/ksslcertificate.cpp:1120 #, kde-format msgid "" "The root CA (Certificate Authority) is not trusted for the purpose you tried " "to use this certificate for." msgstr "" "К удостоверяющему центру пропадает доверие при таком использовании " "сертификата." #: kssl/ksslcertificate.cpp:1123 #, kde-format msgid "" "The root CA (Certificate Authority) has been marked to be rejected for the " "purpose you tried to use it for." msgstr "" "Удостоверяющий центр отмечен для игнорирования при таком использовании " "сертификата." #: kssl/ksslcertificate.cpp:1125 #, kde-format msgid "" "The certificate's CA (Certificate Authority) does not match the CA name of " "the certificate." msgstr "" "Удостоверяющий центр сертификата не соответствует имени удостоверяющего " "центра в сертификате." #: kssl/ksslcertificate.cpp:1127 #, kde-format msgid "" "The CA (Certificate Authority) certificate's key ID does not match the key " "ID in the 'Issuer' section of the certificate you are trying to use." msgstr "" "Идентификатор ключа сертификата удостоверяющего центра не соответствует " "идентификатору ключа центра выдачи сертификата." #: kssl/ksslcertificate.cpp:1129 #, kde-format msgid "" "The CA (Certificate Authority) certificate's key ID and name do not match " "the key ID and name in the 'Issuer' section of the certificate you are " "trying to use." msgstr "" "Идентификатор и имя ключа сертификата удостоверяющего центра не " "соответствуют идентификатору и имени ключа центра выдачи сертификата." #: kssl/ksslcertificate.cpp:1131 #, kde-format msgid "" "The certificate's CA (Certificate Authority) is not allowed to sign " "certificates." msgstr "" "Удостоверяющий центр сертификата не позволяет подписывать другие сертификаты." #: kssl/ksslcertificate.cpp:1133 #, kde-format msgid "OpenSSL could not be verified." msgstr "Невозможно проверить OpenSSL." #: kssl/ksslcertificate.cpp:1137 #, kde-format msgid "" "The signature test for this certificate failed. This could mean that the " "signature of this certificate or any in its trust path are invalid, could " "not be decoded or that the CRL (Certificate Revocation List) could not be " "verified. If you see this message, please let the author of the software you " "are using know that he or she should use the new, more specific error " "messages." msgstr "" "Ошибка при проверке подписи сертификата. Причиной этого может быть то, что " "подпись или любая часть цепочки сертификатов неправильная, не может быть " "расшифрована или невозможно проверить список отозванных сертификатов." #: kssl/ksslcertificate.cpp:1139 #, kde-format msgid "" "This certificate, any in its trust path or its CA's (Certificate Authority) " "CRL (Certificate Revocation List) is not valid. Any of them could not be " "valid yet or not valid any more. If you see this message, please let the " "author of the software you are using know that he or she should use the new, " "more specific error messages." msgstr "" "Подпись, любая часть цепочки сертификатов или список отозванных сертификатов " "не являются правильными." #: kssl/ksslcertificate.cpp:1145 #, kde-format msgid "" "Certificate signing authority root files could not be found so the " "certificate is not verified." msgstr "" "Невозможно найти корневые файлы организаций, заверяющих сертификаты, поэтому " "сертификат не проверен." #: kssl/ksslcertificate.cpp:1147 #, kde-format msgid "SSL support was not found." msgstr "Поддержка SSL не найдена." #: kssl/ksslcertificate.cpp:1149 #, kde-format msgid "Private key test failed." msgstr "Сбой проверки секретного ключа." #: kssl/ksslcertificate.cpp:1151 #, kde-format msgid "The certificate has not been issued for this host." msgstr "Сертификат не был выпущен для этого узла." #: kssl/ksslcertificate.cpp:1153 #, kde-format msgid "This certificate is not relevant." msgstr "Сертификат недействителен." #: kssl/ksslcertificate.cpp:1158 #, kde-format msgid "The certificate is invalid." msgstr "Сертификат недействителен." #: kssl/ksslutils.cpp:90 #, kde-format msgid "GMT" msgstr "GMT" #~ msgid "Test Service for Network Status kded module" #~ msgstr "Модуль kded для проверки службы состояния сети" #~ msgid "knetworkstatustestservice" #~ msgstr "knetworkstatustestservice" #~ msgid "(C) 2007 Will Stephenson" #~ msgstr "© Will Stephenson, 2007" #~ msgid "Will Stephenson" #~ msgstr "Will Stephenson" #, fuzzy #~| msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" #~| msgid "Before Christ" #~ msgctxt "color" #~ msgid "forest" #~ msgstr "до Рождества Христова" #~ msgctxt "color" #~ msgid "sky" #~ msgstr "Небесно-голубой" #~ msgctxt "color" #~ msgid "slate" #~ msgstr "Грифельный" #~ msgctxt "@item Calendar system" #~ msgid "Gregorian (Proleptic)" #~ msgstr "Григорианский (ранний)" #~ msgctxt "Ethiopian month 1 - ShortNamePossessive" #~ msgid "of Mes" #~ msgstr "мес" #~ msgctxt "Ethiopian month 5 - LongNamePossessive" #~ msgid "of Ter" #~ msgstr "тера" #~ msgctxt "Ethiopian month 1 - ShortName" #~ msgid "Mes" #~ msgstr "Мес" #~ msgctxt "Ethiopian month 5 - LongName" #~ msgid "Ter" #~ msgstr "Тер" #~ msgctxt "Ethiopian weekday 4 - ShortDayName" #~ msgid "Ham" #~ msgstr "Хам" #~ msgctxt "Ethiopian weekday 5 - ShortDayName" #~ msgid "Arb" #~ msgstr "Арб" #~ msgctxt "Ethiopian weekday 3 - LongDayName" #~ msgid "Rob" #~ msgstr "Роб" #~ msgctxt "Ethiopian weekday 5 - LongDayName" #~ msgid "Arb" #~ msgstr "Арб" #~ msgctxt "of May long" #~ msgid "of May" #~ msgstr "мая" #~ msgctxt "May long" #~ msgid "May" #~ msgstr "Май" #~ msgid "R. Thaani" #~ msgstr "Раби-уль-ахир" #~ msgid "J. Thaani" #~ msgstr "Джумад-уль-ахир" #~ msgid "Hijjah" #~ msgstr "Зуль-Хиджжа" #~ msgctxt "of Tir long" #~ msgid "of Tir" #~ msgstr "Тир" #~ msgctxt "of Dei long" #~ msgid "of Dei" #~ msgstr "Дей" #~ msgctxt "Tir long" #~ msgid "Tir" #~ msgstr "Тир" #~ msgctxt "Dei long" #~ msgid "Dei" #~ msgstr "Дей" #~ msgctxt "Shanbe short" #~ msgid "shn" #~ msgstr "шан" Index: trunk/l10n-kf5/ru/messages/frameworks/kxmlgui5.po =================================================================== --- trunk/l10n-kf5/ru/messages/frameworks/kxmlgui5.po (revision 1549882) +++ trunk/l10n-kf5/ru/messages/frameworks/kxmlgui5.po (revision 1549883) @@ -1,10446 +1,10446 @@ # KDE - kdelibs/kdelibs4.po Russian translation. # Copyright (C) 2005, KDE Russian translation team. # # Denis Perchine , 2000. # Gregory Mokhin , 2000, 2004, 2005. # Albert R. Valiev , 2002, 2008. # Leonid Kanter , 2002-2004, 2005, 2008. # Andrey Cherepanov , 2005-2007, 2008, 2009, 2011. # Nick Shaforostoff , 2004, 2006, 2007, 2008, 2009. # Nick Shaforostoff , 2009, 2016. -# Alexander Potashev , 2009, 2010, 2011, 2014, 2015, 2016, 2017, 2018. +# Alexander Potashev , 2009, 2010, 2011, 2014, 2015, 2016, 2017, 2018, 2019. # Yury G. Kudryashov , 2011. # Yuri Efremov , 2012. # Inga Barinova , 2012. # Julia Dronova , 2012. # Alexander Lakhin , 2013. msgid "" msgstr "" "Project-Id-Version: kdelibs4\n" "Report-Msgid-Bugs-To: https://bugs.kde.org\n" "POT-Creation-Date: 2019-08-02 02:42+0200\n" -"PO-Revision-Date: 2018-11-30 16:56+0300\n" +"PO-Revision-Date: 2019-08-18 04:47+0300\n" "Last-Translator: Alexander Potashev \n" "Language-Team: Russian \n" "Language: ru\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" -"X-Generator: Lokalize 2.0\n" +"X-Generator: Lokalize 19.07.70\n" "Plural-Forms: nplurals=4; plural=n==1 ? 3 : n%10==1 && n%100!=11 ? 0 : n" "%10>=2 && n%10<=4 && (n%100<10 || n%100>=20) ? 1 : 2;\n" "X-Environment: kde\n" "X-Accelerator-Marker: &\n" "X-Text-Markup: kde4\n" #: kaboutapplicationdialog.cpp:81 khelpmenu.cpp:280 #, kde-format msgid "About %1" msgstr "О программе %1" #: kaboutapplicationdialog.cpp:98 #, kde-format msgid "%1
    Version %2" msgstr "%1
    Версия %2" #: kaboutapplicationdialog.cpp:136 #, kde-format msgid "License: %1" msgstr "Лицензия: %1" #: kaboutapplicationdialog.cpp:148 #, kde-format msgid "&About" msgstr "&О программе" #: kaboutapplicationdialog.cpp:155 #, kde-format msgid "" "
    • KDE Frameworks %1
    • Qt %2 (built against %3)
    • The " "%4 windowing system
    " msgstr "" "
    • KDE Frameworks %1,
    • Qt %2 (собрана с версией %3),
    • Оконная система %4.
    " #: kaboutapplicationdialog.cpp:165 #, kde-format msgid "&Libraries" msgstr "Б&иблиотеки" #: kaboutapplicationdialog.cpp:186 #, kde-format msgid "" "Please use https://bugs.kde.org to " "report bugs.\n" msgstr "" "Используйте https://bugs.kde.org для " "сообщения об ошибках.\n" #: kaboutapplicationdialog.cpp:192 #, kde-format msgid "Please report bugs to %2.\n" msgstr "Используйте %2 для сообщения об ошибках.\n" #: kaboutapplicationdialog.cpp:218 #, kde-format msgid "A&uthor" msgstr "&Автор" #: kaboutapplicationdialog.cpp:218 #, kde-format msgid "A&uthors" msgstr "&Авторы" #: kaboutapplicationdialog.cpp:245 #, kde-format msgid "&Thanks To" msgstr "&Благодарности" #: kaboutapplicationdialog.cpp:284 #, kde-format msgid "T&ranslation" msgstr "&Перевод" #: kaboutapplicationdialog.cpp:316 #, kde-format msgid "License Agreement" msgstr "Лицензионное соглашение" #: kaboutapplicationpersonlistdelegate_p.cpp:62 #, kde-format msgctxt "Action to send an email to a contributor" msgid "Email contributor" msgstr "Написать участнику по электронной почте" #: kaboutapplicationpersonlistdelegate_p.cpp:67 #, kde-format msgid "Visit contributor's homepage" msgstr "Посетить домашнюю страницу участника" #: kaboutapplicationpersonlistdelegate_p.cpp:128 #, kde-format msgctxt "Action to send an email to a contributor" msgid "" "Email contributor\n" "%1" msgstr "" "Написать участнику по электронной почте:\n" "%1" #: kaboutapplicationpersonlistdelegate_p.cpp:134 #: kaboutapplicationpersonlistdelegate_p.cpp:170 #, kde-format msgid "" "Visit contributor's homepage\n" "%1" msgstr "" "Посетить домашнюю страницу участника:\n" "%1" #: kaboutapplicationpersonlistdelegate_p.cpp:141 #: kaboutapplicationpersonlistdelegate_p.cpp:173 #, kde-format msgid "" "Visit contributor's profile on %1\n" "%2" msgstr "" "Посетить страницу профиля помощника на %1\n" "%2" #: kaboutapplicationpersonlistdelegate_p.cpp:164 #, kde-format msgid "" "Visit contributor's page\n" "%1" msgstr "" "Посетить страницу помощника\n" "%1" #: kaboutapplicationpersonlistdelegate_p.cpp:167 #, kde-format msgid "" "Visit contributor's blog\n" "%1" msgstr "" "Посетить блог участника:\n" "%1" #: kaboutapplicationpersonlistdelegate_p.cpp:265 #, kde-format msgctxt "@item Contributor name in about dialog." msgid "%1" msgstr "%1" #: kaboutapplicationpersonmodel_p.cpp:206 #, kde-format msgctxt "City, Country" msgid "%1, %2" msgstr "%1, %2" #: kaboutapplicationpersonmodel_p.cpp:309 #, kde-format msgctxt "A generic social network or homepage link of an unlisted type." msgid "Other" msgstr "Другое" #: kaboutapplicationpersonmodel_p.cpp:311 #, kde-format msgctxt "A type of link." msgid "Blog" msgstr "Блог" #: kaboutapplicationpersonmodel_p.cpp:319 #, kde-format msgctxt "A type of link." msgid "Homepage" msgstr "Домашняя страница" #: kaboutkdedialog_p.cpp:43 #, kde-format msgid "About KDE" msgstr "О KDE" #: kaboutkdedialog_p.cpp:46 #, kde-format msgid "KDE - Be Free!" msgstr "KDE — будьте свободными!" #: kaboutkdedialog_p.cpp:55 #, kde-format msgid "" "KDE is a world-wide community of software engineers, artists, " "writers, translators and creators who are committed to Free " "Software development. KDE produces the Plasma desktop environment, " "hundreds of applications, and the many software libraries that support them." "

    KDE is a cooperative enterprise: no single entity controls its " "direction or products. Instead, we work together to achieve the common goal " "of building the world's finest Free Software. Everyone is welcome to join and contribute to KDE, including you.

    Visit %3 for more information about the KDE community and the " "software we produce." msgstr "" "KDE — международное сообщество программистов, дизайнеров, " "переводчиков и других людей, так или иначе посвящающих себя разработке свободного программного обеспечения. KDE выпускает рабочую " "среду Plasma, сотни прикладных программ, а также множество необходимых для " "них программных библиотек.

    Не существует группы или организации, " "держащей под исключительным контролем действия или направления развития " "продуктов KDE. Вместо централизованного подхода мы стремимся к общей цели — " "созданию лучшего в мире свободного ПО. Мы будем рады каждому, кто захочет внести свой вклад в развитие KDE.

    Для того чтобы " "больше узнать о проекте, зайдите на сайт %3." #: kaboutkdedialog_p.cpp:75 #, kde-format msgid "" "Software can always be improved, and the KDE team is ready to do so. " "However, you - the user - must tell us when something does not work as " "expected or could be done better.

    KDE has a bug tracking system. " "Visit %1 or use the \"Report Bug...\" dialog from the " "\"Help\" menu to report bugs.

    If you have a suggestion for " "improvement then you are welcome to use the bug tracking system to register " "your wish. Make sure you use the severity called \"Wishlist\"." msgstr "" "Программное обеспечение всегда можно улучшить, и команда KDE готова " "этим заниматься. Однако, для этого надо, чтобы вы, обычный пользователь, " "сообщили нам о том, что не соответствует вашим ожиданиям и что можно было бы " "улучшить.

    В рамках проекта KDE создана система учёта ошибок и " "пожеланий. Для того чтобы сообщить об ошибке, зайдите на сайт " "%1 или отправьте сообщение по электронной почте, используя пункт " "«Сообщить об ошибке...» из меню «Справка» содержащего ошибку приложения. " "Сообщение должно быть на английском языке.

    Ваши пожелания можно " "зарегистрировать тем же способом. При регистрации пожеланий не забудьте " "установить уровень важности «Wishlist» (пожелание).

    Для связи с " -"командой перевода KDE на русский язык используйте почтовую рассылку kde-russian@lists.kde." -"ru." +"командой перевода KDE на русский язык используйте контакты, указанные на" +" странице kde.ru/translation.<" +"/html>" #: kaboutkdedialog_p.cpp:93 #, kde-format msgid "" "You do not have to be a software developer to be a member of the KDE " "team. You can join the national teams that translate program interfaces. You " "can provide graphics, themes, sounds, and improved documentation. You decide!" "

    Visit %1 for information on some projects in " "which you can participate.

    If you need more information or " "documentation, then a visit to %2 will provide you with " "what you need." msgstr "" "Для того чтобы включиться в разработку KDE, не обязательно быть " "программистом. Вы можете помочь в переводе KDE на родной язык, создавать " "графику, стили, звуки, улучшать документацию — то есть тем, чем вы сами " "хотите заниматься.

    Список проектов, в которых вы могли бы принять " "участие, приведён на сайте %1. Вполне возможно, какой-то " "из них вас заинтересует.

    Более подробные сведения и документацию " "можно найти на сайте %2." #: kaboutkdedialog_p.cpp:115 #, kde-format msgid "" "KDE software is and will always be available free of charge, however " "creating it is not free.

    To support development the KDE community " "has formed the KDE e.V., a non-profit organization legally founded in " "Germany. KDE e.V. represents the KDE community in legal and financial " "matters. See %1 for information on KDE e.V.

    KDE benefits from many kinds of contributions, including financial. We use " "the funds to reimburse members and others for expenses they incur when " "contributing. Further funds are used for legal support and organizing " "conferences and meetings.

    We would like to encourage you to " "support our efforts with a financial donation, using one of the ways " "described at %2.

    Thank you very much in " "advance for your support." msgstr "" "Среда KDE распространяется бесплатно, но её создание требует затрат." "

    Поэтому команда KDE основала Ассоциацию KDE, некоммерческую " "организацию, которая зарегистрирована в Германии. Ассоциация KDE " "представляет проект KDE в правовом и финансовом аспектах. Посетите %1 для получения более подробной информации об Ассоциации KDE." "

    Финансовая поддержка идёт на благо KDE. Большая часть средств " "используется для возмещения расходов участников проекта, которые они несут " "при разработке KDE. Остальные средства используются для юридической " "поддержки и организации конференций и встреч. Вы можете поддержать KDE " "финансовым пожертвованием, которое может быть внесено одним из способов, " "описанных на странице %2.

    Заранее благодарим " "за поддержку!" #: kaboutkdedialog_p.cpp:135 #, kde-format msgctxt "About KDE" msgid "&About" msgstr "О &среде KDE" #: kaboutkdedialog_p.cpp:136 #, kde-format msgid "&Report Bugs or Wishes" msgstr "&Сообщить об ошибках или пожеланиях" #: kaboutkdedialog_p.cpp:137 #, kde-format msgid "&Join KDE" msgstr "&Присоединиться к сообществу KDE" #: kaboutkdedialog_p.cpp:138 #, kde-format msgid "&Support KDE" msgstr "&Поддержать KDE" #: kactionconflictdetector.cpp:50 #, kde-format msgid "" "The key sequence '%1' is ambiguous. Use 'Configure Shortcuts'\n" "from the 'Settings' menu to solve the ambiguity.\n" "No action will be triggered." msgstr "" "Конфликт действий на комбинации клавиш «%1». Используйте пункт \n" "«Комбинации клавиш» меню «Настройка» чтобы исправить конфликт.\n" "Не выполнено ни одно из конфликтующих действий." #: kactionconflictdetector.cpp:54 #, kde-format msgid "Ambiguous shortcut detected" msgstr "Конфликт действий" #: kbugreport.cpp:104 kbugreport.cpp:133 #, kde-format msgid "Submit Bug Report" msgstr "Отправить отчёт об ошибке" #: kbugreport.cpp:144 #, kde-format msgid "" "Your email address. If incorrect, use the Configure Email button to change it" msgstr "" "Ваш электронный адрес. Если он неверен, нажмите кнопку «Настройка " "электронной почты» и измените его." #: kbugreport.cpp:145 #, kde-format msgctxt "Email sender address" msgid "From:" msgstr "Отправитель: " #: kbugreport.cpp:153 #, kde-format msgid "Configure Email..." msgstr "Параметры электронной почты..." #: kbugreport.cpp:160 #, kde-format msgid "The email address this bug report is sent to." msgstr "Почтовый адрес для отправления сообщения об ошибке." #: kbugreport.cpp:161 #, kde-format msgctxt "Email receiver address" msgid "To:" msgstr "Получатель:" #: kbugreport.cpp:170 #, kde-format msgid "&Send" msgstr "&Отправить" #: kbugreport.cpp:170 #, kde-format msgid "Send bug report." msgstr "Отправить сообщение об ошибке." #: kbugreport.cpp:171 #, kde-format msgid "Send this bug report to %1." msgstr "Отправить это сообщение об ошибке на %1." #: kbugreport.cpp:179 #, kde-format msgid "" "The application for which you wish to submit a bug report - if incorrect, " "please use the Report Bug menu item of the correct application" msgstr "" "Приложение, содержащее описываемую ошибку. Если здесь указано не то " "приложение, используйте пункт меню «Отправить сообщение об ошибке» нужного " "приложения" #: kbugreport.cpp:180 #, kde-format msgid "Application: " msgstr "Приложение: " #: kbugreport.cpp:207 #, kde-format msgid "" "The version of this application - please make sure that no newer version is " "available before sending a bug report" msgstr "" "Версия программы. Прежде чем отправлять сообщение об ошибке, проверьте, не " "вышла ли более свежая версия." #: kbugreport.cpp:208 #, kde-format msgid "Version:" msgstr "Версия:" #: kbugreport.cpp:213 #, kde-format msgid "no version set (programmer error)" msgstr "нет данных о версии (ошибка программиста!)" #: kbugreport.cpp:226 #, kde-format msgid "OS:" msgstr "Операционная система:" #: kbugreport.cpp:234 #, kde-format msgid "Compiler:" msgstr "Компилятор:" #: kbugreport.cpp:242 #, kde-format msgid "Se&verity" msgstr "Степень &важности" #: kbugreport.cpp:244 #, kde-format msgid "Critical" msgstr "Критическая ошибка" #: kbugreport.cpp:244 #, kde-format msgid "Grave" msgstr "Опасная ошибка" #: kbugreport.cpp:244 #, kde-format msgctxt "normal severity" msgid "Normal" msgstr "Обычная ошибка" #: kbugreport.cpp:244 #, kde-format msgid "Wishlist" msgstr "Пожелание" #: kbugreport.cpp:244 #, kde-format msgid "Translation" msgstr "Ошибка в переводе" #: kbugreport.cpp:262 #, kde-format msgid "S&ubject: " msgstr "&Тема: " #: kbugreport.cpp:270 #, kde-format msgid "" "Enter the text (in English if possible) that you wish to submit for the bug " "report.\n" "If you press \"Send\", a mail message will be sent to the maintainer of this " "program.\n" msgstr "" "Введите текст (желательно по-английски), который описывает ошибку.\n" "Если вы нажмёте кнопку «Отправить», сообщение будет отправлено к " "ответственному за разработку этой программы.\n" #: kbugreport.cpp:294 #, kde-format msgid "" "To submit a bug report, click on the button below. This will open a web " "browser window on https://bugs.kde.org " "where you will find a form to fill in. The information displayed above will " "be transferred to that server." msgstr "" "Для того, чтобы отправить сообщение об ошибке, нажмите на кнопку внизу. " "Откроется окно с адресом https://bugs.kde." "org, где можно будет заполнить форму. Информация будет отправлена на " "сервер учёта ошибок." #: kbugreport.cpp:299 #, kde-format msgid "" "To submit a bug report, click on the button below. This will open a web " "browser window on %2." msgstr "" "Для того, чтобы отправить сообщение об ошибке, нажмите на кнопку внизу. " "В веб-браузере откроется адрес %2." #: kbugreport.cpp:316 #, kde-format msgid "&Launch Bug Report Wizard" msgstr "&Запустить мастер сообщения об ошибке" #: kbugreport.cpp:318 #, kde-format msgid "&Submit Bug Report" msgstr "&Отправить отчёт об ошибке" #: kbugreport.cpp:382 #, kde-format msgctxt "unknown program name" msgid "unknown" msgstr "неизвестная" #: kbugreport.cpp:441 #, kde-format msgid "" "You must specify both a subject and a description before the report can be " "sent." msgstr "Перед отправкой отчёта необходимо указать тему и описание ошибки." #: kbugreport.cpp:450 #, kde-format msgid "" "

    You chose the severity Critical. Please note that this severity is " "intended only for bugs that:

    • break unrelated software on the " "system (or the whole system)
    • cause serious data loss
    • introduce a security hole on the system where the affected package is " "installed
    \n" "

    Does the bug you are reporting cause any of the above damage? If it does " "not, please select a lower severity. Thank you.

    " msgstr "" "

    Выбран уровень ошибки Критическая. Этот уровень подразумевает, что " "ошибка:

    • может вызвать сбой в работе других программ или системы в " "целом
    • привести к порче и утрате данных
    • нарушить безопасность " "системы, если установлен данный пакет
    \n" "

    Является ли ошибка, о которой вы хотите сообщить, настолько серьёзной? " "Если нет, выберите другой, менее высокий уровень ошибки.

    " #: kbugreport.cpp:462 #, kde-format msgid "" "

    You chose the severity Grave. Please note that this severity is " "intended only for bugs that:

    • make the package in question " "unusable or mostly so
    • cause data loss
    • introduce a security " "hole allowing access to the accounts of users who use the affected package
    \n" "

    Does the bug you are reporting cause any of the above damage? If it does " "not, please select a lower severity. Thank you.

    " msgstr "" "

    Вы выбрали уровень ошибки Опасная. Этот уровень подразумевает, что " "ошибка:

    • может вызвать неисправимый сбой в работе данного пакета
    • привести к утрате данных
    • нарушить безопасность системы и " "открыть доступ к файлам пользователей, установивших данный пакет
    \n" "

    Является ли ошибка, о которой вы хотите сообщить, настолько серьёзной? " "Если нет, выберите другой, менее высокий уровень ошибки.

    " #: kbugreport.cpp:476 #, kde-format msgid "" "Unable to send the bug report.\n" "Please submit a bug report manually....\n" "See https://bugs.kde.org/ for instructions." msgstr "" "Не удалось отправить сообщение об ошибке.\n" "Попробуйте отправить его вручную на сайте https://bugs.kde.org/" #: kbugreport.cpp:484 #, kde-format msgid "Bug report sent, thank you for your input." msgstr "Сообщение об ошибке отправлено, спасибо." #: kbugreport.cpp:493 #, kde-format msgid "" "Close and discard\n" "edited message?" msgstr "" "Закрыть и отменить\n" "введённое сообщение?" #: kbugreport.cpp:494 #, kde-format msgid "Close Message" msgstr "Закрыть сообщение" #: kcheckaccelerators.cpp:267 #, kde-format msgctxt "@title:window" msgid "Dr. Klash' Accelerator Diagnosis" msgstr "Проверка клавиш вызова от Dr. Klash" #: kcheckaccelerators.cpp:274 #, kde-format msgctxt "@option:check" msgid "Disable automatic checking" msgstr "Отключить автоматическую проверку" #: kcheckaccelerators.cpp:318 #, kde-format msgid "

    Accelerators changed

    " msgstr "

    Акселераторы изменены

    " # BUGME: needs clarification: what is meant by "text"? --aspotashev #: kcheckaccelerators.cpp:320 kcheckaccelerators.cpp:331 #, kde-format msgid "Old Text" msgstr "Старый текст" # "Подпись кнопки"? (на данный момент она одна, 22 марта 2011 г.) --aspotashev # # BUGME: needs clarification: what is meant by "text"? --aspotashev #: kcheckaccelerators.cpp:322 kcheckaccelerators.cpp:340 #, kde-format msgid "New Text" msgstr "Новый текст" #: kcheckaccelerators.cpp:329 #, kde-format msgid "

    Accelerators removed

    " msgstr "

    Акселераторы удалены

    " #: kcheckaccelerators.cpp:338 #, kde-format msgid "

    Accelerators added (just for your info)

    " msgstr "

    Акселераторы добавлены

    " #: kedittoolbar.cpp:55 #, kde-format msgid "--- separator ---" msgstr "--- разделитель ---" #: kedittoolbar.cpp:56 #, fuzzy, kde-format #| msgid "--- separator ---" msgid "--- expanding spacer ---" msgstr "--- разделитель ---" #: kedittoolbar.cpp:347 #, kde-format msgid "Change Text" msgstr "Изменить текст" #: kedittoolbar.cpp:358 #, kde-format msgid "Icon te&xt:" msgstr "&Текст кнопки:" #: kedittoolbar.cpp:363 #, kde-format msgid "&Hide text when toolbar shows text alongside icons" msgstr "&Скрывать текст при показе подписей сбоку от значков" #: kedittoolbar.cpp:617 #, kde-format msgid "Configure Toolbars" msgstr "Настройка панелей инструментов" #: kedittoolbar.cpp:680 #, kde-format msgid "" "Do you really want to reset all toolbars of this application to their " "default? The changes will be applied immediately." msgstr "" "Восстановить панели инструментов по умолчанию? Изменения вступят в силу " "немедленно." #: kedittoolbar.cpp:680 #, kde-format msgid "Reset Toolbars" msgstr "Восстановить панели инструментов" #: kedittoolbar.cpp:680 #, kde-format msgid "Reset" msgstr "Восстановить" #: kedittoolbar.cpp:1003 #, kde-format msgid "&Toolbar:" msgstr "&Панель инструментов:" #. i18n("&New"), this); #. new_toolbar->setPixmap(BarIcon("document-new", KIconLoader::SizeSmall)); #. new_toolbar->setEnabled(false); // disabled until implemented #. QPushButton *del_toolbar = new QPushButton(i18n("&Delete"), this); #. del_toolbar->setPixmap(BarIcon("edit-delete", KIconLoader::SizeSmall)); #. del_toolbar->setEnabled(false); // disabled until implemented #. our list of inactive actions #: kedittoolbar.cpp:1018 #, kde-format msgid "A&vailable actions:" msgstr "&Доступные действия:" #: kedittoolbar.cpp:1033 kedittoolbar.cpp:1052 #, kde-format msgid "Filter" msgstr "Фильтр" #: kedittoolbar.cpp:1036 #, kde-format msgid "Curr&ent actions:" msgstr "&Текущие действия:" #: kedittoolbar.cpp:1055 #, kde-format msgid "Change &Icon..." msgstr "Изменить &значок..." #: kedittoolbar.cpp:1063 #, kde-format msgid "Change Te&xt..." msgstr "Изменить текст..." #: kedittoolbar.cpp:1218 #, kde-format msgctxt "@item:intable Action name in toolbar editor" msgid "%1" msgstr "%1" #: kedittoolbar.cpp:1245 #, kde-format msgid "" "This element will be replaced with all the elements of an embedded component." msgstr "" "Данный элемент будет полностью замещён элементами встроенного компонента." #: kedittoolbar.cpp:1247 #, kde-format msgid "" msgstr "<Точка вставки>" #: kedittoolbar.cpp:1249 #, kde-format msgid "" msgstr "<Точка вставки %1>" #: kedittoolbar.cpp:1255 #, kde-format msgid "" "This is a dynamic list of actions. You can move it, but if you remove it you " "will not be able to re-add it." msgstr "" "Это список действий. Вы можете перемещать его, однако при удалении " "восстановить его будет невозможно." #: kedittoolbar.cpp:1256 #, kde-format msgid "ActionList: %1" msgstr "Список действий: %1" #: kedittoolbar.cpp:1360 kedittoolbar.cpp:1387 #, kde-format msgctxt "@label Action tooltip in toolbar editor, below the action list" msgid "%1" msgstr "%1" #: kedittoolbar.cpp:1616 #, kde-format msgid "Change Icon" msgstr "Изменить значок" #: kgesture.cpp:505 #, kde-format msgctxt "left mouse button" msgid "left button" msgstr "левая кнопка" #: kgesture.cpp:507 #, kde-format msgctxt "middle mouse button" msgid "middle button" msgstr "средняя кнопка" #: kgesture.cpp:509 #, kde-format msgctxt "right mouse button" msgid "right button" msgstr "правая кнопка" #: kgesture.cpp:511 #, kde-format msgctxt "a nonexistent value of mouse button" msgid "invalid button" msgstr "недопустимая кнопка" #: kgesture.cpp:524 #, kde-format msgctxt "" "a kind of mouse gesture: hold down one mouse button, then press another " "button" msgid "Hold %1, then push %2" msgstr "Держать %1, затем нажать %2" #. i18n: ectx: Menu (help) #: khelpmenu.cpp:172 ui_standards.rc:177 #, kde-format msgid "&Help" msgstr "&Справка" # [https://bugs.kde.org/show_bug.cgi?id=254400] BUGME: В названии действия не удаляется акселератор. Пока что будем делать это вручную (Transcript) # --aspotashev #: kkeysequencewidget.cpp:128 #, kde-format msgid "Shortcut '%1' in Application %2 for action %3\n" msgstr "Комбинация клавиш «%1» в приложении %2 для действия «%3»\n" #: kkeysequencewidget.cpp:138 #, kde-format msgctxt "" "%1 is the number of conflicts (hidden), %2 is the key sequence of the " "shortcut that is problematic" msgid "The shortcut '%2' conflicts with the following key combination:\n" msgid_plural "" "The shortcut '%2' conflicts with the following key combinations:\n" msgstr[0] "" "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" msgstr[1] "" "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" msgstr[2] "" "Комбинация клавиш «%2» конфликтует со следующими комбинациями клавиш:\n" msgstr[3] "" "Комбинация клавиш «%2» конфликтует со следующей комбинацией клавиш:\n" #: kkeysequencewidget.cpp:144 #, kde-format msgctxt "%1 is the number of shortcuts with which there is a conflict" msgid "Conflict with Registered Global Shortcut" msgid_plural "Conflict with Registered Global Shortcuts" msgstr[0] "Конфликт с глобальными комбинациями клавиш" msgstr[1] "Конфликт с глобальными комбинациями клавиш" msgstr[2] "Конфликт с глобальными комбинациями клавиш" msgstr[3] "Конфликт с глобальной комбинацией клавиш" #: kkeysequencewidget.cpp:146 kkeysequencewidget.cpp:234 #: kkeysequencewidget.cpp:625 kshortcutseditor.cpp:635 kshortcutseditor.cpp:653 #, kde-format msgid "Reassign" msgstr "Связать с новым" #: kkeysequencewidget.cpp:215 #, kde-format msgctxt "%1 is the number of conflicts" msgid "Shortcut Conflict" msgid_plural "Shortcut Conflicts" msgstr[0] "Конфликты комбинаций клавиш" msgstr[1] "Конфликты комбинаций клавиш" msgstr[2] "Конфликты комбинаций клавиш" msgstr[3] "Конфликт комбинаций клавиш" #: kkeysequencewidget.cpp:219 #, kde-format msgid "Shortcut '%1' for action '%2'\n" msgstr "Комбинация клавиш «%1» для действия «%2»\n" #: kkeysequencewidget.cpp:224 #, kde-format msgctxt "%1 is the number of ambigious shortcut clashes (hidden)" msgid "" "The \"%2\" shortcut is ambiguous with the following shortcut.\n" "Do you want to assign an empty shortcut to this action?\n" "%3" msgid_plural "" "The \"%2\" shortcut is ambiguous with the following shortcuts.\n" "Do you want to assign an empty shortcut to these actions?\n" "%3" msgstr[0] "" "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями клавиш.\n" "Отменить назначение комбинации клавиш для указанных действий?\n" "\n" "%3" msgstr[1] "" "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями клавиш.\n" "Отменить назначение комбинации клавиш для указанных действий?\n" "\n" "%3" msgstr[2] "" "Комбинация клавиш «%2» конфликтует с приведёнными ниже комбинациями клавиш.\n" "Отменить назначение комбинации клавиш для указанных действий?\n" "\n" "%3" msgstr[3] "" "Комбинация клавиш «%2» конфликтует с приведённой ниже комбинацией клавиш.\n" "Отменить назначение комбинации клавиш для указанного действия?\n" "\n" "%3" #: kkeysequencewidget.cpp:243 #, kde-format msgid "Shortcut conflict" msgstr "Конфликт комбинации клавиш" #: kkeysequencewidget.cpp:244 #, kde-format msgid "" "The '%1' key combination is already used by the %2 action." "
    Please select a different one.    " msgstr "" "Комбинация клавиш %1 уже связана с действием %2.
    Выберите " "уникальную комбинацию клавиш.    " #: kkeysequencewidget.cpp:274 #, kde-format msgid "" "Click on the button, then enter the shortcut like you would in the program.\n" "Example for Ctrl+A: hold the Ctrl key and press A." msgstr "" "Нажмите на кнопке и введите комбинацию клавиш.\n" "Например, для комбинации клавиш Ctrl+A зажмите клавишу Ctrl и нажмите A." #: kkeysequencewidget.cpp:466 #, kde-format msgid "Reserved Shortcut" msgstr "Зарезервированная комбинация клавиш" #: kkeysequencewidget.cpp:467 #, kde-format msgid "" "The F12 key is reserved on Windows, so cannot be used for a global " "shortcut.\n" "Please choose another one." msgstr "" "В Windows клавиша F12 зарезервирована, поэтому её нельзя использовать в " "глобальных комбинациях клавиш.\n" "Выберите другую комбинацию клавиш." #: kkeysequencewidget.cpp:619 #, kde-format msgid "Conflict with Standard Application Shortcut" msgstr "Конфликт со стандартной клавишей приложения" #: kkeysequencewidget.cpp:620 #, kde-format msgid "" "The '%1' key combination is also used for the standard action \"%2\" that " "some applications use.\n" "Do you really want to use it as a global shortcut as well?" msgstr "" "Комбинация клавиш %1 уже связана со стандартным действием «%2», используемым " "во многих программах.\n" "Вы действительно хотите использовать эту комбинацию как глобальную?" #: kkeysequencewidget.cpp:668 #, kde-format msgctxt "What the user inputs now will be taken as the new shortcut" msgid "Input" msgstr "Сейчас" #: kkeysequencewidget.cpp:675 kshortcuteditwidget.cpp:67 #: kshortcuteditwidget.cpp:70 #, kde-format msgctxt "No shortcut defined" msgid "None" msgstr "Не определена" #: kkeysequencewidget.cpp:721 #, kde-format msgid "The key you just pressed is not supported by Qt." msgstr "Нажатая клавиша не поддерживается в Qt." #: kkeysequencewidget.cpp:722 #, kde-format msgid "Unsupported Key" msgstr "Клавиша не поддерживается" #: kmainwindow.cpp:247 #, kde-format msgctxt "NAME OF TRANSLATORS" msgid "Your names" msgstr "" "Григорий Мохин,Николай Шафоростов,Андрей Черепанов,Леонид Кантер,Альберт " "Валиев" #: kmainwindow.cpp:248 #, kde-format msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" msgstr "" "mok@kde.ru,shaforostoff@kde.ru,skull@kde.ru,leon@asplinux.ru," "darkstar@altlinux.ru" #: kmenumenuhandler_p.cpp:49 #, kde-format msgid "Add to Toolbar" msgstr "Добавить на панель инструментов" #: kmenumenuhandler_p.cpp:232 #, kde-format msgid "Configure Shortcut..." msgstr "Настроить комбинацию клавиш..." #: ksendbugmail/main.cpp:44 #, kde-format msgid "Error connecting to server." msgstr "Не удалось подключиться к серверу." #: ksendbugmail/main.cpp:47 #, kde-format msgid "Not connected." msgstr "Не подключено." #: ksendbugmail/main.cpp:50 #, kde-format msgid "Connection timed out." msgstr "Время ожидания соединения истекло." #: ksendbugmail/main.cpp:53 #, kde-format msgid "Time out waiting for server interaction." msgstr "Время ожидания ответа сервера истекло." #: ksendbugmail/main.cpp:57 #, kde-format msgid "Server said: \"%1\"" msgstr "Ответ сервера: «%1»" #: ksendbugmail/main.cpp:88 #, kde-format msgid "Sends a bug report by email." msgstr "Отправка отчётов об ошибках по электронной почте." #: ksendbugmail/main.cpp:90 #, kde-format msgid "The subject line of the email." msgstr "Тема письма." #: ksendbugmail/main.cpp:91 #, kde-format msgid "The email address to send the bug report to." msgstr "Адрес электронной почты для отправки сообщения об ошибке." #: kshortcuteditwidget.cpp:66 #, kde-format msgid "Default:" msgstr "По умолчанию:" #: kshortcuteditwidget.cpp:74 #, kde-format msgid "Custom:" msgstr "Другая:" #: kshortcutschemeseditor.cpp:44 #, kde-format msgid "Shortcut Schemes" msgstr "Схемы комбинаций клавиш" #: kshortcutschemeseditor.cpp:65 #, kde-format msgid "Current scheme:" msgstr "Текущая схема:" #: kshortcutschemeseditor.cpp:81 #, kde-format msgid "New..." msgstr "Создать..." #: kshortcutschemeseditor.cpp:84 #, kde-format msgid "Delete" msgstr "Удалить" #: kshortcutschemeseditor.cpp:87 #, kde-format msgid "More Actions" msgstr "Дополнительно" #: kshortcutschemeseditor.cpp:91 #, kde-format msgid "Save shortcuts to scheme" msgstr "Сохранить схему комбинаций клавиш" #: kshortcutschemeseditor.cpp:93 #, kde-format msgid "Export Scheme..." msgstr "Экспорт схемы..." #: kshortcutschemeseditor.cpp:95 #, kde-format msgid "Import Scheme..." msgstr "Импорт схемы..." #: kshortcutschemeseditor.cpp:111 #, kde-format msgid "Name for New Scheme" msgstr "Название новой схемы" #: kshortcutschemeseditor.cpp:112 #, kde-format msgid "Name for new scheme:" msgstr "Название новой схемы:" #: kshortcutschemeseditor.cpp:112 #, kde-format msgid "New Scheme" msgstr "Новая схема" #: kshortcutschemeseditor.cpp:118 #, kde-format msgid "A scheme with this name already exists." msgstr "Схема с таким названием уже существует" #: kshortcutschemeseditor.cpp:148 #, kde-format msgid "" "Do you really want to delete the scheme %1?\n" "Note that this will not remove any system wide shortcut schemes." msgstr "Удалить схему «%1»?" #: kshortcutschemeseditor.cpp:178 #, kde-format msgid "Export Shortcuts" msgstr "Экспорт комбинаций клавиш" #: kshortcutschemeseditor.cpp:178 kshortcutschemeseditor.cpp:189 #, kde-format msgid "Shortcuts (*.shortcuts)" msgstr "Комбинации клавиш (*.shortcuts)" #: kshortcutschemeseditor.cpp:189 #, kde-format msgid "Import Shortcuts" msgstr "Импорт комбинаций клавиш" #: kshortcutschemeseditor.cpp:200 #, kde-format msgid "Shortcut scheme successfully saved." msgstr "Схема комбинаций клавиш успешно сохранена." #: kshortcutschemeseditor.cpp:203 #, kde-format msgid "Error saving the shortcut scheme." msgstr "Не удалось сохранить схему комбинаций клавиш." #: kshortcutsdialog.cpp:85 #, kde-format msgid "" "The current shortcut scheme is modified. Save before switching to the new " "one?" msgstr "" "Текущая схема комбинаций клавиш была изменена. Сохранить изменения перед " "переключением на другую схему." #: kshortcutsdialog.cpp:135 #, kde-format msgid "Manage &Schemes" msgstr "Настройка &схем" #: kshortcutsdialog.cpp:154 #, kde-format msgid "Configure Shortcuts" msgstr "Настройка комбинаций клавиш" #. i18n: ectx: property (whatsThis), widget (KTreeWidgetSearchLineWidget, searchFilter) #: kshortcutsdialog.ui:16 #, kde-format msgid "" "Search interactively for shortcut names (e.g. Copy) or combination of keys " "(e.g. Ctrl+C) by typing them here." msgstr "" "Поиск по мере набора по именам комбинаций клавиш (например, Копировать) или " "по самим комбинациям (например, Ctrl+C)." #. i18n: ectx: property (whatsThis), widget (QTreeWidget, list) #: kshortcutsdialog.ui:23 #, kde-format msgid "" "Here you can see a list of key bindings, i.e. associations between actions " "(e.g. 'Copy') shown in the left column and keys or combination of keys (e.g. " "Ctrl+V) shown in the right column." msgstr "" "Здесь показан список комбинаций клавиш. Действия из левого столбца " "(например, Копировать), вызываются при нажатии клавиш или их сочетаний " "(например, Ctrl+V), указанных в правом столбце." #. i18n: ectx: property (text), widget (QTreeWidget, list) #: kshortcutsdialog.ui:33 #, kde-format msgid "Action" msgstr "Действие" #. i18n: ectx: property (text), widget (QTreeWidget, list) #: kshortcutsdialog.ui:38 #, kde-format msgid "Shortcut" msgstr "Комбинация клавиш" #. i18n: ectx: property (text), widget (QTreeWidget, list) #: kshortcutsdialog.ui:43 #, kde-format msgid "Alternate" msgstr "Дополнительная" #. i18n: ectx: property (text), widget (QTreeWidget, list) #: kshortcutsdialog.ui:48 #, kde-format msgid "Global" msgstr "Глобальная" #. i18n: ectx: property (text), widget (QTreeWidget, list) #: kshortcutsdialog.ui:53 #, kde-format msgid "Global Alternate" msgstr "Дополнительная глобальная" #. i18n: ectx: property (text), widget (QTreeWidget, list) #: kshortcutsdialog.ui:58 #, kde-format msgid "Mouse Button Gesture" msgstr "Кнопка росчерка мышью" #. i18n: ectx: property (text), widget (QTreeWidget, list) #: kshortcutsdialog.ui:63 #, kde-format msgid "Mouse Shape Gesture" msgstr "Фигура росчерка мышью" #: kshortcutseditor.cpp:630 kshortcutseditor.cpp:648 #, kde-format msgid "Key Conflict" msgstr "Конфликт клавиш" #: kshortcutseditor.cpp:631 #, kde-format msgid "" "The '%1' shape gesture has already been allocated to the \"%2\" action.\n" "Do you want to reassign it from that action to the current one?" msgstr "" "Фигура росчерка %1 уже связана с действием «%2».\n" "Связать росчерк с текущим действием?" #: kshortcutseditor.cpp:649 #, kde-format msgid "" "The '%1' rocker gesture has already been allocated to the \"%2\" action.\n" "Do you want to reassign it from that action to the current one?" msgstr "" "Зачёркивающий росчерк %1 уже связан с действием «%2».\n" "Связать росчерк с текущим действием?" #: kshortcutseditor.cpp:696 #, kde-format msgctxt "header for an applications shortcut list" msgid "Shortcuts for %1" msgstr "Комбинации клавиш для %1" #. i18n: ectx: property (text), widget (QLabel, priLabel) #: kshortcutseditor.cpp:714 kshortcutwidget.ui:22 #, kde-format msgid "Main:" msgstr "Основная:" #. i18n: ectx: property (text), widget (QLabel, altLabel) #: kshortcutseditor.cpp:715 kshortcutwidget.ui:52 #, kde-format msgid "Alternate:" msgstr "Дополнительная:" #: kshortcutseditor.cpp:716 #, kde-format msgid "Global:" msgstr "Глобальная:" #: kshortcutseditor.cpp:717 #, kde-format msgid "Global alternate:" msgstr "Дополнительная глобальная:" #: kshortcutseditor.cpp:732 #, kde-format msgid "Action Name" msgstr "Название действия" #: kshortcutseditor.cpp:736 #, kde-format msgid "Shortcuts" msgstr "Комбинации клавиш" #: kshortcutseditor.cpp:740 #, kde-format msgid "Description" msgstr "Описание" #: kshortcutseditoritem.cpp:54 #, kde-format msgctxt "@item:intable Action name in shortcuts configuration" msgid "%1" msgstr "%1" #: kswitchlanguagedialog_p.cpp:159 #, kde-format msgid "Switch Application Language" msgstr "Смена языка приложения" #: kswitchlanguagedialog_p.cpp:164 #, kde-format msgid "Please choose the language which should be used for this application:" msgstr "" "Выберите язык интерфейса, который должен использоваться в этом приложении:" #: kswitchlanguagedialog_p.cpp:191 #, kde-format msgid "Add Fallback Language" msgstr "Добавить резервный язык" #: kswitchlanguagedialog_p.cpp:192 #, kde-format msgid "" "Adds one more language which will be used if other translations do not " "contain a proper translation." msgstr "" "Установить один или несколько языков, которые будут использоваться, если нет " "перевода на основной язык." #: kswitchlanguagedialog_p.cpp:289 kswitchlanguagedialog_p.cpp:311 #, kde-format msgid "" "The language for this application has been changed. The change will take " "effect the next time the application is started." msgstr "" "Язык интерфейса приложения изменён. Это изменение вступит в силу при " "следующем запуске приложения." #: kswitchlanguagedialog_p.cpp:290 kswitchlanguagedialog_p.cpp:312 #, kde-format msgid "Application Language Changed" msgstr "Изменён язык приложения" #: kswitchlanguagedialog_p.cpp:400 #, kde-format msgid "Primary language:" msgstr "Основной язык:" #: kswitchlanguagedialog_p.cpp:400 #, kde-format msgid "Fallback language:" msgstr "Резервный язык:" #: kswitchlanguagedialog_p.cpp:415 #, kde-format msgid "Remove" msgstr "Удалить" #: kswitchlanguagedialog_p.cpp:422 #, kde-format msgid "" "This is the main application language which will be used first, before any " "other languages." msgstr "" "Это основной язык интерфейса приложения, который будет использоваться " "первым, перед всеми остальными языками." #: kswitchlanguagedialog_p.cpp:423 #, kde-format msgid "" "This is the language which will be used if any previous languages do not " "contain a proper translation." msgstr "" "Это язык, который будет использоваться, если перевод на основной язык " "отсутствует." # "Подпись кнопки"? (на данный момент она одна, 22 марта 2011 г.) --aspotashev #: ktoolbar.cpp:309 #, kde-format msgctxt "@title:menu" msgid "Show Text" msgstr "Подписи кнопок" #: ktoolbar.cpp:312 #, kde-format msgctxt "@title:menu" msgid "Toolbar Settings" msgstr "Меню панели инструментов" #: ktoolbar.cpp:314 #, kde-format msgctxt "Toolbar orientation" msgid "Orientation" msgstr "Ориентация" #: ktoolbar.cpp:316 #, kde-format msgctxt "toolbar position string" msgid "Top" msgstr "Вверху" #: ktoolbar.cpp:318 #, kde-format msgctxt "toolbar position string" msgid "Left" msgstr "Слева" #: ktoolbar.cpp:319 #, kde-format msgctxt "toolbar position string" msgid "Right" msgstr "Справа" #: ktoolbar.cpp:320 #, kde-format msgctxt "toolbar position string" msgid "Bottom" msgstr "Внизу" #: ktoolbar.cpp:328 #, kde-format msgid "Text Position" msgstr "Положение текста" #: ktoolbar.cpp:330 #, kde-format msgid "Icons Only" msgstr "Только значки" #: ktoolbar.cpp:331 #, kde-format msgid "Text Only" msgstr "Только подписи" #: ktoolbar.cpp:332 #, kde-format msgid "Text Alongside Icons" msgstr "Подписи сбоку от значков" #: ktoolbar.cpp:333 #, kde-format msgid "Text Under Icons" msgstr "Подписи под значками" #: ktoolbar.cpp:341 #, kde-format msgid "Icon Size" msgstr "Размер значков" #: ktoolbar.cpp:343 #, kde-format msgctxt "@item:inmenu Icon size" msgid "Default" msgstr "По умолчанию" #: ktoolbar.cpp:360 ktoolbar.cpp:381 #, kde-format msgid "Small (%1x%2)" msgstr "Малые (%1x%2)" #: ktoolbar.cpp:362 ktoolbar.cpp:383 #, kde-format msgid "Medium (%1x%2)" msgstr "Средние (%1x%2)" #: ktoolbar.cpp:364 ktoolbar.cpp:385 #, kde-format msgid "Large (%1x%2)" msgstr "Большие (%1x%2)" #: ktoolbar.cpp:366 ktoolbar.cpp:387 #, kde-format msgid "Huge (%1x%2)" msgstr "Очень большие (%1x%2)" #: ktoolbar.cpp:409 #, kde-format msgid "Lock Toolbar Positions" msgstr "Заблокировать панели инструментов" #: ktoolbarhandler.cpp:103 #, kde-format msgid "Toolbars Shown" msgstr "Видимые панели инструментов" #: kundoactions.cpp:41 #, kde-format msgid "Redo" msgstr "Повторить" #: kundoactions.cpp:60 #, kde-format msgid "Undo" msgstr "Отменить" #: kxmlguibuilder.cpp:192 kxmlguibuilder.cpp:363 #, kde-format msgid "No text" msgstr "Нет текста" #: kxmlguiwindow.cpp:437 #, kde-format msgid "" "There are two actions (%1, %2) that want to use the same shortcut (%3). This " "is most probably a bug. Please report it in bugs.kde.org" msgstr "" "Два действия (%1, %2) привязаны к одной комбинации клавиш (%3). Скорее " "всего, это говорит об ошибке в программе, сообщите о ней на bugs.kde.org." #: kxmlguiwindow.cpp:437 #, kde-format msgid "Ambiguous Shortcuts" msgstr "Конфликт действий" #. i18n: ectx: Menu (file) #: ui_standards.rc:5 #, kde-format msgid "&File" msgstr "&Файл" #. i18n: ectx: Menu (game) #: ui_standards.rc:34 #, kde-format msgid "&Game" msgstr "&Игра" #. i18n: ectx: Menu (edit) #: ui_standards.rc:61 #, kde-format msgid "&Edit" msgstr "&Правка" #. i18n: ectx: Menu (move) #: ui_standards.rc:84 #, kde-format msgctxt "@title:menu Game move" msgid "&Move" msgstr "&Ход" #. i18n: ectx: Menu (view) #: ui_standards.rc:101 #, kde-format msgid "&View" msgstr "&Вид" #. i18n: ectx: Menu (go) #: ui_standards.rc:117 #, kde-format msgid "&Go" msgstr "Пере&ход" #. i18n: ectx: Menu (bookmarks) #: ui_standards.rc:138 #, kde-format msgid "&Bookmarks" msgstr "&Закладки" #. i18n: ectx: Menu (tools) #: ui_standards.rc:144 #, kde-format msgid "&Tools" msgstr "С&ервис" #. i18n: ectx: Menu (settings) #: ui_standards.rc:148 #, kde-format msgid "&Settings" msgstr "&Настройка" #. i18n: ectx: ToolBar (mainToolBar) #: ui_standards.rc:196 #, kde-format msgid "Main Toolbar" msgstr "Основная панель инструментов" #~ msgctxt "@action:intoolbar Text label of toolbar button" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@info:tooltip Tooltip of toolbar button" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button" #~ msgid "Close" #~ msgstr "Закрыть" #~ msgid "%1" #~ msgstr "%1" #~ msgid "Version %1" #~ msgstr "Версия %1" #~ msgid "&Version" #~ msgstr "&Версия" #~ msgid "&Donate" #~ msgstr "&Сделать пожертвование" #~ msgid "Save as Scheme Defaults" #~ msgstr "Сохранить как схему по умолчанию" #~ msgid "&Details" #~ msgstr "&Подробности" #~ msgid "Export to Location" #~ msgstr "Экспорт в папку" #~ msgid "Could not export shortcuts scheme because the location is invalid." #~ msgstr "Невозможно экспортировать схему в неправильно заданную папку." #~ msgctxt "" #~ "Program name, version and KDE platform version; do not translate " #~ "'Development Platform'" #~ msgid "" #~ "%1
    Version %2
    Using KDE " #~ "Frameworks %3" #~ msgstr "" #~ "%1
    Версия %2
    Использует KDE " #~ "Frameworks %3" #~ msgid "Print" #~ msgstr "Печать" #~ msgid "Reset to Defaults" #~ msgstr "По умолчанию" #~ msgid "Name" #~ msgstr "Название" #~ msgid "Host" #~ msgstr "Узел" #~ msgid "Port" #~ msgstr "Порт" #~ msgid "i18n() takes at least one argument" #~ msgstr "Функция i18n() требует хотя бы один аргумент." #~ msgid "i18nc() takes at least two arguments" #~ msgstr "Функция i18nc() требует хотя бы два аргумента." #~ msgid "i18np() takes at least two arguments" #~ msgstr "Функция i18np() требует хотя бы два аргумента." #~ msgid "i18ncp() takes at least three arguments" #~ msgstr "Функция i18ncp() требует хотя бы три аргумента." #~ msgid "System Default (currently: %1)" #~ msgstr "Стандартный (сейчас: %1)" #~ msgid "Editor Chooser" #~ msgstr "Редактор по умолчанию" #~ msgid "" #~ "Please choose the default text editing component that you wish to use in " #~ "this application. If you choose System Default, the application " #~ "will honor your changes in the System Settings. All other choices will " #~ "override that setting." #~ msgstr "" #~ "Выберите компонент редактирования текста, который вы хотите использовать " #~ "с этим приложением по умолчанию. Если вы выберете Стандартный, " #~ "приложение будет использовать компонент, указанный вами в параметрах " #~ "системы. При выборе любого другого варианта глобальные настройки будут " #~ "игнорироваться." #~ msgid "" #~ "The template needs information about you, which is stored in your address " #~ "book.\n" #~ "However, the required plugin could not be loaded.\n" #~ "\n" #~ "Please install the KDEPIM/Kontact package for your system." #~ msgstr "" #~ "Для заполнения шаблона требуются данные о вас, хранящиеся в адресной " #~ "книге.\n" #~ "Требуемое для этого расширение не найдено.\n" #~ "\n" #~ "Установите пакет KDEPIM/Kontact." #~ msgid "TETest" #~ msgstr "TETest" #~ msgid "Only local files are supported." #~ msgstr "Поддерживаются только локальные файлы." #~ msgid "Keep output results from scripts" #~ msgstr "Сохранять коды выхода из скриптов" #~ msgid "Check whether config file itself requires updating" #~ msgstr "Проверять, требует ли обновления сам файл конфигурации" #~ msgid "File to read update instructions from" #~ msgstr "Читать инструкции по обновлению из файла" #~ msgid "KConf Update" #~ msgstr "KConf Update" #~ msgid "KDE Tool for updating user configuration files" #~ msgstr "Утилита KDE для обновления файлов настроек пользователей" #~ msgid "(c) 2001, Waldo Bastian" #~ msgstr "© Waldo Bastian, 2001" #~ msgid "Waldo Bastian" #~ msgstr "Waldo Bastian" #~ msgid "??" #~ msgstr "??" #~ msgid "" #~ "No information available.\n" #~ "The supplied KAboutData object does not exist." #~ msgstr "" #~ "К сожалению, информация отсутствует.\n" #~ "Программа не предоставила объекта KAboutData." #~ msgid "&License Agreement" #~ msgstr "&Лицензия" #~ msgid "Author" #~ msgstr "Автор" #~ msgid "Email" #~ msgstr "Адрес электронной почты" #~ msgid "Homepage" #~ msgstr "Веб-сайт" #~ msgid "Task" #~ msgstr "Задача" #~ msgid "%1 %2, %3" #~ msgstr "%1 %2, %3" #~ msgid "Other Contributors:" #~ msgstr "Другие участники:" #~ msgid "(No logo available)" #~ msgstr "(Логотип отсутствует)" #~ msgid "Undo: %1" #~ msgstr "Отменить: %1" #~ msgid "Redo: %1" #~ msgstr "Повторить: %1" #~ msgid "&Undo" #~ msgstr "О&тменить действие" #~ msgid "&Redo" #~ msgstr "&Повторить отменённое действие" #~ msgid "&Undo: %1" #~ msgstr "&Отменить: %1" #~ msgid "&Redo: %1" #~ msgstr "&Повторить: %1" #~ msgid "Close" #~ msgstr "Закрыть" #~ msgctxt "Freeze the window geometry" #~ msgid "Freeze" #~ msgstr "Зафиксировать" #~ msgctxt "Dock this window" #~ msgid "Dock" #~ msgstr "Встроить" #~ msgid "Detach" #~ msgstr "Отделить" #~ msgid "Hide %1" #~ msgstr "Скрыть %1" #~ msgid "Show %1" #~ msgstr "Показать %1" #~ msgid "Search Columns" #~ msgstr "Столбцы для поиска" #~ msgid "All Visible Columns" #~ msgstr "Все показанные столбцы" #~ msgctxt "Column number %1" #~ msgid "Column No. %1" #~ msgstr "Столбец № %1" #~ msgid "S&earch:" #~ msgstr "&Поиск:" #~ msgid "&Password:" #~ msgstr "&Пароль:" #~ msgid "&Keep password" #~ msgstr "Сохранить паро&ль" #~ msgid "&Verify:" #~ msgstr "&Проверка:" #~ msgid "Password strength meter:" #~ msgstr "Датчик надёжности пароля:" #~ msgid "" #~ "The password strength meter gives an indication of the security of the " #~ "password you have entered. To improve the strength of the password, " #~ "try:\n" #~ " - using a longer password;\n" #~ " - using a mixture of upper- and lower-case letters;\n" #~ " - using numbers or symbols, such as #, as well as letters." #~ msgstr "" #~ "Датчик показывает защищённость или надёжность введённого пароля. Пароль " #~ "будет более надёжным, если:\n" #~ " - он имеет достаточную длину;\n" #~ " - в него входят как прописные, так и строчные буквы;\n" #~ " - в него входят помимо букв числа и специальные символы, такие как #." #~ msgid "Passwords do not match" #~ msgstr "Пароли не совпадают" #~ msgid "You entered two different passwords. Please try again." #~ msgstr "Введённые пароли не совпадают. Попробуйте ещё раз." #~ msgid "" #~ "The password you have entered has a low strength. To improve the strength " #~ "of the password, try:\n" #~ " - using a longer password;\n" #~ " - using a mixture of upper- and lower-case letters;\n" #~ " - using numbers or symbols as well as letters.\n" #~ "\n" #~ "Would you like to use this password anyway?" #~ msgstr "" #~ "Введён слабый пароль. Пароль будет более надёжным, если:\n" #~ " - он имеет достаточную длину;\n" #~ " - в него входят как прописные, так и строчные буквы;\n" #~ " - в него входят помимо букв числа и специальные символы.\n" #~ "\n" #~ "Использовать введённый пароль?" #~ msgid "Low Password Strength" #~ msgstr "Слабый пароль" #~ msgid "Password Input" #~ msgstr "Ввод пароля" #~ msgid "Password is empty" #~ msgstr "Пустой пароль" #~ msgid "Password must be at least 1 character long" #~ msgid_plural "Password must be at least %1 characters long" #~ msgstr[0] "Пароль должен быть не короче %1 символа" #~ msgstr[1] "Пароль должен быть не короче %1 символов" #~ msgstr[2] "Пароль должен быть не короче %1 символов" #~ msgstr[3] "Пароль должен быть не короче %1 символа" #~ msgid "Passwords match" #~ msgstr "Пароли совпадают" #~ msgctxt "@option:check" #~ msgid "Do Spellchecking" #~ msgstr "Проверить орфографию" #~ msgctxt "@option:check" #~ msgid "Create &root/affix combinations not in dictionary" #~ msgstr "Соз&давать сочетания корней/аффиксов не в словаре" #~ msgctxt "@option:check" #~ msgid "Consider run-together &words as spelling errors" #~ msgstr "С&читать ошибкой написанные вместе слова" #~ msgctxt "@label:listbox" #~ msgid "&Dictionary:" #~ msgstr "&Словарь:" #~ msgctxt "@label:listbox" #~ msgid "&Encoding:" #~ msgstr "&Кодировка:" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "International Ispell" #~ msgstr "Международный Ispell" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Aspell" #~ msgstr "Aspell" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Hspell" #~ msgstr "Hspell" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Zemberek" #~ msgstr "Zemberek" #~ msgctxt "@item:inlistbox Spell checker" #~ msgid "Hunspell" #~ msgstr "Hunspell" #~ msgctxt "@label:listbox" #~ msgid "&Client:" #~ msgstr "&Программа проверки:" #~ msgctxt "@item Spelling dictionary" #~ msgid "Hebrew" #~ msgstr "Иврит" #~ msgctxt "@item Spelling dictionary" #~ msgid "Turkish" #~ msgstr "Турецкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "English" #~ msgstr "Английский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Spanish" #~ msgstr "Испанский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Danish" #~ msgstr "Датский" #~ msgctxt "@item Spelling dictionary" #~ msgid "German" #~ msgstr "Немецкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "German (new spelling)" #~ msgstr "Немецкий (новая орфография)" #~ msgctxt "@item Spelling dictionary" #~ msgid "Brazilian Portuguese" #~ msgstr "Португальский (Бразилия)" #~ msgctxt "@item Spelling dictionary" #~ msgid "Portuguese" #~ msgstr "Португальский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Esperanto" #~ msgstr "Эсперанто" #~ msgctxt "@item Spelling dictionary" #~ msgid "Norwegian" #~ msgstr "Норвежский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Polish" #~ msgstr "Польский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Russian" #~ msgstr "Русский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Slovenian" #~ msgstr "Словенский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Slovak" #~ msgstr "Словацкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "Czech" #~ msgstr "Чешский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Swedish" #~ msgstr "Шведский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Swiss German" #~ msgstr "Швейцарский немецкий" #~ msgctxt "@item Spelling dictionary" #~ msgid "Ukrainian" #~ msgstr "Украинский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Lithuanian" #~ msgstr "Литовский" #~ msgctxt "@item Spelling dictionary" #~ msgid "French" #~ msgstr "Французский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Belarusian" #~ msgstr "Белорусский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Hungarian" #~ msgstr "Венгерский" #~ msgctxt "@item Spelling dictionary" #~ msgid "Unknown" #~ msgstr "Неизвестный" #~ msgctxt "@item Spelling dictionary" #~ msgid "ISpell Default" #~ msgstr "ISpell по умолчанию" #~ msgctxt "@item Spelling dictionary: %1 dictionary name, %2 file name" #~ msgid "Default - %1 [%2]" #~ msgstr "По умолчанию: %1 [%2]" #~ msgctxt "@item Spelling dictionary" #~ msgid "ASpell Default" #~ msgstr "ASpell по умолчанию" #~ msgctxt "@item Spelling dictionary: %1 dictionary name" #~ msgid "Default - %1" #~ msgstr "По умолчанию: %1" #~ msgctxt "@item Spelling dictionary" #~ msgid "Hunspell Default" #~ msgstr "Hunspell по умолчанию" #~ msgid "You have to restart the dialog for changes to take effect" #~ msgstr "Чтобы изменения вступили в силу, необходимо перезапустить диалог" #~ msgid "Spell Checker" #~ msgstr "Проверка орфографии" #~ msgid "Check Spelling" #~ msgstr "Проверить орфографию" #~ msgid "&Finished" #~ msgstr "&Готово" #~ msgid "" #~ "

    This word was considered to be an \"unknown word\" because it does " #~ "not match any entry in the dictionary currently in use. It may also be a " #~ "word in a foreign language.

    \n" #~ "

    If the word is not misspelled, you may add it to the dictionary by " #~ "clicking Add to Dictionary. If you do not want to add the unknown " #~ "word to the dictionary, but you want to leave it unchanged, click " #~ "Ignore or Ignore All.

    \n" #~ "

    However, if the word is misspelled, you can try to find the correct " #~ "replacement in the list below. If you cannot find a replacement there, " #~ "you may type it in the text box below, and click Replace or " #~ "Replace All.

    \n" #~ "    " #~ msgstr "" #~ "

    Это слово отсутствует в текущем словаре. Возможно, это иностранное " #~ "слово или неологизм.

    \n" #~ "

    Если вы уверены, что слово не содержит ошибок, вы можете его " #~ "Добавить в словарь. Если вы не хотите это делать, просто нажмите " #~ "Игнорировать или Игнорировать везде.

    \n" #~ "

    Если слово содержит опечатку, выберите из списка подходящий вариант. " #~ "Если такого не имеется, введите слово вручную и нажмите Заменить " #~ "или Заменить все.

    \n" #~ "    " #~ msgid "Unknown word:" #~ msgstr "Неизвестное слово:" #~ msgid "Unknown word" #~ msgstr "Неизвестное слово" #~ msgid "misspelled" #~ msgstr "ошибочно" #~ msgid "" #~ "\n" #~ "

    Select the language of the document you are proofing here.

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Выберите язык проверяемого документа.

    \n" #~ "    " #~ msgid "&Language:" #~ msgstr "&Язык:" #~ msgid "Text excerpt showing the unknown word in its context." #~ msgstr "Отрывок текста со словом, содержащим ошибку." #~ msgid "" #~ "\n" #~ "

    Here you can see a text excerpt showing the unknown word in its " #~ "context. If this information is not sufficient to choose the best " #~ "replacement for the unknown word, you can click on the document you are " #~ "proofing, read a larger part of the text and then return here to continue " #~ "proofing.

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Здесь показывается контекст слова, содержащего ошибку. Если этого " #~ "отрывка недостаточно, щёлкните на документе, прочитайте основной текст и " #~ "вернитесь в диалог проверки орфографии.

    \n" #~ "    " #~ msgid "... the misspelled word shown in context ..." #~ msgstr "... ошибочное слово показано в контексте ..." #~ msgid "" #~ "\n" #~ "

    The unknown word was detected and considered unknown because it is not " #~ "included in the dictionary.
    \n" #~ "Click here if you consider the unknown word not to be misspelled, and you " #~ "want to avoid wrongly detecting it again in the future. If you want to " #~ "let it remain as is, but not add it to the dictionary, then click " #~ "Ignore or Ignore All instead.

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Это слово отсутствует в текущем словаре. Возможно, это иностранное " #~ "слово или неологизм.

    \n" #~ "

    Если вы уверены, что слово не содержит ошибок, вы можете его " #~ "Добавить в словарь. Если вы не хотите это делать, просто нажмите " #~ "Игнорировать или Игнорировать везде.

    \n" #~ "    " #~ msgid "<< Add to Dictionary" #~ msgstr "<< Добавить в словарь" #~ msgid "" #~ "\n" #~ "

    Click here to replace all occurrences of the unknown text with the " #~ "text in the edit box above (to the left).

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Заменить это слово во всём документе.

    \n" #~ "    " #~ msgid "R&eplace All" #~ msgstr "Зам&енить все" #~ msgid "Suggestion List" #~ msgstr "Предлагаемые варианты" #~ msgid "" #~ "\n" #~ "

    If the unknown word is misspelled, you should check if the correction " #~ "for it is available and if it is, click on it. If none of the words in " #~ "this list is a good replacement you may type the correct word in the edit " #~ "box above.

    \n" #~ "

    To correct this word click Replace if you want to correct only " #~ "this occurrence or Replace All if you want to correct all " #~ "occurrences.

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Если слово содержит ошибку, проверьте наличие правильного варианта в " #~ "предлагаемом списке. Если его там не будет, вы можете ввести правильный " #~ "вариант вручную.

    \n" #~ "

    Чтобы исправить это слово только в этом месте нажмите Заменить, " #~ "а чтобы исправить его во всём документе, воспользуйтесь Заменить все.

    \n" #~ "    " #~ msgid "Suggested Words" #~ msgstr "Предлагаемые слова" #~ msgid "" #~ "\n" #~ "

    Click here to replace this occurrence of the unknown text with the " #~ "text in the edit box above (to the left).

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Заменить слово в данном случае.

    \n" #~ "    " #~ msgid "&Replace" #~ msgstr "&Заменить" #~ msgid "" #~ "\n" #~ "

    If the unknown word is misspelled, you should type the correction for " #~ "your misspelled word here or select it from the list below.

    \n" #~ "

    You can then click Replace if you want to correct only this " #~ "occurrence of the word or Replace All if you want to correct all " #~ "occurrences.

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Введите здесь правильный вариант написания слова или выберите го из " #~ "списка.

    \n" #~ "

    Затем нажмите Заменить либо Заменить все.

    \n" #~ "    " #~ msgid "Replace &with:" #~ msgstr "Заменить &на:" #~ msgid "" #~ "\n" #~ "

    Click here to let this occurrence of the unknown word remain as is.\n" #~ "

    This action is useful when the word is a name, an acronym, a foreign " #~ "word or any other unknown word that you want to use but not add to the " #~ "dictionary.

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Не проверять это слово.

    \n" #~ "

    Это может быть полезно, если слово является именем, сокращением, " #~ "иностранным словом или любым другим словом, которое вы хотите " #~ "использовать, но не хотите добавлять в словарь.

    \n" #~ "    " #~ msgid "&Ignore" #~ msgstr "&Игнорировать" #~ msgid "" #~ "\n" #~ "

    Click here to let all occurrences of the unknown word remain as they " #~ "are.

    \n" #~ "

    This action is useful when the word is a name, an acronym, a foreign " #~ "word or any other unknown word that you want to use but not add to the " #~ "dictionary.

    \n" #~ "    " #~ msgstr "" #~ "\n" #~ "

    Не проверять все вхождения этого слова в тексте.

    \n" #~ "

    Это может быть полезно, если слово является именем, сокращением, " #~ "иностранным словом или любым другим словом, которое вы хотите " #~ "использовать, но не хотите добавлять в словарь.

    \n" #~ "    " #~ msgid "I&gnore All" #~ msgstr "Игнорировать вез&де" #~ msgid "S&uggest" #~ msgstr "В&ариант" #~ msgid "Language Selection" #~ msgstr "Выбор языка" #~ msgid "As-you-type spell checking enabled." #~ msgstr "Проверка орфографии на лету включена." #~ msgid "As-you-type spell checking disabled." #~ msgstr "Проверка орфографии на лету выключена." #~ msgid "Incremental Spellcheck" #~ msgstr "Проверка орфографии на лету" #~ msgid "Too many misspelled words. As-you-type spell checking disabled." #~ msgstr "" #~ "Слишком много ошибочных слов. Проверка орфографии на лету выключена." #~ msgid "Check Spelling..." #~ msgstr "Проверить орфографию..." #~ msgid "Auto Spell Check" #~ msgstr "Автоматическая проверка орфографии" #~ msgid "Allow Tabulations" #~ msgstr "Разрешить табуляцию" #~ msgid "Spell Checking" #~ msgstr "Проверка орфографии" #~ msgid "&Back" #~ msgstr "&Назад" #~ msgctxt "Opposite to Back" #~ msgid "&Next" #~ msgstr "&Вперёд" #~ msgid "Unknown View" #~ msgstr "Неизвестный вид" #~ msgid "" #~ "A command-line application that can be used to run KUnitTest modules." #~ msgstr "Утилита командной строки для запуска модулей KUnitTest." #~ msgid "Only run modules whose filenames match the regexp." #~ msgstr "Запустить только модули, совпадающие с регулярным выражением." #~ msgid "" #~ "Only run tests modules which are found in the folder. Use the query " #~ "option to select modules." #~ msgstr "" #~ "Запустить модули тестов из папки. Измените параметры запроса для выбора " #~ "модулей." #~ msgid "" #~ "Disables debug capturing. You typically use this option when you use the " #~ "GUI." #~ msgstr "" #~ "Отключить отладку захвата. Обычно применяется при использовании " #~ "графического интерфейса." #~ msgid "KUnitTest ModRunner" #~ msgstr "KUnitTest ModRunner" #~ msgid "(C) 2005 Jeroen Wijnhout" #~ msgstr "© Jeroen Wijnhout, 2005" #~ msgid "DBus Backend error: connection to helper failed. %1" #~ msgstr "Внутренняя ошибка DBus: сбой подключения к обработчику. %1" # BUGME: Message error -> error message #~ msgid "" #~ "DBus Backend error: could not contact the helper. Connection error: %1. " #~ "Message error: %2" #~ msgstr "" #~ "Внутренняя ошибка DBus: сбой подключения к обработчику. Ошибка " #~ "подключения: %1. Сообщение об ошибке: %2" # BUGME: absolutely no information on what "%1" is #~ msgid "DBus Backend error: received corrupt data from helper %1 %2" #~ msgstr "" #~ "Внутренняя ошибка DBus: получены повреждённые данные от обработчика. %1 %2" #~ msgid "Please contact your system administrator." #~ msgstr "Свяжитесь с вашим системным администратором." #~ msgid "Configuration file \"%1\" not writable.\n" #~ msgstr "Файл конфигурации «%1» защищён от записи.\n" #~ msgid "am" #~ msgstr "am" #~ msgid "pm" #~ msgstr "pm" #~ msgid "No target filename has been given." #~ msgstr "Не указан целевой файл." #~ msgid "Already opened." #~ msgstr "Файл уже открыт." #~ msgid "Insufficient permissions in target directory." #~ msgstr "Недостаточно прав для записи в целевую папку." #~ msgid "Unable to open temporary file. Error was: %1." #~ msgstr "Не удалось открыть временный файл. Произошла ошибка: %1" #~ msgid "Synchronization to disk failed" #~ msgstr "Ошибка синхронизации с диском" #~ msgid "Error during rename." #~ msgstr "Ошибка при попытке переименования." #~ msgid "kde4-config" #~ msgstr "kde4-config" #~ msgid "A little program to output installation paths" #~ msgstr "Программа, выводящая пути каталогов KDE" #~ msgid "(C) 2000 Stephan Kulow" #~ msgstr "© Stephan Kulow, 2000" #~ msgid "Left for legacy support" #~ msgstr "Зарезервировано для устаревших приложений" #~ msgid "Compiled in prefix for KDE libraries" #~ msgstr "Встроенный prefix для библиотек KDE" #~ msgid "Compiled in exec_prefix for KDE libraries" #~ msgstr "Встроенный exec_prefix для библиотек KDE" #~ msgid "Compiled in library path suffix" #~ msgstr "Встроенный путь к библиотекам" #~ msgid "Prefix in $HOME used to write files" #~ msgstr "Путь в $HOME для записи файлов" #~ msgid "Compiled in version string for KDE libraries" #~ msgstr "Встроенная строка - версия библиотек KDE" #~ msgid "Available KDE resource types" #~ msgstr "Доступные типы ресурсов KDE" #~ msgid "Search path for resource type" #~ msgstr "Путь поиска типов ресурсов" #~ msgid "Find filename inside the resource type given to --path" #~ msgstr "Поиск имени файла для типа ресурса, указанного в --path" #~ msgid "User path: desktop|autostart|document" #~ msgstr "Пользовательский путь: desktop|autostart|document" #~ msgid "Prefix to install resource files to" #~ msgstr "Путь для установки файлов ресурсов" #~ msgid "Installation prefix for Qt" #~ msgstr "Путь к установленной библиотеке Qt" #~ msgid "Location of installed Qt binaries" #~ msgstr "Расположение установленных бинарных файлов Qt" #~ msgid "Location of installed Qt libraries" #~ msgstr "Расположение установленных библиотек Qt" #~ msgid "Location of installed Qt plugins" #~ msgstr "Расположение установленных расширений Qt" #~ msgid "Applications menu (.desktop files)" #~ msgstr "Меню приложений (файлы .desktop)" #~ msgid "Autostart directories" #~ msgstr "Папки автозапуска" #~ msgid "Cached information (e.g. favicons, web-pages)" #~ msgstr "Кэшированная информация (например, значки сайтов, веб-страницы)" #~ msgid "CGIs to run from kdehelp" #~ msgstr "CGI, вызываемые из kdehelp" #~ msgid "Configuration files" #~ msgstr "Конфигурационные файле" #~ msgid "Where applications store data" #~ msgstr "Хранилище данных приложений" #~ msgid "Emoticons" #~ msgstr "Смайлики" #~ msgid "Executables in $prefix/bin" #~ msgstr "Исполняемые файлы из $prefix/bin" #~ msgid "HTML documentation" #~ msgstr "Документация HTML" #~ msgid "Icons" #~ msgstr "Значки" #~ msgid "Configuration description files" #~ msgstr "Файлы описания конфигурации" #~ msgid "Includes/Headers" #~ msgstr "Заголовки" #~ msgid "Translation files for KLocale" #~ msgstr "Файлы перевода для KLocale" #~ msgid "Mime types" #~ msgstr "Типы MIME" #~ msgid "Loadable modules" #~ msgstr "Загружаемые расширения" #~ msgid "Legacy pixmaps" #~ msgstr "Устаревшие значки" #~ msgid "Qt plugins" #~ msgstr "Расширения Qt" #~ msgid "Services" #~ msgstr "Службы" #~ msgid "Service types" #~ msgstr "Типы служб" #~ msgid "Application sounds" #~ msgstr "Звуковые файлы приложений" #~ msgid "Templates" #~ msgstr "Шаблоны" #~ msgid "Wallpapers" #~ msgstr "Обои" #~ msgid "XDG Application menu (.desktop files)" #~ msgstr "Меню приложений XDG (файлы .desktop)" #~ msgid "XDG Menu descriptions (.directory files)" #~ msgstr "Описание меню XDG (файлы .directory)" #~ msgid "XDG Icons" #~ msgstr "Значки XDG" #~ msgid "XDG Mime Types" #~ msgstr "Типы MIME XDG" #~ msgid "XDG Menu layout (.menu files)" #~ msgstr "Меню XDG (файлы .menu)" #~ msgid "XDG autostart directory" #~ msgstr "Папки автозапуска XDG" #~ msgid "Temporary files (specific for both current host and current user)" #~ msgstr "" #~ "Временные файлы (для конкретного компьютера и текущего пользователя)" #~ msgid "UNIX Sockets (specific for both current host and current user)" #~ msgstr "Сокеты UNIX (для конкретного компьютера и текущего пользователя)" #~ msgid "%1 - unknown type\n" #~ msgstr "%1 - неизвестный тип\n" #~ msgid "%1 - unknown type of userpath\n" #~ msgstr "%1 - неизвестный тип или путь\n" #~ msgid "" #~ "No licensing terms for this program have been specified.\n" #~ "Please check the documentation or the source for any\n" #~ "licensing terms.\n" #~ msgstr "" #~ "Лицензия в данной программе не указана.\n" #~ "Возможно, она указана в документации или в исходных текстах этой " #~ "программы.\n" #~ msgid "This program is distributed under the terms of the %1." #~ msgstr "Программа распространяется на условиях %1." #~ msgctxt "@item license (short name)" #~ msgid "GPL v2" #~ msgstr "GPL v2" #~ msgctxt "@item license" #~ msgid "GNU General Public License Version 2" #~ msgstr "GNU General Public License, версия 2" #~ msgctxt "@item license (short name)" #~ msgid "LGPL v2" #~ msgstr "LGPL v2" #~ msgctxt "@item license" #~ msgid "GNU Lesser General Public License Version 2" #~ msgstr "GNU Lesser General Public License, версия 2" #~ msgctxt "@item license (short name)" #~ msgid "BSD License" #~ msgstr "Лицензия BSD" #~ msgctxt "@item license" #~ msgid "BSD License" #~ msgstr "Лицензия BSD" #~ msgctxt "@item license (short name)" #~ msgid "Artistic License" #~ msgstr "Artistic License" #~ msgctxt "@item license" #~ msgid "Artistic License" #~ msgstr "Artistic License" #~ msgctxt "@item license (short name)" #~ msgid "QPL v1.0" #~ msgstr "QPL v1.0" #~ msgctxt "@item license" #~ msgid "Q Public License" #~ msgstr "Q Public License" #~ msgctxt "@item license (short name)" #~ msgid "GPL v3" #~ msgstr "GPL v3" #~ msgctxt "@item license" #~ msgid "GNU General Public License Version 3" #~ msgstr "GNU General Public License, версия 3" #~ msgctxt "@item license (short name)" #~ msgid "LGPL v3" #~ msgstr "LGPL v3" #~ msgctxt "@item license" #~ msgid "GNU Lesser General Public License Version 3" #~ msgstr "GNU Lesser General Public License, версия 3" #~ msgctxt "@item license" #~ msgid "Custom" #~ msgstr "Другая лицензия" #~ msgctxt "@item license" #~ msgid "Not specified" #~ msgstr "Лицензия не указана" #~ msgid "Use the X-server display 'displayname'" #~ msgstr "Использовать дисплей X-сервера «displayname»" #~ msgid "Use the QWS display 'displayname'" #~ msgstr "Использовать QWS дисплей «displayname»" #~ msgid "Restore the application for the given 'sessionId'" #~ msgstr "Восстановить сеанс приложения по ключу «sessionId»" #~ msgid "" #~ "Causes the application to install a private color\n" #~ "map on an 8-bit display" #~ msgstr "" #~ "В случае 8-битного дисплея приложение\n" #~ "будет использовать собственную таблицу\n" #~ "цветов" #~ msgid "" #~ "Limits the number of colors allocated in the color\n" #~ "cube on an 8-bit display, if the application is\n" #~ "using the QApplication::ManyColor color\n" #~ "specification" #~ msgstr "" #~ "Ограничить количество используемых \n" #~ "цветов на 8-битном дисплее. Этот параметр \n" #~ "работает только для приложений, \n" #~ "использующих режим\n" #~ "QApplication::ManyColor." #~ msgid "tells Qt to never grab the mouse or the keyboard" #~ msgstr "Запрещает Qt перехватывать мышь или клавиатуру" #~ msgid "" #~ "running under a debugger can cause an implicit\n" #~ "-nograb, use -dograb to override" #~ msgstr "" #~ "при запуске в отладчике применять\n" #~ "-nograb. Используйте -dograb, чтобы явно включить этот режим" #~ msgid "switches to synchronous mode for debugging" #~ msgstr "включает синхронный режим для отладки" #~ msgid "defines the application font" #~ msgstr "определяет шрифт приложения" #~ msgid "" #~ "sets the default background color and an\n" #~ "application palette (light and dark shades are\n" #~ "calculated)" #~ msgstr "" #~ "задаёт цвет фона по умолчанию и палитру\n" #~ "приложения (светлые и тёмные тени\n" #~ "вычисляются)." #~ msgid "sets the default foreground color" #~ msgstr "определяет цвет текста по умолчанию" #~ msgid "sets the default button color" #~ msgstr "определяет цвет кнопок по умолчанию" #~ msgid "sets the application name" #~ msgstr "определяет имя приложения" #~ msgid "sets the application title (caption)" #~ msgstr "устанавливает заголовок приложения" #~ msgid "load the testability framework" #~ msgstr "загрузить тестовое окружение" #~ msgid "" #~ "forces the application to use a TrueColor visual on\n" #~ "an 8-bit display" #~ msgstr "" #~ "Приложение будет работать с 8-битным\n" #~ "дисплеем как с полноцветным устройством." #~ msgid "" #~ "sets XIM (X Input Method) input style. Possible\n" #~ "values are onthespot, overthespot, offthespot and\n" #~ "root" #~ msgstr "" #~ "Устанавливает тип ввода XIM (X Input Method).\n" #~ "Возможные значения: onthespot, overthespot, offthespot и \n" #~ "root." #~ msgid "set XIM server" #~ msgstr "устанавливает сервер XIM" #~ msgid "disable XIM" #~ msgstr "запретить XIM" #~ msgid "forces the application to run as QWS Server" #~ msgstr "Заставляет приложение работать как QWS сервер" #~ msgid "mirrors the whole layout of widgets" #~ msgstr "отразить расположение виджетов" #~ msgid "applies the Qt stylesheet to the application widgets" #~ msgstr "применяет стиль Qt к графическим элементам приложения" #~ msgid "" #~ "use a different graphics system instead of the default one, options are " #~ "raster and opengl (experimental)" #~ msgstr "" #~ "использовать указанную графическую подсистему для эффектов: raster или " #~ "opengl" #~ msgid "" #~ "QML JS debugger information. Application must be\n" #~ "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" #~ "enabled" #~ msgstr "" #~ "Отладочная информация QML JS. Для включения\n" #~ "отладчика приложение должно быть собрано с ключом\n" #~ "-DQT_DECLARATIVE_DEBUG" #~ msgid "Use 'caption' as name in the titlebar" #~ msgstr "Использовать имя «caption» в заголовке" #~ msgid "Use 'icon' as the application icon" #~ msgstr "Использовать «icon» как значок приложения" #~ msgid "Use alternative configuration file" #~ msgstr "Использовать альтернативный файл конфигурации" #~ msgid "Disable crash handler, to get core dumps" #~ msgstr "" #~ "Отключить обработчик сбоев. Это позволит в случае сбоя получить core dump." #~ msgid "Waits for a WM_NET compatible windowmanager" #~ msgstr "Ожидать инициализации WM_NET-совместимого оконного менеджера" #~ msgid "sets the application GUI style" #~ msgstr "устанавливает стиль графического интерфейса приложения" #~ msgid "" #~ "sets the client geometry of the main widget - see man X for the argument " #~ "format (usually WidthxHeight+XPos+YPos)" #~ msgstr "" #~ "устанавливает положение и размер главного окна приложения - формат " #~ "аргумента см. в man X (обычно это ШИРИНА×ВЫСОТА+X+Y)" #~ msgid "KDE Application" #~ msgstr "Приложение KDE" #~ msgid "Qt" #~ msgstr "Qt" #~ msgid "KDE" #~ msgstr "KDE" #~ msgid "Unknown option '%1'." #~ msgstr "Неизвестный параметр %1." #~ msgctxt "@info:shell %1 is cmdoption name" #~ msgid "'%1' missing." #~ msgstr "Отсутствует %1." #~ msgctxt "" #~ "@info:shell message on appcmd --version; do not translate 'Development " #~ "Platform'%3 application name, other %n version strings" #~ msgid "" #~ "Qt: %1\n" #~ "KDE Development Platform: %2\n" #~ "%3: %4\n" #~ msgstr "" #~ "Qt: %1\n" #~ "KDE: %2\n" #~ "%3: %4\n" #~ msgctxt "the 2nd argument is a list of name+address, one on each line" #~ msgid "" #~ "%1 was written by\n" #~ "%2" #~ msgstr "" #~ "%1 написали:\n" #~ "%2" #~ msgid "" #~ "This application was written by somebody who wants to remain anonymous." #~ msgstr "Автор программы пожелал остаться неизвестным." #~ msgid "Please use http://bugs.kde.org to report bugs.\n" #~ msgstr "Используйте http://bugs.kde.org для сообщений об ошибках.\n" #~ msgid "Please report bugs to %1.\n" #~ msgstr "Используйте %1 для сообщений об ошибках.\n" #~ msgid "Unexpected argument '%1'." #~ msgstr "Недопустимый аргумент %1." #~ msgid "Use --help to get a list of available command line options." #~ msgstr "Используйте --help для вывода списка доступных параметров." #~ msgid "[options] " #~ msgstr "[параметры] " #~ msgid "[%1-options]" #~ msgstr "[параметры %1]" #~ msgid "Usage: %1 %2\n" #~ msgstr "Использование: %1 %2\n" #~ msgid "" #~ "\n" #~ "Generic options:\n" #~ msgstr "" #~ "\n" #~ "Общие параметры:\n" #~ msgid "Show help about options" #~ msgstr "Показать справку о параметрах" #~ msgid "Show %1 specific options" #~ msgstr "Показать специфические параметры %1" #~ msgid "Show all options" #~ msgstr "Показать список всех параметров" #~ msgid "Show author information" #~ msgstr "Показать сведения об авторе" #~ msgid "Show version information" #~ msgstr "Показать сведения о версии" #~ msgid "Show license information" #~ msgstr "Показать сведения о лицензии" #~ msgid "End of options" #~ msgstr "Конец параметров" #~ msgid "" #~ "\n" #~ "%1 options:\n" #~ msgstr "" #~ "\n" #~ "Параметры %1:\n" #~ msgid "" #~ "\n" #~ "Options:\n" #~ msgstr "" #~ "\n" #~ "Параметры:\n" #~ msgid "" #~ "\n" #~ "Arguments:\n" #~ msgstr "" #~ "\n" #~ "Аргументы:\n" #~ msgid "The files/URLs opened by the application will be deleted after use" #~ msgstr "" #~ "Файлы или ссылки, открытые приложением, будут удалены после использования" #~ msgid "KDE-tempfile" #~ msgstr "KDE-tempfile" #~ msgid "Function must be called from the main thread." #~ msgstr "Функция должна быть вызвана из основного потока процесса." #~ msgid "" #~ "Error launching %1. Either KLauncher is not running anymore, or it failed " #~ "to start the application." #~ msgstr "" #~ "Не удалось запустить «%1». KLauncher либо не запущен, либо не смог " #~ "запустить приложение." #~ msgid "" #~ "KLauncher could not be reached via D-Bus. Error when calling %1:\n" #~ "%2\n" #~ msgstr "" #~ "KLauncher недоступен через D-Bus, ошибка вызова %1:\n" #~ "%2\n" #~ msgid "" #~ "Could not launch the KDE Help Center:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить Центр справки KDE:\n" #~ "\n" #~ "%1" #~ msgid "Could not Launch Help Center" #~ msgstr "Не удалось запустить Центр справки KDE" #~ msgid "" #~ "Could not launch the mail client:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить почтовый клиент:\n" #~ "\n" #~ "%1" #~ msgid "Could not launch Mail Client" #~ msgstr "Не удалось запустить почтовый клиент" #~ msgid "" #~ "Could not launch the browser:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить веб-браузер:\n" #~ "\n" #~ "%1" #~ msgid "Could not launch Browser" #~ msgstr "Не удалось запустить веб-браузер" #~ msgid "" #~ "Could not launch the terminal client:\n" #~ "\n" #~ "%1" #~ msgstr "" #~ "Не удалось запустить эмулятор терминала:\n" #~ "\n" #~ "%1" #~ msgid "Could not launch Terminal Client" #~ msgstr "Не удалось запустить эмулятор терминала" #~ msgctxt "@item Text character set" #~ msgid "Western European" #~ msgstr "Западная Европа" #~ msgctxt "@item Text character set" #~ msgid "Central European" #~ msgstr "Центральная Европа" #~ msgctxt "@item Text character set" #~ msgid "Baltic" #~ msgstr "Прибалтийское письмо" #~ msgctxt "@item Text character set" #~ msgid "South-Eastern Europe" #~ msgstr "Юго-восточная Европа" #~ msgctxt "@item Text character set" #~ msgid "Turkish" #~ msgstr "Турецкое письмо" #~ msgctxt "@item Text character set" #~ msgid "Cyrillic" #~ msgstr "Кириллица" # Здесь речь идёт не о локали, а о наборе символов. В случае локали перевод "Китайский (Тайвань)", т.к. локаль zh_TW. #~ msgctxt "@item Text character set" #~ msgid "Chinese Traditional" #~ msgstr "Китайское письмо (традиционное)" #~ msgctxt "@item Text character set" #~ msgid "Chinese Simplified" #~ msgstr "Китайское письмо (упрощённое)" #~ msgctxt "@item Text character set" #~ msgid "Korean" #~ msgstr "Корейское письмо" #~ msgctxt "@item Text character set" #~ msgid "Japanese" #~ msgstr "Японское письмо" #~ msgctxt "@item Text character set" #~ msgid "Greek" #~ msgstr "Греческое письмо" #~ msgctxt "@item Text character set" #~ msgid "Arabic" #~ msgstr "Арабское письмо" #~ msgctxt "@item Text character set" #~ msgid "Hebrew" #~ msgstr "Иврит" #~ msgctxt "@item Text character set" #~ msgid "Thai" #~ msgstr "Тайское письмо" #~ msgctxt "@item Text character set" #~ msgid "Unicode" #~ msgstr "Юникод" #~ msgctxt "@item Text character set" #~ msgid "Northern Saami" #~ msgstr "Северносаамский" #~ msgctxt "@item Text character set" #~ msgid "Other" #~ msgstr "Другие" #~ msgctxt "@item %1 character set, %2 encoding" #~ msgid "%1 ( %2 )" #~ msgstr "%1 (%2)" #~ msgctxt "@item" #~ msgid "Other encoding (%1)" #~ msgstr "Другая кодировка (%1)" #~ msgctxt "@item Text encoding: %1 character set, %2 encoding" #~ msgid "%1 ( %2 )" #~ msgstr "%1 (%2)" #~ msgctxt "@item Text character set" #~ msgid "Disabled" #~ msgstr "Отключена" #~ msgctxt "@item Text character set" #~ msgid "Universal" #~ msgstr "Универсальная" #~ msgctxt "digit set" #~ msgid "Arabic-Indic" #~ msgstr "Арабские цифры, используемые в арабских странах" #~ msgctxt "digit set" #~ msgid "Bengali" #~ msgstr "Бенгальские цифры" #~ msgctxt "digit set" #~ msgid "Devanagari" #~ msgstr "Деванагари" #~ msgctxt "digit set" #~ msgid "Eastern Arabic-Indic" #~ msgstr "Персидские цифры" #~ msgctxt "digit set" #~ msgid "Gujarati" #~ msgstr "Цифры гуджарати" #~ msgctxt "digit set" #~ msgid "Gurmukhi" #~ msgstr "Цифры гурмукхи" #~ msgctxt "digit set" #~ msgid "Kannada" #~ msgstr "Цифры каннада" #~ msgctxt "digit set" #~ msgid "Khmer" #~ msgstr "Кхмерские цифры" #~ msgctxt "digit set" #~ msgid "Malayalam" #~ msgstr "Цифры малаялам" #~ msgctxt "digit set" #~ msgid "Oriya" #~ msgstr "Цифры ория" #~ msgctxt "digit set" #~ msgid "Tamil" #~ msgstr "Тамильские цифры" #~ msgctxt "digit set" #~ msgid "Telugu" #~ msgstr "Цифры телугу" #~ msgctxt "digit set" #~ msgid "Thai" #~ msgstr "Тайские цифры" #~ msgctxt "digit set" #~ msgid "Arabic" #~ msgstr "Арабские цифры" #~ msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" #~ msgid "%1 (%2)" #~ msgstr "%1 (%2)" #~ msgctxt "size in bytes" #~ msgid "%1 B" #~ msgstr "%1 Б" #~ msgctxt "size in 1000 bytes" #~ msgid "%1 kB" #~ msgstr "%1 КБ" #~ msgctxt "size in 10^6 bytes" #~ msgid "%1 MB" #~ msgstr "%1 МБ" #~ msgctxt "size in 10^9 bytes" #~ msgid "%1 GB" #~ msgstr "%1 ГБ" #~ msgctxt "size in 10^12 bytes" #~ msgid "%1 TB" #~ msgstr "%1 ТБ" #~ msgctxt "size in 10^15 bytes" #~ msgid "%1 PB" #~ msgstr "%1 ПБ" #~ msgctxt "size in 10^18 bytes" #~ msgid "%1 EB" #~ msgstr "%1 ЭБ" #~ msgctxt "size in 10^21 bytes" #~ msgid "%1 ZB" #~ msgstr "%1 ЗБ" #~ msgctxt "size in 10^24 bytes" #~ msgid "%1 YB" #~ msgstr "%1 ЙБ" #~ msgctxt "memory size in 1024 bytes" #~ msgid "%1 KB" #~ msgstr "%1 КБ" #~ msgctxt "memory size in 2^20 bytes" #~ msgid "%1 MB" #~ msgstr "%1 МБ" #~ msgctxt "memory size in 2^30 bytes" #~ msgid "%1 GB" #~ msgstr "%1 ГБ" #~ msgctxt "memory size in 2^40 bytes" #~ msgid "%1 TB" #~ msgstr "%1 ТБ" #~ msgctxt "memory size in 2^50 bytes" #~ msgid "%1 PB" #~ msgstr "%1 ПБ" #~ msgctxt "memory size in 2^60 bytes" #~ msgid "%1 EB" #~ msgstr "%1 ЭБ" #~ msgctxt "memory size in 2^70 bytes" #~ msgid "%1 ZB" #~ msgstr "%1 ЗБ" #~ msgctxt "memory size in 2^80 bytes" #~ msgid "%1 YB" #~ msgstr "%1 ЙБ" #~ msgctxt "size in 1024 bytes" #~ msgid "%1 KiB" #~ msgstr "%1 КиБ" #~ msgctxt "size in 2^20 bytes" #~ msgid "%1 MiB" #~ msgstr "%1 МиБ" #~ msgctxt "size in 2^30 bytes" #~ msgid "%1 GiB" #~ msgstr "%1 ГиБ" #~ msgctxt "size in 2^40 bytes" #~ msgid "%1 TiB" #~ msgstr "%1 ТиБ" #~ msgctxt "size in 2^50 bytes" #~ msgid "%1 PiB" #~ msgstr "%1 ПиБ" #~ msgctxt "size in 2^60 bytes" #~ msgid "%1 EiB" #~ msgstr "%1 ЭиБ" #~ msgctxt "size in 2^70 bytes" #~ msgid "%1 ZiB" #~ msgstr "%1 ЗиБ" #~ msgctxt "size in 2^80 bytes" #~ msgid "%1 YiB" #~ msgstr "%1 ЙиБ" #~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" #~ msgid "%1 days" #~ msgstr "%1 дня" #~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" #~ msgid "%1 hours" #~ msgstr "%1 часа" #~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" #~ msgid "%1 minutes" #~ msgstr "%1 минуты" #~ msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" #~ msgid "%1 seconds" #~ msgstr "%1 секунды" #~ msgctxt "@item:intext" #~ msgid "%1 millisecond" #~ msgid_plural "%1 milliseconds" #~ msgstr[0] "%1 миллисекунда" #~ msgstr[1] "%1 миллисекунды" #~ msgstr[2] "%1 миллисекунд" #~ msgstr[3] "%1 миллисекунда" #~ msgctxt "@item:intext" #~ msgid "1 day" #~ msgid_plural "%1 days" #~ msgstr[0] "%1 день" #~ msgstr[1] "%1 дня" #~ msgstr[2] "%1 дней" #~ msgstr[3] "%1 день" #~ msgctxt "@item:intext" #~ msgid "1 hour" #~ msgid_plural "%1 hours" #~ msgstr[0] "%1 час" #~ msgstr[1] "%1 часа" #~ msgstr[2] "%1 часов" #~ msgstr[3] "%1 час" #~ msgctxt "@item:intext" #~ msgid "1 minute" #~ msgid_plural "%1 minutes" #~ msgstr[0] "%1 минута" #~ msgstr[1] "%1 минуты" #~ msgstr[2] "%1 минут" #~ msgstr[3] "%1 минута" #~ msgctxt "@item:intext" #~ msgid "1 second" #~ msgid_plural "%1 seconds" #~ msgstr[0] "%1 секунда" #~ msgstr[1] "%1 секунды" #~ msgstr[2] "%1 секунд" #~ msgstr[3] "%1 секунда" #~ msgctxt "" #~ "@item:intext days and hours. This uses the previous item:intext messages. " #~ "If this does not fit the grammar of your language please contact the i18n " #~ "team to solve the problem" #~ msgid "%1 and %2" #~ msgstr "%1 %2" #~ msgctxt "" #~ "@item:intext hours and minutes. This uses the previous item:intext " #~ "messages. If this does not fit the grammar of your language please " #~ "contact the i18n team to solve the problem" #~ msgid "%1 and %2" #~ msgstr "%1 %2" #~ msgctxt "" #~ "@item:intext minutes and seconds. This uses the previous item:intext " #~ "messages. If this does not fit the grammar of your language please " #~ "contact the i18n team to solve the problem" #~ msgid "%1 and %2" #~ msgstr "%1 %2" #~ msgctxt "Before Noon KLocale::LongName" #~ msgid "Ante Meridiem" #~ msgstr "до полудня" #~ msgctxt "Before Noon KLocale::ShortName" #~ msgid "AM" #~ msgstr "AM" #~ msgctxt "Before Noon KLocale::NarrowName" #~ msgid "A" #~ msgstr "A" #~ msgctxt "After Noon KLocale::LongName" #~ msgid "Post Meridiem" #~ msgstr "после полудня" #~ msgctxt "After Noon KLocale::ShortName" #~ msgid "PM" #~ msgstr "PM" #~ msgctxt "After Noon KLocale::NarrowName" #~ msgid "P" #~ msgstr "P" #~ msgid "Today" #~ msgstr "Сегодня" #~ msgid "Yesterday" #~ msgstr "Вчера" #~ msgctxt "concatenation of dates and time" #~ msgid "%1 %2" #~ msgstr "%1 %2" #~ msgctxt "concatenation of date/time and time zone" #~ msgid "%1 %2" #~ msgstr "%1 %2" #~ msgctxt "@title/plain" #~ msgid "== %1 ==" #~ msgstr "== %1 ==" #~ msgctxt "@title/rich" #~ msgid "

    %1

    " #~ msgstr "

    %1

    " #~ msgctxt "@subtitle/plain" #~ msgid "~ %1 ~" #~ msgstr "~ %1 ~" #~ msgctxt "@subtitle/rich" #~ msgid "

    %1

    " #~ msgstr "

    %1

    " #~ msgctxt "@item/plain" #~ msgid " * %1" #~ msgstr " * %1" #~ msgctxt "@item/rich" #~ msgid "
  • %1
    • " #~ msgstr "
  • %1
    • " #~ msgctxt "@note/plain" #~ msgid "Note: %1" #~ msgstr "Примечание: %1" #~ msgctxt "@note/rich" #~ msgid "Note: %1" #~ msgstr "Примечание: %1" #~ msgctxt "" #~ "@note-with-label/plain\n" #~ "%1 is the note label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "" #~ "@note-with-label/rich\n" #~ "%1 is the note label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "@warning/plain" #~ msgid "WARNING: %1" #~ msgstr "Внимание: %1" #~ msgctxt "@warning/rich" #~ msgid "Warning: %1" #~ msgstr "Внимание: %1" #~ msgctxt "" #~ "@warning-with-label/plain\n" #~ "%1 is the warning label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "" #~ "@warning-with-label/rich\n" #~ "%1 is the warning label, %2 is the text" #~ msgid "%1: %2" #~ msgstr "%1: %2" #~ msgctxt "" #~ "@link-with-description/plain\n" #~ "%1 is the URL, %2 is the descriptive text" #~ msgid "%2 (%1)" #~ msgstr "%2 (%1)" #~ msgctxt "" #~ "@link-with-description/rich\n" #~ "%1 is the URL, %2 is the descriptive text" #~ msgid "%2" #~ msgstr "%2" #~ msgctxt "@filename/plain" #~ msgid "‘%1’" #~ msgstr "«%1»" #~ msgctxt "@filename/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@application/plain" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@application/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@command/plain" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@command/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "" #~ "@command-with-section/plain\n" #~ "%1 is the command name, %2 is its man section" #~ msgid "%1(%2)" #~ msgstr "%1(%2)" #~ msgctxt "" #~ "@command-with-section/rich\n" #~ "%1 is the command name, %2 is its man section" #~ msgid "%1(%2)" #~ msgstr "%1(%2)" #~ msgctxt "@resource/plain" #~ msgid "“%1”" #~ msgstr "«%1»" #~ msgctxt "@resource/rich" #~ msgid "“%1”" #~ msgstr "«%1»" #~ msgctxt "@icode/plain" #~ msgid "“%1”" #~ msgstr "«%1»" #~ msgctxt "@icode/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@shortcut/plain" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@shortcut/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@interface/plain" #~ msgid "|%1|" #~ msgstr "|%1|" #~ msgctxt "@interface/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@emphasis/plain" #~ msgid "*%1*" #~ msgstr "*%1*" #~ msgctxt "@emphasis/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@emphasis-strong/plain" #~ msgid "**%1**" #~ msgstr "**%1**" #~ msgctxt "@emphasis-strong/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@placeholder/plain" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "@placeholder/rich" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "@email/plain" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "@email/rich" #~ msgid "<%1>" #~ msgstr "<%1>" #~ msgctxt "" #~ "@email-with-name/plain\n" #~ "%1 is name, %2 is address" #~ msgid "%1 <%2>" #~ msgstr "%1 <%2>" #~ msgctxt "" #~ "@email-with-name/rich\n" #~ "%1 is name, %2 is address" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@envar/plain" #~ msgid "$%1" #~ msgstr "$%1" #~ msgctxt "@envar/rich" #~ msgid "$%1" #~ msgstr "$%1" #~ msgctxt "@message/plain" #~ msgid "/%1/" #~ msgstr "/%1/" #~ msgctxt "@message/rich" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "shortcut-key-delimiter/plain" #~ msgid "+" #~ msgstr "+" #~ msgctxt "shortcut-key-delimiter/rich" #~ msgid "+" #~ msgstr "+" #~ msgctxt "gui-path-delimiter/plain" #~ msgid "→" #~ msgstr "➤" #~ msgctxt "gui-path-delimiter/rich" #~ msgid "→" #~ msgstr "➤" #~ msgctxt "keyboard-key-name" #~ msgid "Alt" #~ msgstr "Alt" #~ msgctxt "keyboard-key-name" #~ msgid "AltGr" #~ msgstr "AltGr" #~ msgctxt "keyboard-key-name" #~ msgid "Backspace" #~ msgstr "Backspace" #~ msgctxt "keyboard-key-name" #~ msgid "CapsLock" #~ msgstr "CapsLock" #~ msgctxt "keyboard-key-name" #~ msgid "Control" #~ msgstr "Control" #~ msgctxt "keyboard-key-name" #~ msgid "Ctrl" #~ msgstr "Ctrl" #~ msgctxt "keyboard-key-name" #~ msgid "Del" #~ msgstr "Del" #~ msgctxt "keyboard-key-name" #~ msgid "Delete" #~ msgstr "Delete" #~ msgctxt "keyboard-key-name" #~ msgid "Down" #~ msgstr "Стрелка вниз" #~ msgctxt "keyboard-key-name" #~ msgid "End" #~ msgstr "End" #~ msgctxt "keyboard-key-name" #~ msgid "Enter" #~ msgstr "Enter" #~ msgctxt "keyboard-key-name" #~ msgid "Esc" #~ msgstr "Esc" #~ msgctxt "keyboard-key-name" #~ msgid "Escape" #~ msgstr "Escape" #~ msgctxt "keyboard-key-name" #~ msgid "Home" #~ msgstr "Home" #~ msgctxt "keyboard-key-name" #~ msgid "Hyper" #~ msgstr "Hyper" #~ msgctxt "keyboard-key-name" #~ msgid "Ins" #~ msgstr "Ins" #~ msgctxt "keyboard-key-name" #~ msgid "Insert" #~ msgstr "Insert" #~ msgctxt "keyboard-key-name" #~ msgid "Left" #~ msgstr "Стрелка влево" #~ msgctxt "keyboard-key-name" #~ msgid "Menu" #~ msgstr "Menu" #~ msgctxt "keyboard-key-name" #~ msgid "Meta" #~ msgstr "Meta" #~ msgctxt "keyboard-key-name" #~ msgid "NumLock" #~ msgstr "NumLock" #~ msgctxt "keyboard-key-name" #~ msgid "PageDown" #~ msgstr "PageDown" #~ msgctxt "keyboard-key-name" #~ msgid "PageUp" #~ msgstr "PageUp" #~ msgctxt "keyboard-key-name" #~ msgid "PgDown" #~ msgstr "PgDown" #~ msgctxt "keyboard-key-name" #~ msgid "PgUp" #~ msgstr "PgUp" #~ msgctxt "keyboard-key-name" #~ msgid "PauseBreak" #~ msgstr "PauseBreak" #~ msgctxt "keyboard-key-name" #~ msgid "PrintScreen" #~ msgstr "PrintScreen" #~ msgctxt "keyboard-key-name" #~ msgid "PrtScr" #~ msgstr "PrtScr" #~ msgctxt "keyboard-key-name" #~ msgid "Return" #~ msgstr "Return" #~ msgctxt "keyboard-key-name" #~ msgid "Right" #~ msgstr "Стрелка вправо" #~ msgctxt "keyboard-key-name" #~ msgid "ScrollLock" #~ msgstr "ScrollLock" #~ msgctxt "keyboard-key-name" #~ msgid "Shift" #~ msgstr "Shift" #~ msgctxt "keyboard-key-name" #~ msgid "Space" #~ msgstr "Пробел" #~ msgctxt "keyboard-key-name" #~ msgid "Super" #~ msgstr "Super" #~ msgctxt "keyboard-key-name" #~ msgid "SysReq" #~ msgstr "SysReq" #~ msgctxt "keyboard-key-name" #~ msgid "Tab" #~ msgstr "Tab" #~ msgctxt "keyboard-key-name" #~ msgid "Up" #~ msgstr "Стрелка вверх" #~ msgctxt "keyboard-key-name" #~ msgid "Win" #~ msgstr "Win" #~ msgctxt "keyboard-key-name" #~ msgid "F%1" #~ msgstr "F%1" #~ msgid "no error" #~ msgstr "нет ошибки" #~ msgid "requested family not supported for this host name" #~ msgstr "Для указанного имени сервера требуемое семейство не поддерживается" #~ msgid "temporary failure in name resolution" #~ msgstr "временный сбой разрешения имён" #~ msgid "non-recoverable failure in name resolution" #~ msgstr "фатальный сбой разрешения имён" #~ msgid "invalid flags" #~ msgstr "неверные флаги" #~ msgid "memory allocation failure" #~ msgstr "ошибка выделения памяти" #~ msgid "name or service not known" #~ msgstr "неизвестное имя или сервис" #~ msgid "requested family not supported" #~ msgstr "запрошенное семейство не поддерживается" #~ msgid "requested service not supported for this socket type" #~ msgstr "запрошенный сервис не поддерживается этим типом сокета" #~ msgid "requested socket type not supported" #~ msgstr "запрошенный тип сокета не поддерживается" #~ msgid "unknown error" #~ msgstr "неизвестная ошибка" #~ msgctxt "1: the i18n'ed system error code, from errno" #~ msgid "system error: %1" #~ msgstr "системная ошибка: %1" #~ msgid "request was canceled" #~ msgstr "запрос отменён" #~ msgctxt "1: the unknown socket address family number" #~ msgid "Unknown family %1" #~ msgstr "Неизвестная гарнитура %1" #~ msgctxt "Socket error code NoError" #~ msgid "no error" #~ msgstr "нет ошибки" #~ msgctxt "Socket error code LookupFailure" #~ msgid "name lookup has failed" #~ msgstr "ошибка разрешения имени" #~ msgctxt "Socket error code AddressInUse" #~ msgid "address already in use" #~ msgstr "адрес уже используется" #~ msgctxt "Socket error code AlreadyBound" #~ msgid "socket is already bound" #~ msgstr "сокет уже связан с адресом и портом" #~ msgctxt "Socket error code AlreadyCreated" #~ msgid "socket is already created" #~ msgstr "сокет уже создан" #~ msgctxt "Socket error code NotBound" #~ msgid "socket is not bound" #~ msgstr "сокет свободен" #~ msgctxt "Socket error code NotCreated" #~ msgid "socket has not been created" #~ msgstr "сокет не создан" #~ msgctxt "Socket error code WouldBlock" #~ msgid "operation would block" #~ msgstr "операция привела бы к блокировке" #~ msgctxt "Socket error code ConnectionRefused" #~ msgid "connection actively refused" #~ msgstr "соединение отвергнуто" #~ msgctxt "Socket error code ConnectionTimedOut" #~ msgid "connection timed out" #~ msgstr "время ожидания соединения истекло" #~ msgctxt "Socket error code InProgress" #~ msgid "operation is already in progress" #~ msgstr "операция уже выполняется" #~ msgctxt "Socket error code NetFailure" #~ msgid "network failure occurred" #~ msgstr "сбой сети" #~ msgctxt "Socket error code NotSupported" #~ msgid "operation is not supported" #~ msgstr "операция не поддерживается" #~ msgctxt "Socket error code Timeout" #~ msgid "timed operation timed out" #~ msgstr "истекло время ожидания операции" #~ msgctxt "Socket error code UnknownError" #~ msgid "an unknown/unexpected error has happened" #~ msgstr "неизвестная или непредвиденная ошибка" #~ msgctxt "Socket error code RemotelyDisconnected" #~ msgid "remote host closed connection" #~ msgstr "Удалённый узел закрыл соединение" #~ msgid "NEC SOCKS client" #~ msgstr "Клиент NEC SOCKS" #~ msgid "Dante SOCKS client" #~ msgstr "Клиент Dante SOCKS" #~ msgid "Specified socket path is invalid" #~ msgstr "Указан неверный путь к сокету" #~ msgid "The socket operation is not supported" #~ msgstr "Операция с сокетом не поддерживается" #~ msgid "Connection refused" #~ msgstr "Соединение отвергнуто" #~ msgid "Permission denied" #~ msgstr "Нет доступа" #~ msgid "Unknown error" #~ msgstr "Неизвестная ошибка" #~ msgid "Could not set non-blocking mode" #~ msgstr "Не удалось установить неблокирующий режим" #~ msgid "Address is already in use" #~ msgstr "Адрес уже используется" #~ msgid "Path cannot be used" #~ msgstr "Невозможно использовать путь" #~ msgid "No such file or directory" #~ msgstr "Файл или папка не найдены" #~ msgid "Not a directory" #~ msgstr "Не папка" #~ msgid "Read-only filesystem" #~ msgstr "Файловая система доступна только для чтения" #~ msgid "Unknown socket error" #~ msgstr "Неизвестная ошибка сокета" #~ msgid "Operation not supported" #~ msgstr "Операция не поддерживается" #~ msgid "Timed out trying to connect to remote host" #~ msgstr "Истекло время ожидания ответа от удалённого узла" #~ msgctxt "SSL error" #~ msgid "No error" #~ msgstr "Нет ошибки" #~ msgctxt "SSL error" #~ msgid "The certificate authority's certificate is invalid" #~ msgstr "Неверный сертификат у удостоверяющего центра." #~ msgctxt "SSL error" #~ msgid "The certificate has expired" #~ msgstr "Срок действия сертификата истёк." #~ msgctxt "SSL error" #~ msgid "The certificate is invalid" #~ msgstr "Сертификат недействителен" #~ msgctxt "SSL error" #~ msgid "The certificate is not signed by any trusted certificate authority" #~ msgstr "" #~ "Сертификат не подписан ни одним из доверенных удостоверяющих центров" #~ msgctxt "SSL error" #~ msgid "The certificate has been revoked" #~ msgstr "Сертификат был отозван" #~ msgctxt "SSL error" #~ msgid "The certificate is unsuitable for this purpose" #~ msgstr "Сертификат не подходит для выбранной области применения" #~ msgctxt "SSL error" #~ msgid "" #~ "The root certificate authority's certificate is not trusted for this " #~ "purpose" #~ msgstr "" #~ "Сертификат корневого удостоверяющего центра не может быть доверенным для " #~ "этого применения" #~ msgctxt "SSL error" #~ msgid "" #~ "The certificate authority's certificate is marked to reject this " #~ "certificate's purpose" #~ msgstr "" #~ "Сертификат корневого удостоверяющего центра недействителен для этого " #~ "применения" #~ msgctxt "SSL error" #~ msgid "The peer did not present any certificate" #~ msgstr "Подключение без сертификата" #~ msgctxt "SSL error" #~ msgid "The certificate does not apply to the given host" #~ msgstr "Сертификат не применим к этому узлу" #~ msgctxt "SSL error" #~ msgid "The certificate cannot be verified for internal reasons" #~ msgstr "Сертификат не может быть проверен по внутренним причинам" #~ msgctxt "SSL error" #~ msgid "The certificate chain is too long" #~ msgstr "Цепочка сертификатов слишком длинная" #~ msgctxt "SSL error" #~ msgid "Unknown error" #~ msgstr "Неизвестная ошибка" #~ msgid "address family for nodename not supported" #~ msgstr "семейство адресов для не поддерживается для данного nodename" #~ msgid "invalid value for 'ai_flags'" #~ msgstr "неверное значение для «ai_flags»" #~ msgid "'ai_family' not supported" #~ msgstr "семейство «ai_family» не поддерживается" #~ msgid "no address associated with nodename" #~ msgstr "с данным узлом (nodename) не связан никакой адрес" #~ msgid "servname not supported for ai_socktype" #~ msgstr "servname не поддерживается для типа ai_socktype" #~ msgid "'ai_socktype' not supported" #~ msgstr "тип «ai_socktype» не поддерживается" #~ msgid "system error" #~ msgstr "системная ошибка" #~ msgid "Could not find mime type %2" #~ msgid_plural "" #~ "Could not find mime types:\n" #~ "%2" #~ msgstr[0] "Не удалось найти типы MIME %2" #~ msgstr[1] "Не удалось найти типы MIME %2" #~ msgstr[2] "Не удалось найти типы MIME %2" #~ msgstr[3] "Не удалось найти тип MIME %2" #~ msgid "" #~ "No mime types installed. Check that shared-mime-info is installed, and " #~ "that XDG_DATA_DIRS is not set, or includes /usr/share." #~ msgstr "" #~ "Не установлены типы MIME. Проверьте установку пакета shared-mime-info и " #~ "состояние переменной окружения XDG_DATA_DIRS. Она должна быть либо не " #~ "установлена, либо должна включать /usr/share." #~ msgid "No service matching the requirements was found" #~ msgstr "Служба, соответствующая требованиям, не найдена" # BUGME: ". " at the end is necessary, otherwise the next sentence goes without space or full stop. --aspotashev #~ msgid "" #~ "The service '%1' does not provide an interface '%2' with keyword '%3'" #~ msgstr "" #~ "Служба «%1» не предоставляет интерфейс «%2» с ключевыми словами «%3». " #~ msgctxt "dictionary variant" #~ msgid "40" #~ msgstr "40" #~ msgctxt "dictionary variant" #~ msgid "60" #~ msgstr "60" #~ msgctxt "dictionary variant" #~ msgid "80" #~ msgstr "80" #~ msgctxt "dictionary variant" #~ msgid "-ise suffixes" #~ msgstr "суффиксы -ise" #~ msgctxt "dictionary variant" #~ msgid "-ize suffixes" #~ msgstr "суффиксы -ize" #~ msgctxt "dictionary variant" #~ msgid "-ise suffixes and with accents" #~ msgstr "суффиксы -ise и буквы с акцентом" #~ msgctxt "dictionary variant" #~ msgid "-ise suffixes and without accents" #~ msgstr "суффиксы -ise и буквы без акцента" #~ msgctxt "dictionary variant" #~ msgid "-ize suffixes and with accents" #~ msgstr "суффиксы -ize и буквы с акцентом" #~ msgctxt "dictionary variant" #~ msgid "-ize suffixes and without accents" #~ msgstr "суффиксы -ize и буквы без акцента" #~ msgctxt "dictionary variant" #~ msgid "large" #~ msgstr "большой" #~ msgctxt "dictionary variant" #~ msgid "medium" #~ msgstr "средний" #~ msgctxt "dictionary variant" #~ msgid "small" #~ msgstr "малый" #~ msgctxt "dictionary variant" #~ msgid "variant 0" #~ msgstr "вариант 0" #~ msgctxt "dictionary variant" #~ msgid "variant 1" #~ msgstr "вариант 1" #~ msgctxt "dictionary variant" #~ msgid "variant 2" #~ msgstr "вариант 2" #~ msgctxt "dictionary variant" #~ msgid "without accents" #~ msgstr "буквы без акцента" #~ msgctxt "dictionary variant" #~ msgid "with accents" #~ msgstr "буквы с акцентом" #~ msgctxt "dictionary variant" #~ msgid "with ye" #~ msgstr "только с вариантами написания через «е»" #~ msgctxt "dictionary variant" #~ msgid "with yeyo" #~ msgstr "с вариантами написания через «е» и «ё»" #~ msgctxt "dictionary variant" #~ msgid "with yo" #~ msgstr "только с вариантами написания через «ё»" #~ msgctxt "dictionary variant" #~ msgid "extended" #~ msgstr "расширенный" #~ msgctxt "dictionary name. %1-language, %2-country and %3 variant name" #~ msgid "%1 (%2) [%3]" #~ msgstr "%1 (%2) [%3]" #~ msgctxt "dictionary name. %1-language and %2-country name" #~ msgid "%1 (%2)" #~ msgstr "%1 (%2)" #~ msgctxt "dictionary name. %1-language and %2-variant name" #~ msgid "%1 [%2]" #~ msgstr "%1 [%2]" #~ msgid "File %1 does not exist" #~ msgstr "Файл %1 не существует" #~ msgid "Cannot open %1 for reading" #~ msgstr "Не удалось открыть %1 для чтения" #~ msgid "Cannot create memory segment for file %1" #~ msgstr "Не удалось выделить область памяти для файла %1" #~ msgid "Could not read data from %1 into shm" #~ msgstr "Не удалось прочитать данные из %1 в shm" #~ msgid "Only 'ReadOnly' allowed" #~ msgstr "Допускается только для чтения (ReadOnly)" #~ msgid "Cannot seek past eof" #~ msgstr "Сдвиг после конца файла невозможен" #~ msgid "Library \"%1\" not found" #~ msgstr "Библиотека «%1» не найдена" #~ msgid "No service matching the requirements was found." #~ msgstr "Нет службы, соответствующей требованиям." #~ msgid "" #~ "The service provides no library, the Library key is missing in the ." #~ "desktop file." #~ msgstr "" #~ "Служба не предоставляет библиотеку, нет записи «Library» в файле .desktop." #~ msgid "The library does not export a factory for creating components." #~ msgstr "Библиотека не предоставляет механизм создания компонентов." #~ msgid "" #~ "The factory does not support creating components of the specified type." #~ msgstr "Фабрика не поддерживает создание компонентов указанного типа." #~ msgid "KLibLoader: Unknown error" #~ msgstr "Неизвестная ошибка KLibLoader" #~ msgid "Could not find plugin '%1' for application '%2'" #~ msgstr "Не удалось найти модуль «%1» для приложения «%2»." #~ msgid "The provided service is not valid" #~ msgstr "Указана недопустимая служба" #~ msgid "The service '%1' provides no library or the Library key is missing" #~ msgstr "Служба «%1» не предоставляет библиотеку или нет записи «Library»" #~ msgid "The library %1 does not offer a KDE 4 compatible factory." #~ msgstr "" #~ "Библиотека %1 не предоставляет механизм создания компонентов, совместимый " #~ "с KDE 4." #~ msgid "The plugin '%1' uses an incompatible KDE library (%2)." #~ msgstr "Расширение «%1» использует несовместимую библиотеку KDE (%2)." #~ msgid "KDE Test Program" #~ msgstr "Тестовая программа KDE" #~ msgid "KBuildSycoca" #~ msgstr "KBuildSycoca" #~ msgid "Rebuilds the system configuration cache." #~ msgstr "Повторное создание кэша системной конфигурации." #~ msgid "(c) 1999-2002 KDE Developers" #~ msgstr "© Разработчики KDE, 1999-2002" #~ msgid "David Faure" #~ msgstr "David Faure" #~ msgid "Do not signal applications to update" #~ msgstr "Не посылать сигнал приложениям для обновления" #~ msgid "Disable incremental update, re-read everything" #~ msgstr "Отключить инкрементное обновление, перечитать все" #~ msgid "Check file timestamps" #~ msgstr "Проверять время изменения файлов" #~ msgid "Disable checking files (dangerous)" #~ msgstr "Отключить проверку файлов (опасно)" #~ msgid "Create global database" #~ msgstr "Создать глобальную базу" #~ msgid "Perform menu generation test run only" #~ msgstr "Выполнить только тест генерации меню" #~ msgid "Track menu id for debug purposes" #~ msgstr "Отслеживать идентификатор меню для отладки" #~ msgid "KDE Daemon" #~ msgstr "Служба KDE" #~ msgid "KDE Daemon - triggers Sycoca database updates when needed" #~ msgstr "" #~ "Служба KDE - запускает обновление базы данных Sycoca по необходимости" #~ msgid "Check Sycoca database only once" #~ msgstr "Проверять базу данных Sycoca только один раз" #~ msgctxt "Encodings menu" #~ msgid "Default" #~ msgstr "По умолчанию" #~ msgctxt "Encodings menu" #~ msgid "Autodetect" #~ msgstr "Автоматическое определение" #~ msgid "No Entries" #~ msgstr "Нет записей" #~ msgid "Clear List" #~ msgstr "Очистить список" #~ msgctxt "go back" #~ msgid "&Back" #~ msgstr "&Назад" #~ msgctxt "go forward" #~ msgid "&Forward" #~ msgstr "&Вперёд" #~ msgctxt "home page" #~ msgid "&Home" #~ msgstr "&Домой" #~ msgctxt "show help" #~ msgid "&Help" #~ msgstr "&Справка" #~ msgid "Show &Menubar" #~ msgstr "Показать &меню" #~ msgid "Show Menubar

    Shows the menubar again after it has been hidden

    " #~ msgstr "" #~ "Показать меню

    Показать меню снова после того, как оно было скрыто

    " #~ msgid "Show St&atusbar" #~ msgstr "Показать строку &состояния" # BUGME: whatsthis on "Hide Statusbar" should be about "Hide Statusbar", not "Show Statusbar" #~ msgid "" #~ "Show Statusbar

    Shows the statusbar, which is the bar at the bottom of " #~ "the window used for status information.

    " #~ msgstr "" #~ "Показать строку состояния

    Строка состояния — это полоса в нижней части " #~ "окна, в которой выводится информация о состоянии приложения.

    " #~ msgid "&New" #~ msgstr "Созд&ать" #~ msgid "Create new document" #~ msgstr "Создать новый документ" #~ msgid "&Open..." #~ msgstr "&Открыть..." #~ msgid "Open an existing document" #~ msgstr "Открыть существующий документ" #~ msgid "Open &Recent" #~ msgstr "По&следние файлы" #~ msgid "Open a document which was recently opened" #~ msgstr "Открыть документ, который уже был недавно открыт" #~ msgid "&Save" #~ msgstr "&Сохранить" #~ msgid "Save document" #~ msgstr "Сохранить документ" #~ msgid "Save &As..." #~ msgstr "Сохранить &как..." #~ msgid "Save document under a new name" #~ msgstr "Сохранить документ под новым именем" #~ msgid "Re&vert" #~ msgstr "&Восстановить" #~ msgid "Revert unsaved changes made to document" #~ msgstr "Восстановить несохранённые изменения, внесённые в документ" #~ msgid "&Close" #~ msgstr "&Закрыть" #~ msgid "Close document" #~ msgstr "Закрыть документ" #~ msgid "&Print..." #~ msgstr "Пе&чать..." #~ msgid "Print document" #~ msgstr "Печать документа" #~ msgid "Print Previe&w" #~ msgstr "Пред&варительный просмотр" #~ msgid "Show a print preview of document" #~ msgstr "Показать предварительный просмотр документа" #~ msgid "&Mail..." #~ msgstr "Отправить по &почте..." #~ msgid "Send document by mail" #~ msgstr "Отправить документ по электронной почте" #~ msgid "&Quit" #~ msgstr "В&ыход" #~ msgid "Quit application" #~ msgstr "Выйти из приложения" #~ msgid "Undo last action" #~ msgstr "Отменить последнее действие" #~ msgid "Re&do" #~ msgstr "&Повторить" #~ msgid "Redo last undone action" #~ msgstr "Повторить последнее отменённое действие" #~ msgid "Cu&t" #~ msgstr "Вы&резать" #~ msgid "Cut selection to clipboard" #~ msgstr "Вырезать выбранное в буфер обмена" #~ msgid "&Copy" #~ msgstr "&Копировать" #~ msgid "Copy selection to clipboard" #~ msgstr "Скопировать выбранное в буфер обмена" #~ msgid "&Paste" #~ msgstr "&Вставить" #~ msgid "Paste clipboard content" #~ msgstr "Вставить содержимое буфера обмена" #~ msgid "C&lear" #~ msgstr "О&чистить" #~ msgid "Select &All" #~ msgstr "Вы&делить все" #~ msgid "Dese&lect" #~ msgstr "С&нять выделение" #~ msgid "&Find..." #~ msgstr "&Найти..." #~ msgid "Find &Next" #~ msgstr "П&родолжить поиск" #~ msgid "Find Pre&vious" #~ msgstr "Найти пред&ыдущее" #~ msgid "&Replace..." #~ msgstr "&Заменить..." #~ msgid "&Actual Size" #~ msgstr "&Фактический размер" #~ msgid "View document at its actual size" #~ msgstr "Просмотр документа в его фактическом размере" #~ msgid "&Fit to Page" #~ msgstr "&Вместить страницу целиком" #~ msgid "Zoom to fit page in window" #~ msgstr "Изменить масштаб, чтобы вместить страницу целиком в окно" #~ msgid "Fit to Page &Width" #~ msgstr "По &ширине страницы" #~ msgid "Zoom to fit page width in window" #~ msgstr "Изменить масштаб, чтобы вместить всю ширину страницы" #~ msgid "Fit to Page &Height" #~ msgstr "По &высоте страницы" #~ msgid "Zoom to fit page height in window" #~ msgstr "Изменить масштаб, чтобы вместить всю высоту страницы" #~ msgid "Zoom &In" #~ msgstr "У&величить" #~ msgid "Zoom &Out" #~ msgstr "У&меньшить" #~ msgid "&Zoom..." #~ msgstr "&Масштаб..." #~ msgid "Select zoom level" #~ msgstr "Выбор масштаба" #~ msgid "&Redisplay" #~ msgstr "Обно&вить изображение" #~ msgid "Redisplay document" #~ msgstr "Обновить документ" #~ msgid "&Up" #~ msgstr "Ввер&х" #~ msgid "Go up" #~ msgstr "Перейти вверх" #~ msgid "&Previous Page" #~ msgstr "&Предыдущая страница" #~ msgid "Go to previous page" #~ msgstr "Перейти на предыдущую страницу" #~ msgid "&Next Page" #~ msgstr "&Следующая страница" #~ msgid "Go to next page" #~ msgstr "Перейти на следующую страницу" #~ msgid "&Go To..." #~ msgstr "&Перейти..." #~ msgid "&Go to Page..." #~ msgstr "Перейти на ст&раницу..." #~ msgid "&Go to Line..." #~ msgstr "&Перейти на строку..." #~ msgid "&First Page" #~ msgstr "Перв&ая страница" #~ msgid "Go to first page" #~ msgstr "Перейти на первую страницу" #~ msgid "&Last Page" #~ msgstr "Последня&я страница" #~ msgid "Go to last page" #~ msgstr "Перейти на последнюю страницу" #~ msgid "Go back in document" #~ msgstr "Назад по документу" #~ msgid "&Forward" #~ msgstr "&Вперёд" #~ msgid "Go forward in document" #~ msgstr "Вперёд по документу" #~ msgid "&Add Bookmark" #~ msgstr "Добавить &закладку" #~ msgid "&Edit Bookmarks..." #~ msgstr "&Изменить закладки..." #~ msgid "&Spelling..." #~ msgstr "&Проверка орфографии..." #~ msgid "Check spelling in document" #~ msgstr "Проверить орфографию в документе" #~ msgid "Show or hide menubar" #~ msgstr "Показать или скрыть меню" #~ msgid "Show &Toolbar" #~ msgstr "Показать панель &инструментов" #~ msgid "Show or hide toolbar" #~ msgstr "Показать или скрыть панель инструментов" #~ msgid "Show or hide statusbar" #~ msgstr "Показать или скрыть строку состояния" #~ msgid "F&ull Screen Mode" #~ msgstr "&Полноэкранный режим" #~ msgid "&Save Settings" #~ msgstr "&Сохранить параметры" #~ msgid "Configure S&hortcuts..." #~ msgstr "&Комбинации клавиш..." #~ msgid "&Configure %1..." #~ msgstr "&Настроить %1..." #~ msgid "Configure Tool&bars..." #~ msgstr "Панели &инструментов..." #~ msgid "Configure &Notifications..." #~ msgstr "Настроить &уведомления..." #~ msgid "%1 &Handbook" #~ msgstr "&Руководство пользователя %1" #~ msgid "What's &This?" #~ msgstr "Что &это?" #~ msgid "Tip of the &Day" #~ msgstr "Совет &дня" #~ msgid "&Report Bug..." #~ msgstr "Сооб&щить об ошибке..." #~ msgid "Switch Application &Language..." #~ msgstr "Сменить &язык интерфейса приложения..." #~ msgid "&About %1" #~ msgstr "&О программе %1" #~ msgid "About &KDE" #~ msgstr "О &KDE" #~ msgctxt "@action:inmenu" #~ msgid "Exit F&ull Screen Mode" #~ msgstr "&Выйти из полноэкранного режима" #~ msgctxt "@action:intoolbar" #~ msgid "Exit Full Screen" #~ msgstr "Выйти из полноэкранного режима" #~ msgctxt "@info:tooltip" #~ msgid "Exit full screen mode" #~ msgstr "Выйти из полноэкранного режима" #~ msgctxt "@action:inmenu" #~ msgid "F&ull Screen Mode" #~ msgstr "&Полноэкранный режим" #~ msgctxt "@action:intoolbar" #~ msgid "Full Screen" #~ msgstr "Полноэкранный режим" #~ msgctxt "@info:tooltip" #~ msgid "Display the window in full screen" #~ msgstr "Разворачивает окно на полный экран" #~ msgctxt "Custom color" #~ msgid "Custom..." #~ msgstr "Указать собственный..." #~ msgctxt "palette name" #~ msgid "* Recent Colors *" #~ msgstr "* Последние цвета *" #~ msgctxt "palette name" #~ msgid "* Custom Colors *" #~ msgstr "* Собственные цвета *" #~ msgctxt "palette name" #~ msgid "Forty Colors" #~ msgstr "Сорок основных цветов" #~ msgctxt "palette name" #~ msgid "Oxygen Colors" #~ msgstr "Цвета Oxygen" #~ msgctxt "palette name" #~ msgid "Rainbow Colors" #~ msgstr "Радужные цвета" #~ msgctxt "palette name" #~ msgid "Royal Colors" #~ msgstr "Королевские цвета" #~ msgctxt "palette name" #~ msgid "Web Colors" #~ msgstr "Цвета веб" #~ msgid "Named Colors" #~ msgstr "Именованные цвета" #~ msgctxt "" #~ "%1 is the number of paths, %2 is the list of paths (with newlines between " #~ "them)" #~ msgid "" #~ "Unable to read X11 RGB color strings. The following file location was " #~ "examined:\n" #~ "%2" #~ msgid_plural "" #~ "Unable to read X11 RGB color strings. The following file locations were " #~ "examined:\n" #~ "%2" #~ msgstr[0] "" #~ "Не удалось получить определения цветов X11 ни из одного из следующих " #~ "расположений:\n" #~ "%2" #~ msgstr[1] "" #~ "Не удалось получить определения цветов X11 ни из одного из следующих " #~ "расположений:\n" #~ "%2" #~ msgstr[2] "" #~ "Не удалось получить определения цветов X11 ни из одного из следующих " #~ "расположений:\n" #~ "%2" #~ msgstr[3] "" #~ "Не удалось получить определения цветов X11 из следующего расположения:\n" #~ "%2" #~ msgid "Select Color" #~ msgstr "Выбор цвета" #~ msgid "Hue:" #~ msgstr "Оттенок:" #~ msgctxt "The angular degree unit (for hue)" #~ msgid "°" #~ msgstr "°" #~ msgid "Saturation:" #~ msgstr "Насыщенность:" #~ msgctxt "This is the V of HSV" #~ msgid "Value:" #~ msgstr "Яркость:" #~ msgid "Red:" #~ msgstr "Красный:" #~ msgid "Green:" #~ msgstr "Зелёный:" #~ msgid "Blue:" #~ msgstr "Синий:" #~ msgid "Alpha:" #~ msgstr "Альфа-канал:" #~ msgid "&Add to Custom Colors" #~ msgstr "&Добавить в собственные цвета" #~ msgid "Name:" #~ msgstr "Название:" #~ msgid "HTML:" #~ msgstr "HTML:" #~ msgid "Default color" #~ msgstr "Цвет по умолчанию" #~ msgid "-default-" #~ msgstr "-по умолчанию-" #~ msgid "-unnamed-" #~ msgstr "-безымянный-" #~ msgid "" #~ "No information available.
    The supplied KAboutData object does " #~ "not exist.    " #~ msgstr "" #~ "К сожалению, информация отсутствует.
    Программа не предоставила " #~ "объект KAboutData.    " #~ msgctxt "" #~ "Program name, version and KDE platform version; do not translate " #~ "'Development Platform'" #~ msgid "" #~ "%1
    Version %2
    Using KDE " #~ "Development Platform %3" #~ msgstr "" #~ "%1
    Версия %2
    Использует " #~ "KDE %3" #~ msgctxt "Opposite to Back" #~ msgid "Next" #~ msgstr "Далее" #~ msgid "Finish" #~ msgstr "Готово" #~ msgid "Configure" #~ msgstr "Настройка" #~ msgid "Job" #~ msgstr "Задание" #~ msgid "Job Control" #~ msgstr "Управление заданиями" #~ msgid "Scheduled printing:" #~ msgstr "Отложенная печать:" #~ msgid "Billing information:" #~ msgstr "Стоимость печати:" #~ msgid "Job priority:" #~ msgstr "Приоритет:" #~ msgid "Job Options" #~ msgstr "Параметры задания" #~ msgid "Option" #~ msgstr "Параметр" #~ msgid "Value" #~ msgstr "Значение" #~ msgid "Print Immediately" #~ msgstr "Печатать немедленно" #~ msgid "Hold Indefinitely" #~ msgstr "Удерживать до следующих распоряжений" #~ msgid "Day (06:00 to 17:59)" #~ msgstr "Днём (06:00 — 17:59)" #~ msgid "Night (18:00 to 05:59)" #~ msgstr "Ночью (18:00 — 05:59)" #~ msgid "Second Shift (16:00 to 23:59)" #~ msgstr "Во вторую смену (16:00 - 23:59)" #~ msgid "Third Shift (00:00 to 07:59)" #~ msgstr "В третью смену (00:00 - 07:59)" #~ msgid "Weekend (Saturday to Sunday)" #~ msgstr "В выходные (суббота, воскресенье)" #~ msgid "Specific Time" #~ msgstr "В указанное время" #~ msgid "Pages" #~ msgstr "Страницы" #~ msgid "Pages Per Sheet" #~ msgstr "Страниц на лист" #~ msgid "1" #~ msgstr "1" #~ msgid "6" #~ msgstr "6" #~ msgid "2" #~ msgstr "2" #~ msgid "9" #~ msgstr "9" #~ msgid "4" #~ msgstr "4" #~ msgid "16" #~ msgstr "16" #~ msgid "Banner Pages" #~ msgstr "Печатать страницы-разделители" #~ msgctxt "Banner page at start" #~ msgid "Start" #~ msgstr "В начале" #~ msgctxt "Banner page at end" #~ msgid "End" #~ msgstr "В конце" #~ msgid "Page Label" #~ msgstr "Название страницы" #~ msgid "Page Border" #~ msgstr "Рамка" #~ msgid "Mirror Pages" #~ msgstr "Зеркальное отражение" #~ msgid "Mirror pages along vertical axis" #~ msgstr "Зеркально отражать по вертикали" #~ msgid "Left to Right, Top to Bottom" #~ msgstr "Слева направо, сверху вниз" #~ msgid "Left to Right, Bottom to Top" #~ msgstr "Слева направо, снизу вверх" #~ msgid "Right to Left, Bottom to Top" #~ msgstr "Справа налево, снизу вверх" #~ msgid "Right to Left, Top to Bottom" #~ msgstr "Справа налево, сверху вниз" #~ msgid "Bottom to Top, Left to Right" #~ msgstr "Снизу вверх, слева направо" #~ msgid "Bottom to Top, Right to Left" #~ msgstr "Снизу вверх, справа налево" #~ msgid "Top to Bottom, Left to Right" #~ msgstr "Сверху вниз, слева направо" #~ msgid "Top to Bottom, Right to Left" #~ msgstr "Сверху вниз, справа налево" #~ msgctxt "No border line" #~ msgid "None" #~ msgstr "Без рамки" #~ msgid "Single Line" #~ msgstr "Одна линия" #~ msgid "Single Thick Line" #~ msgstr "Одна толстая линия" #~ msgid "Double Line" #~ msgstr "Двойная линия" #~ msgid "Double Thick Line" #~ msgstr "Двойная толстая линия" #~ msgctxt "Banner page" #~ msgid "None" #~ msgstr "Нет" #~ msgctxt "Banner page" #~ msgid "Standard" #~ msgstr "Стандартная" #~ msgctxt "Banner page" #~ msgid "Unclassified" #~ msgstr "Не классифицируется" #~ msgctxt "Banner page" #~ msgid "Confidential" #~ msgstr "Конфиденциально" #~ msgctxt "Banner page" #~ msgid "Classified" #~ msgstr "Классифицируется" #~ msgctxt "Banner page" #~ msgid "Secret" #~ msgstr "Секретно" #~ msgctxt "Banner page" #~ msgid "Top Secret" #~ msgstr "Особо секретно" #~ msgid "All Pages" #~ msgstr "Все страницы" #~ msgid "Odd Pages" #~ msgstr "Нечётные страницы" #~ msgid "Even Pages" #~ msgstr "Чётные страницы" #~ msgid "Page Set" #~ msgstr "Набор страниц" #~ msgctxt "@title:window" #~ msgid "Print" #~ msgstr "Печать" #~ msgid "&Try" #~ msgstr "&Попробовать" #~ msgid "modified" #~ msgstr "изменён" #~ msgctxt "Document/application separator in titlebar" #~ msgid " – " #~ msgstr " — " #~ msgid "Get help..." #~ msgstr "Справка..." #~ msgid "Manage Link" #~ msgstr "Ссылка" #~ msgid "Link Text:" #~ msgstr "Текст ссылки:" #~ msgid "Link URL:" #~ msgstr "URL ссылки:" #~ msgctxt "@action:button filter-yes" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button filter-no" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button filter-continue" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button filter-cancel" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@action:button post-filter" #~ msgid "." #~ msgstr "." #~ msgid "Details" #~ msgstr "Сведения" #~ msgid "Question" #~ msgstr "Вопрос" #~ msgid "Do not ask again" #~ msgstr "Не задавать больше этот вопрос" #~ msgid "Warning" #~ msgstr "Предупреждение" #~ msgid "Error" #~ msgstr "Ошибка" #~ msgid "Sorry" #~ msgstr "Ошибка" #~ msgid "Information" #~ msgstr "Сведения" #~ msgid "Do not show this message again" #~ msgstr "Не показывать больше это сообщение" #~ msgid "Password:" #~ msgstr "Пароль:" #~ msgid "Password" #~ msgstr "Пароль" #~ msgid "Supply a username and password below." #~ msgstr "Введите имя пользователя и пароль." #~ msgid "No password, use anonymous (or guest) login" #~ msgstr "Без пароля, анонимный или гостевой вход" #~ msgid "Use this password:" #~ msgstr "Указать пароль:" #~ msgid "Username:" #~ msgstr "Имя пользователя:" #~ msgid "Domain:" #~ msgstr "Домен:" #~ msgid "Remember password" #~ msgstr "Сохранить пароль" #~ msgid "Select Region of Image" #~ msgstr "Выбор области изображения" #~ msgid "Please click and drag on the image to select the region of interest:" #~ msgstr "" #~ "Нажмите кнопку мыши и перемещайте указатель, чтобы выбрать интересующую " #~ "область:" #~ msgid "Unknown" #~ msgstr "неизвестный" #~ msgid "Tip of the Day" #~ msgstr "Совет дня" #~ msgid "Did you know...?\n" #~ msgstr "Знаете ли вы...?\n" #~ msgid "&Show tips on startup" #~ msgstr "&Показывать советы при запуске" #~ msgid "&Previous" #~ msgstr "&Предыдущее" #~ msgctxt "Opposite to Previous" #~ msgid "&Next" #~ msgstr "&Далее" #~ msgid "Find Next" #~ msgstr "Найти далее" #~ msgid "Find next occurrence of '%1'?" #~ msgstr "Найти следующее вхождение «%1»?" #~ msgid "1 match found." #~ msgid_plural "%1 matches found." #~ msgstr[0] "Найдено %1 совпадение." #~ msgstr[1] "Найдено %1 совпадения." #~ msgstr[2] "Найдено %1 совпадений." #~ msgstr[3] "Найдено %1 совпадение." #~ msgid "No matches found for '%1'." #~ msgstr "Не найдено совпадений для «%1»." #~ msgid "No matches found for '%1'." #~ msgstr "Нет совпадений для «%1»." #~ msgid "Beginning of document reached." #~ msgstr "Достигнуто начало документа." #~ msgid "End of document reached." #~ msgstr "Достигнут конец документа." #~ msgid "Continue from the end?" #~ msgstr "Продолжить с конца?" #~ msgid "Continue from the beginning?" #~ msgstr "Продолжить с начала?" #~ msgctxt "@title:group" #~ msgid "Find" #~ msgstr "Поиск" #~ msgid "&Text to find:" #~ msgstr "Искать &текст:" #~ msgid "Regular e&xpression" #~ msgstr "&Регулярное выражение" #~ msgid "&Edit..." #~ msgstr "&Изменить..." #~ msgid "Replace With" #~ msgstr "Заменить на" #~ msgid "Replace&ment text:" #~ msgstr "Текст для за&мены:" #~ msgid "Use p&laceholders" #~ msgstr "&Использовать заполнители" #~ msgid "Insert Place&holder" #~ msgstr "Вставить &заполнитель" #~ msgid "Options" #~ msgstr "Параметры" #~ msgid "C&ase sensitive" #~ msgstr "С &учётом регистра" #~ msgid "&Whole words only" #~ msgstr "&Только полные слова" #~ msgid "From c&ursor" #~ msgstr "От к&урсора" #~ msgid "Find &backwards" #~ msgstr "Ис&кать назад" #~ msgid "&Selected text" #~ msgstr "&Выделенный текст" #~ msgid "&Prompt on replace" #~ msgstr "&Спрашивать при замене" #~ msgid "Start replace" #~ msgstr "Начать замену" #~ msgid "" #~ "If you press the Replace button, the text you entered above is " #~ "searched for within the document and any occurrence is replaced with the " #~ "replacement text." #~ msgstr "" #~ "Если вы нажмёте копку Заменить, будет произведён поиск " #~ "введённого вами выражения, а затем замена каждого из найденных совпадений " #~ "на текст замены " #~ msgid "&Find" #~ msgstr "&Поиск" #~ msgid "Start searching" #~ msgstr "Начать поиск" #~ msgid "" #~ "If you press the Find button, the text you entered above is " #~ "searched for within the document." #~ msgstr "" #~ "Если вы нажмёте кнопку Найти, будет выполнен поиск введённого " #~ "вами текста по всему документу." #~ msgid "" #~ "Enter a pattern to search for, or select a previous pattern from the list." #~ msgstr "" #~ "Введите шаблон для поиска, или выберите предыдущий шаблон из списка." #~ msgid "If enabled, search for a regular expression." #~ msgstr "Если включено, искать регулярное выражение." #~ msgid "Click here to edit your regular expression using a graphical editor." #~ msgstr "" #~ "Нажмите, чтобы изменить ваше регулярное выражение при помощи графического " #~ "редактора." #~ msgid "Enter a replacement string, or select a previous one from the list." #~ msgstr "Введите строку для замены, или выберите предыдущую из списка." #~ msgid "" #~ "If enabled, any occurrence of \\N, where " #~ "N is an integer number, will be replaced with the " #~ "corresponding capture (\"parenthesized substring\") from the pattern." #~ "

    To include (a literal \\N in your replacement, put " #~ "an extra backslash in front of it, like \\\\N.

    " #~ msgstr "" #~ "Если установлен флажок, любое вхождение вида \\N, " #~ "где N — целое число, будет заменено N-ым захватом (компонентом найденной строки; компоненты обозначаются в регулярном " #~ "выражении круглыми скобками).

    Для того, чтобы последовательность " #~ "\\N не интерпретировалась (включалась в замены " #~ "буквально), поместите перед ней экранированную обратную косую черту: " #~ "\\\\N.

    " #~ msgid "Click for a menu of available captures." #~ msgstr "Нажмите для получения списка доступных захватов." #~ msgid "Require word boundaries in both ends of a match to succeed." #~ msgstr "Соответствие должно быть отдельным словом." #~ msgid "" #~ "Start searching at the current cursor location rather than at the top." #~ msgstr "Начать поиск от позиции курсора, а не с начала документа." #~ msgid "Only search within the current selection." #~ msgstr "Искать только в выделенном фрагменте." #~ msgid "" #~ "Perform a case sensitive search: entering the pattern 'Joe' will not " #~ "match 'joe' or 'JOE', only 'Joe'." #~ msgstr "" #~ "Искать с учётом регистра. В этом случае при поиске строки «Все» не будут " #~ "найдены слова «все» или «ВСЕ», только «Все»." #~ msgid "Search backwards." #~ msgstr "Искать назад." #~ msgid "Ask before replacing each match found." #~ msgstr "Спрашивать при каждой замене." #~ msgid "Any Character" #~ msgstr "Любой символ" #~ msgid "Start of Line" #~ msgstr "Начало строки" #~ msgid "End of Line" #~ msgstr "Конец строки" #~ msgid "Set of Characters" #~ msgstr "Набор символов" #~ msgid "Repeats, Zero or More Times" #~ msgstr "Повторы, ноль или более раз" #~ msgid "Repeats, One or More Times" #~ msgstr "Повторы, один или более раз" #~ msgid "Optional" #~ msgstr "Дополнительно" #~ msgid "Escape" #~ msgstr "Экранирующий символ" #~ msgid "TAB" #~ msgstr "Табуляция" #~ msgid "Newline" #~ msgstr "Перевод строки" #~ msgid "Carriage Return" #~ msgstr "Возврат каретки" #~ msgid "White Space" #~ msgstr "Пробельный символ" #~ msgid "Digit" #~ msgstr "Цифра" #~ msgid "Complete Match" #~ msgstr "Полное соответствие" #~ msgid "Captured Text (%1)" #~ msgstr "Захваченный текст (%1)" #~ msgid "You must enter some text to search for." #~ msgstr "Необходимо ввести текст для поиска." #~ msgid "Invalid regular expression." #~ msgstr "Неверное регулярное выражение." #~ msgid "Replace" #~ msgstr "Заменить" #~ msgctxt "@action:button Replace all occurrences" #~ msgid "&All" #~ msgstr "&Все" #~ msgid "&Skip" #~ msgstr "Пропу&стить" #~ msgid "Replace '%1' with '%2'?" #~ msgstr "Заменить «%1» на «%2»?" #~ msgid "No text was replaced." #~ msgstr "Замена текста не была произведена." #~ msgid "1 replacement done." #~ msgid_plural "%1 replacements done." #~ msgstr[0] "Сделана %1 замена." #~ msgstr[1] "Сделаны %1 замены." #~ msgstr[2] "Сделано %1 замен." #~ msgstr[3] "Сделана %1 замена." #~ msgid "Do you want to restart search from the end?" #~ msgstr "Продолжить поиск с конца?" #~ msgid "Do you want to restart search at the beginning?" #~ msgstr "Продолжить поиск с начала?" #~ msgctxt "@action:button Restart find & replace" #~ msgid "Restart" #~ msgstr "Повторить" #~ msgctxt "@action:button Stop find & replace" #~ msgid "Stop" #~ msgstr "Остановить" #~ msgid "" #~ "Your replacement string is referencing a capture greater than '\\%1', " #~ msgstr "Строка замены ссылается на захват, больший чем \\%1, " #~ msgid "but your pattern only defines 1 capture." #~ msgid_plural "but your pattern only defines %1 captures." #~ msgstr[0] "но шаблон определяет только %1 захват." #~ msgstr[1] "но шаблон определяет только %1 захвата." #~ msgstr[2] "но шаблон определяет только %1 захватов." #~ msgstr[3] "но шаблон определяет только %1 захват." #~ msgid "but your pattern defines no captures." #~ msgstr "но шаблон не определяет захватов." #~ msgid "" #~ "\n" #~ "Please correct." #~ msgstr "" #~ "\n" #~ "Исправьте, пожалуйста." #~ msgctxt "@item Font name" #~ msgid "Sans Serif" #~ msgstr "Sans Serif" #~ msgctxt "@item Font name" #~ msgid "Serif" #~ msgstr "Serif" #~ msgctxt "@item Font name" #~ msgid "Monospace" #~ msgstr "Monospace" #~ msgctxt "@item Font name" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "@item Font name [foundry]" #~ msgid "%1 [%2]" #~ msgstr "%1 [%2]" #~ msgctxt "@info:whatsthis" #~ msgid "Here you can choose the font to be used." #~ msgstr "Здесь можно выбрать шрифт." #~ msgid "Requested Font" #~ msgstr "Запрошенный шрифт" #~ msgctxt "@option:check" #~ msgid "Font" #~ msgstr "Шрифт" #~ msgctxt "@info:whatsthis" #~ msgid "Enable this checkbox to change the font family settings." #~ msgstr "Поставьте флажок чтобы изменить гарнитуру шрифта." #~ msgctxt "@info:tooltip" #~ msgid "Change font family?" #~ msgstr "Изменить гарнитуру шрифта?" #~ msgctxt "@label" #~ msgid "Font:" #~ msgstr "Гарнитура:" #~ msgctxt "@option:check" #~ msgid "Font style" #~ msgstr "Начертание" #~ msgctxt "@info:whatsthis" #~ msgid "Enable this checkbox to change the font style settings." #~ msgstr "Поставьте флажок чтобы изменить начертание шрифта." #~ msgctxt "@info:tooltip" #~ msgid "Change font style?" #~ msgstr "Изменить начертание шрифта?" #~ msgid "Font style:" #~ msgstr "Начертание:" #~ msgctxt "@option:check" #~ msgid "Size" #~ msgstr "Размер" #~ msgctxt "@info:whatsthis" #~ msgid "Enable this checkbox to change the font size settings." #~ msgstr "Поставьте флажок чтобы изменить размер шрифта." #~ msgctxt "@info:tooltip" #~ msgid "Change font size?" #~ msgstr "Изменить размер шрифта?" #~ msgctxt "@label:listbox Font size" #~ msgid "Size:" #~ msgstr "Размер:" #~ msgctxt "@info:whatsthis" #~ msgid "Here you can choose the font family to be used." #~ msgstr "Здесь можно выбрать гарнитуру шрифта." #~ msgctxt "@info:whatsthis" #~ msgid "Here you can choose the font style to be used." #~ msgstr "Здесь можно выбрать начертание шрифта." #~ msgctxt "@item font" #~ msgid "Italic" #~ msgstr "Курсив" #~ msgctxt "@item font" #~ msgid "Oblique" #~ msgstr "Наклонный" #~ msgctxt "@item font" #~ msgid "Bold" #~ msgstr "Полужирный" #~ msgctxt "@item font" #~ msgid "Bold Italic" #~ msgstr "Полужирный курсив" #~ msgctxt "@item font size" #~ msgid "Relative" #~ msgstr "Относительный" #~ msgid "Font size
    fixed or relative
    to environment" #~ msgstr "" #~ "Размер шрифта
    фиксированный или относительный
    к " #~ "среде" #~ msgid "" #~ "Here you can switch between fixed font size and font size to be " #~ "calculated dynamically and adjusted to changing environment (e.g. widget " #~ "dimensions, paper size)." #~ msgstr "" #~ "Здесь можно переключиться между фиксированным размером шрифта и размером, " #~ "вычисляемым динамически и зависящим от изменяющегося окружения (размер " #~ "элементов окна, бумаги и т.д.)." #~ msgid "Here you can choose the font size to be used." #~ msgstr "Здесь можно выбрать размер шрифта." #~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog" #~ msgstr "" #~ "Широкая электрификация южных губерний даст мощный толчок подъёму " #~ "сельского хозяйства" #~ msgid "" #~ "This sample text illustrates the current settings. You may edit it to " #~ "test special characters." #~ msgstr "" #~ "Этот текст иллюстрирует текущие параметры. Измените его, чтобы проверить " #~ "корректность показа специальных символов." #~ msgid "Actual Font" #~ msgstr "Доступный шрифт" #~ msgctxt "@item Font style" #~ msgid "%1" #~ msgstr "%1" #~ msgctxt "short" #~ msgid "The Quick Brown Fox Jumps Over The Lazy Dog" #~ msgstr "" #~ "Широкая электрификация южных губерний даст мощный толчок подъёму " #~ "сельского хозяйства" #~ msgctxt "Numeric IDs of scripts for font previews" #~ msgid "1" #~ msgstr "1" #~ msgid "Select Font" #~ msgstr "Выбор шрифта" #~ msgid "Choose..." #~ msgstr "Выбрать..." #~ msgid "Click to select a font" #~ msgstr "Нажмите, чтобы выбрать шрифт" #~ msgid "Preview of the selected font" #~ msgstr "Образец выбранного шрифта" #~ msgid "" #~ "This is a preview of the selected font. You can change it by clicking the " #~ "\"Choose...\" button." #~ msgstr "" #~ "Это образец выбранного шрифта. Его можно сменить, нажав кнопку " #~ "«Выбрать...»." #~ msgid "Preview of the \"%1\" font" #~ msgstr "Образец шрифта %1" #~ msgid "" #~ "This is a preview of the \"%1\" font. You can change it by clicking the " #~ "\"Choose...\" button." #~ msgstr "" #~ "Это образец шрифта %1. Вы можете сменить его, нажав кнопку «Выбрать...»." #~ msgid "Search" #~ msgstr "Поиск" #~ msgid "Stop" #~ msgstr "Остановить" #~ msgid " Stalled " #~ msgstr " Нет данных " #~ msgid " %1/s " #~ msgstr " %1/с " #~ msgctxt "%1 is the label, we add a ':' to it" #~ msgid "%1:" #~ msgstr "%1:" #~ msgid "%2 of %3 complete" #~ msgid_plural "%2 of %3 complete" #~ msgstr[0] "Выполнено %2 из %3" #~ msgstr[1] "Выполнено %2 из %3" #~ msgstr[2] "Выполнено %2 из %3" #~ msgstr[3] "Выполнено %2 из %3" #~ msgid "%2 / %1 folder" #~ msgid_plural "%2 / %1 folders" #~ msgstr[0] "%2 из %1 папки" #~ msgstr[1] "%2 из %1 папок" #~ msgstr[2] "%2 из %1 папок" #~ msgstr[3] "%2 из %1 папки" #~ msgid "%2 / %1 file" #~ msgid_plural "%2 / %1 files" #~ msgstr[0] "%2 из %1 файла" #~ msgstr[1] "%2 из %1 файлов" #~ msgstr[2] "%2 из %1 файлов" #~ msgstr[3] "%2 из %1 файла" #~ msgid "%1% of %2" #~ msgstr "%1% из %2" #~ msgid "%2% of 1 file" #~ msgid_plural "%2% of %1 files" #~ msgstr[0] "%2% %1 файла" #~ msgstr[1] "%2% %1 файлов" #~ msgstr[2] "%2% %1 файлов" #~ msgstr[3] "%2% %1 файла" #~ msgid "%1%" #~ msgstr "%1%" #~ msgid "Stalled" #~ msgstr "Нет данных" #~ msgid "%2/s (%3 remaining)" #~ msgid_plural "%2/s (%3 remaining)" #~ msgstr[0] "%2/с ( осталось %3 )" #~ msgstr[1] "%2/с ( осталось %3 )" #~ msgstr[2] "%2/с ( осталось %3 )" #~ msgstr[3] "%2/с ( осталось %3 )" #~ msgctxt "speed in bytes per second" #~ msgid "%1/s" #~ msgstr "%1/с" #~ msgid "%1/s (done)" #~ msgstr "%1/с (готово)" #~ msgid "&Resume" #~ msgstr "&Возобновить" #~ msgid "&Pause" #~ msgstr "&Приостановить" #~ msgctxt "The source url of a job" #~ msgid "Source:" #~ msgstr "Источник:" #~ msgctxt "The destination url of a job" #~ msgid "Destination:" #~ msgstr "Назначение:" #~ msgid "Click this to expand the dialog, to show details" #~ msgstr "" #~ "Нажмите эту кнопку, чтобы развернуть диалог для показа дополнительных " #~ "сведений" #~ msgid "&Keep this window open after transfer is complete" #~ msgstr "Не &закрывать окно после окончания передачи данных" #~ msgid "Open &File" #~ msgstr "&Открыть файл" #~ msgid "Open &Destination" #~ msgstr "Открыть папку &назначения" #~ msgid "Progress Dialog" #~ msgstr "Процесс выполнения" #~ msgid "%1 folder" #~ msgid_plural "%1 folders" #~ msgstr[0] "%1 папка" #~ msgstr[1] "%1 папки" #~ msgstr[2] "%1 папок" #~ msgstr[3] "%1 папка" #~ msgid "%1 file" #~ msgid_plural "%1 files" #~ msgstr[0] "%1 файл" #~ msgstr[1] "%1 файла" #~ msgstr[2] "%1 файлов" #~ msgstr[3] "%1 файл" #~ msgid "Click this to collapse the dialog, to hide details" #~ msgstr "Нажмите эту кнопку для сворачивания диалога" #~ msgid "The style '%1' was not found" #~ msgstr "Стиль «%1» не найден" #~ msgid "Do not run in the background." #~ msgstr "Не запускать в фоновом режиме." #~ msgid "Internally added if launched from Finder" #~ msgstr "Добавлено изнутри, если запущено из Finder" #~ msgid "Unknown Application" #~ msgstr "Неизвестное приложение" #~ msgid "&Minimize" #~ msgstr "&Свернуть" #~ msgid "&Restore" #~ msgstr "Восст&ановить" #~ msgid "Are you sure you want to quit %1?" #~ msgstr "Выйти из программы %1?" #~ msgid "Confirm Quit From System Tray" #~ msgstr "Подтверждение выхода из программы" #~ msgid "Minimize" #~ msgstr "Свернуть" #~ msgid "Conflict with Global Shortcut" #~ msgstr "Конфликт с глобальной комбинацией" #~ msgid "" #~ "The '%1' key combination has already been allocated to the global action " #~ "\"%2\" in %3.\n" #~ "Do you want to reassign it from that action to the current one?" #~ msgstr "" #~ "Комбинация клавиш %1 уже связана с глобальным действием «%2» в %3.\n" #~ "Связать комбинацию с текущим действием?" #~ msgid "" #~ "The '%1' key combination is registered by application %2 for action %3:" #~ msgstr "Клавиша «%1» уже назначена в приложении %2 на действие %3:" #~ msgid "In context '%1' for action '%2'\n" #~ msgstr "Контекст «%1» для действия «%2»\n" #~ msgid "" #~ "The '%1' key combination is registered by application %2.\n" #~ "%3" #~ msgstr "" #~ "Клавиша «%1» уже назначена в приложении %2.\n" #~ "%3" #~ msgid "Conflict With Registered Global Shortcut" #~ msgstr "Конфликт с глобальной комбинацией клавиш" #~ msgctxt "@action" #~ msgid "Open" #~ msgstr "Открыть" #~ msgctxt "@action" #~ msgid "New" #~ msgstr "Создать" #~ msgctxt "@action" #~ msgid "Close" #~ msgstr "Закрыть" #~ msgctxt "@action" #~ msgid "Save" #~ msgstr "Сохранить" #~ msgctxt "@action" #~ msgid "Print" #~ msgstr "Печать" #~ msgctxt "@action" #~ msgid "Quit" #~ msgstr "Выход" #~ msgctxt "@action" #~ msgid "Undo" #~ msgstr "Отменить действие" #~ msgctxt "@action" #~ msgid "Redo" #~ msgstr "Повторить отменённое действие" #~ msgctxt "@action" #~ msgid "Cut" #~ msgstr "Вырезать" #~ msgctxt "@action" #~ msgid "Copy" #~ msgstr "Копировать" #~ msgctxt "@action" #~ msgid "Paste" #~ msgstr "Вставить" #~ msgctxt "@action" #~ msgid "Paste Selection" #~ msgstr "Вставить выделение" #~ msgctxt "@action" #~ msgid "Select All" #~ msgstr "Выделить все" #~ msgctxt "@action" #~ msgid "Deselect" #~ msgstr "Снять выделение" #~ msgctxt "@action" #~ msgid "Delete Word Backwards" #~ msgstr "Удалить слово перед курсором" #~ msgctxt "@action" #~ msgid "Delete Word Forward" #~ msgstr "Удалить слово после курсора" #~ msgctxt "@action" #~ msgid "Find" #~ msgstr "Найти" #~ msgctxt "@action" #~ msgid "Find Next" #~ msgstr "Найти далее" #~ msgctxt "@action" #~ msgid "Find Prev" #~ msgstr "Найти предыдущее" #~ msgctxt "@action" #~ msgid "Replace" #~ msgstr "Заменить" #~ msgctxt "@action Go to main page" #~ msgid "Home" #~ msgstr "Основная страница" #~ msgctxt "@action Beginning of document" #~ msgid "Begin" #~ msgstr "Начало документа" #~ msgctxt "@action End of document" #~ msgid "End" #~ msgstr "Конец документа" #~ msgctxt "@action" #~ msgid "Prior" #~ msgstr "Предыдущий" #~ msgctxt "@action Opposite to Prior" #~ msgid "Next" #~ msgstr "Далее" #~ msgctxt "@action" #~ msgid "Up" #~ msgstr "Вверх" #~ msgctxt "@action" #~ msgid "Back" #~ msgstr "Назад" #~ msgctxt "@action" #~ msgid "Forward" #~ msgstr "Вперёд" #~ msgctxt "@action" #~ msgid "Reload" #~ msgstr "Открыть заново" #~ msgctxt "@action" #~ msgid "Beginning of Line" #~ msgstr "Начало строки" #~ msgctxt "@action" #~ msgid "End of Line" #~ msgstr "Конец строки" #~ msgctxt "@action" #~ msgid "Go to Line" #~ msgstr "Перейти к строке" #~ msgctxt "@action" #~ msgid "Backward Word" #~ msgstr "На слово назад" #~ msgctxt "@action" #~ msgid "Forward Word" #~ msgstr "На слово вперёд" #~ msgctxt "@action" #~ msgid "Add Bookmark" #~ msgstr "Добавить закладку" #~ msgctxt "@action" #~ msgid "Zoom In" #~ msgstr "Увеличить масштаб" #~ msgctxt "@action" #~ msgid "Zoom Out" #~ msgstr "Уменьшить масштаб" #~ msgctxt "@action" #~ msgid "Full Screen Mode" #~ msgstr "Полноэкранный режим" #~ msgctxt "@action" #~ msgid "Show Menu Bar" #~ msgstr "Показать меню" #~ msgctxt "@action" #~ msgid "Activate Next Tab" #~ msgstr "Перейти на следующую вкладку" #~ msgctxt "@action" #~ msgid "Activate Previous Tab" #~ msgstr "Перейти на предыдущую вкладку" #~ msgctxt "@action" #~ msgid "Help" #~ msgstr "Справка" #~ msgctxt "@action" #~ msgid "What's This" #~ msgstr "Что это?" #~ msgctxt "@action" #~ msgid "Text Completion" #~ msgstr "Завершение текста" #~ msgctxt "@action" #~ msgid "Previous Completion Match" #~ msgstr "Предыдущий вариант завершения" #~ msgctxt "@action" #~ msgid "Next Completion Match" #~ msgstr "Следующий вариант завершения" #~ msgctxt "@action" #~ msgid "Substring Completion" #~ msgstr "Завершение подстроки" #~ msgctxt "@action" #~ msgid "Previous Item in List" #~ msgstr "Предыдущий элемент в списке" #~ msgctxt "@action" #~ msgid "Next Item in List" #~ msgstr "Следующий элемент в списке" #~ msgctxt "@action" #~ msgid "Open Recent" #~ msgstr "Последние файлы" #~ msgctxt "@action" #~ msgid "Save As" #~ msgstr "Сохранить как" #~ msgctxt "@action" #~ msgid "Revert" #~ msgstr "Восстановить" #~ msgctxt "@action" #~ msgid "Print Preview" #~ msgstr "Предварительный просмотр" #~ msgctxt "@action" #~ msgid "Mail" #~ msgstr "Отправить по почте" #~ msgctxt "@action" #~ msgid "Clear" #~ msgstr "Очистить" #~ msgctxt "@action" #~ msgid "Actual Size" #~ msgstr "Фактический размер" #~ msgctxt "@action" #~ msgid "Fit To Page" #~ msgstr "Вместить" #~ msgctxt "@action" #~ msgid "Fit To Width" #~ msgstr "Вместить по ширине" #~ msgctxt "@action" #~ msgid "Fit To Height" #~ msgstr "Вместить по высоте" #~ msgctxt "@action" #~ msgid "Zoom" #~ msgstr "Масштаб" #~ msgctxt "@action" #~ msgid "Goto" #~ msgstr "Перейти" #~ msgctxt "@action" #~ msgid "Goto Page" #~ msgstr "Перейти на страницу" #~ msgctxt "@action" #~ msgid "Document Back" #~ msgstr "Назад" #~ msgctxt "@action" #~ msgid "Document Forward" #~ msgstr "Вперёд" #~ msgctxt "@action" #~ msgid "Edit Bookmarks" #~ msgstr "Изменить закладки" #~ msgctxt "@action" #~ msgid "Spelling" #~ msgstr "Проверка орфографии" #~ msgctxt "@action" #~ msgid "Show Toolbar" #~ msgstr "Показать панель инструментов" #~ msgctxt "@action" #~ msgid "Show Statusbar" #~ msgstr "Показать строку состояния" #~ msgctxt "@action" #~ msgid "Save Options" #~ msgstr "Сохранить параметры" #~ msgctxt "@action" #~ msgid "Key Bindings" #~ msgstr "Комбинации клавиш" #~ msgctxt "@action" #~ msgid "Preferences" #~ msgstr "Настроить" #~ msgctxt "@action" #~ msgid "Configure Toolbars" #~ msgstr "Настроить панели инструментов" #~ msgctxt "@action" #~ msgid "Configure Notifications" #~ msgstr "Настроить уведомления" #~ msgctxt "@action" #~ msgid "Tip Of Day" #~ msgstr "Совет дня" #~ msgctxt "@action" #~ msgid "Report Bug" #~ msgstr "Сообщить об ошибке" #~ msgctxt "@action" #~ msgid "Switch Application Language" #~ msgstr "Сменить язык интерфейса приложения" #~ msgctxt "@action" #~ msgid "About Application" #~ msgstr "О приложении" #~ msgctxt "@action" #~ msgid "About KDE" #~ msgstr "О KDE" #~ msgid "Spell Checking Configuration" #~ msgstr "Настройка проверки орфографии" #~ msgid "Enable &background spellchecking" #~ msgstr "Включить &фоновую проверку орфографии" #~ msgid "&Automatic spell checking enabled by default" #~ msgstr "&По умолчанию использовать проверку орфографии на лету" #~ msgid "Skip all &uppercase words" #~ msgstr "Пропускать &слова в верхнем регистре" #~ msgid "S&kip run-together words" #~ msgstr "Пропускать слова, &написанные слитно" #~ msgid "Default language:" #~ msgstr "Язык по умолчанию:" #~ msgid "Ignored Words" #~ msgstr "Игнорируемые слова" #~ msgctxt "@title:window" #~ msgid "Check Spelling" #~ msgstr "Проверить орфографию" #~ msgctxt "@action:button" #~ msgid "&Finished" #~ msgstr "&Готово" #~ msgctxt "progress label" #~ msgid "Spell checking in progress..." #~ msgstr "Выполняется проверка орфографии..." #~ msgid "Spell check stopped." #~ msgstr "Проверка орфографии остановлена" #~ msgid "Spell check canceled." #~ msgstr "Проверка орфографии отменена." #~ msgid "Spell check complete." #~ msgstr "Проверка орфографии завершена." #~ msgid "Autocorrect" #~ msgstr "Автокоррекция" #~ msgid "" #~ "You reached the end of the list\n" #~ "of matching items.\n" #~ msgstr "" #~ "Достигнут конец списка\n" #~ "совпадающих элементов.\n" #~ msgid "" #~ "The completion is ambiguous, more than one\n" #~ "match is available.\n" #~ msgstr "" #~ "Завершение неоднозначно, существует более\n" #~ "одного варианта.\n" #~ msgid "There is no matching item available.\n" #~ msgstr "Нет совпадающих элементов.\n" #~ msgid "Backspace" #~ msgstr "Backspace" #~ msgid "SysReq" #~ msgstr "SysReq" #~ msgid "CapsLock" #~ msgstr "CapsLock" #~ msgid "NumLock" #~ msgstr "NumLock" #~ msgid "ScrollLock" #~ msgstr "ScrollLock" #~ msgid "PageUp" #~ msgstr "PageUp" #~ msgid "PageDown" #~ msgstr "PageDown" #~ msgid "Again" #~ msgstr "Снова" #~ msgid "Props" #~ msgstr "Свойства" #~ msgid "Front" #~ msgstr "Фронт" #~ msgid "Copy" #~ msgstr "Копировать" #~ msgid "Open" #~ msgstr "Открыть" #~ msgid "Paste" #~ msgstr "Вставить" #~ msgid "Find" #~ msgstr "Найти" #~ msgid "Cut" #~ msgstr "Вырезать" #~ msgid "&OK" #~ msgstr "&ОК" #~ msgid "&Cancel" #~ msgstr "О&тмена" #~ msgid "&Yes" #~ msgstr "&Да" #~ msgid "Yes" #~ msgstr "Да" #~ msgid "&No" #~ msgstr "&Нет" #~ msgid "No" #~ msgstr "Нет" #~ msgid "&Discard" #~ msgstr "От&клонить" #~ msgid "Discard changes" #~ msgstr "Сбросить изменения" #~ msgid "" #~ "Pressing this button will discard all recent changes made in this dialog." #~ msgstr "Нажатие этой кнопки сбросит все изменения в текущем диалоге." #~ msgid "Save data" #~ msgstr "Сохранить данные" #~ msgid "&Do Not Save" #~ msgstr "&Не сохранять" #~ msgid "Do not save data" #~ msgstr "Не сохранять данные" #~ msgid "Save file with another name" #~ msgstr "Сохранить файл под другим именем" #~ msgid "&Apply" #~ msgstr "&Применить" #~ msgid "Apply changes" #~ msgstr "Применить изменения" #~ msgid "" #~ "When you click Apply, the settings will be handed over to the " #~ "program, but the dialog will not be closed.\n" #~ "Use this to try different settings." #~ msgstr "" #~ "При нажатии кнопки Применить параметры будут переданы в программу, " #~ "но окно параметров не будет закрыто.\n" #~ "Благодаря этому вы можете попробовать различные варианты настройки." #~ msgid "Administrator &Mode..." #~ msgstr "&Режим администратора..." #~ msgid "Enter Administrator Mode" #~ msgstr "Вход с правами администратора" #~ msgid "" #~ "When you click Administrator Mode you will be prompted for the " #~ "administrator (root) password in order to make changes which require root " #~ "privileges." #~ msgstr "" #~ "При нажатии кнопки Режим администратора будет запрошен пароль " #~ "администратора (root), поскольку действия нужно будет выполнять с правами " #~ "этого пользователя." #~ msgid "Clear input" #~ msgstr "Очистить ввод" #~ msgid "Clear the input in the edit field" #~ msgstr "Очистить ввод в строке редактирования" #~ msgid "Show help" #~ msgstr "Показать справку" #~ msgid "Close the current window or document" #~ msgstr "Закрыть текущее окно или документ" #~ msgid "&Close Window" #~ msgstr "&Закрыть окно" #~ msgid "Close the current window." #~ msgstr "Закрыть текущее окно" #~ msgid "&Close Document" #~ msgstr "&Закрыть документ" #~ msgid "Close the current document." #~ msgstr "Закрыть текущий документ." #~ msgid "&Defaults" #~ msgstr "По &умолчанию" #~ msgid "Reset all items to their default values" #~ msgstr "Восстановить значения по умолчанию" #~ msgid "Go back one step" #~ msgstr "Вернуться на шаг назад" #~ msgid "Go forward one step" #~ msgstr "Перейти на шаг вперёд" #~ msgid "Opens the print dialog to print the current document" #~ msgstr "Открывает диалог печати для печати текущего документа" #~ msgid "C&ontinue" #~ msgstr "Пр&одолжить" #~ msgid "Continue operation" #~ msgstr "Продолжить действие" #~ msgid "&Delete" #~ msgstr "&Удалить" #~ msgid "Delete item(s)" #~ msgstr "Удалить элементы" #~ msgid "Open file" #~ msgstr "Открыть файл" #~ msgid "&Reset" #~ msgstr "Сб&рос" #~ msgid "Reset configuration" #~ msgstr "Сбросить конфигурацию" #~ msgctxt "Verb" #~ msgid "&Insert" #~ msgstr "&Вставить" #~ msgid "Confi&gure..." #~ msgstr "&Настроить..." #~ msgid "Add" #~ msgstr "Добавить" #~ msgid "Test" #~ msgstr "Проверить" #~ msgid "Properties" #~ msgstr "Свойства" #~ msgid "&Overwrite" #~ msgstr "&Заменить" #~ msgid "&Available:" #~ msgstr "&Доступные:" #~ msgid "&Selected:" #~ msgstr "&Выбранные:" #~ msgctxt "KCharSelect section name" #~ msgid "European Alphabets" #~ msgstr "Европейские" #~ msgctxt "KCharSelect section name" #~ msgid "African Scripts" #~ msgstr "Африканские" #~ msgctxt "KCharSelect section name" #~ msgid "Middle Eastern Scripts" #~ msgstr "Ближневосточные" #~ msgctxt "KCharSelect section name" #~ msgid "South Asian Scripts" #~ msgstr "Южной Азии" #~ msgctxt "KCharSelect section name" #~ msgid "Philippine Scripts" #~ msgstr "Филиппинские" #~ msgctxt "KCharSelect section name" #~ msgid "South East Asian Scripts" #~ msgstr "Юго-Восточной Азии" #~ msgctxt "KCharSelect section name" #~ msgid "East Asian Scripts" #~ msgstr "Восточно-Азиатские" #~ msgctxt "KCharSelect section name" #~ msgid "Central Asian Scripts" #~ msgstr "Центрально-Азиатские" #~ msgctxt "KCharSelect section name" #~ msgid "Other Scripts" #~ msgstr "Другие" #~ msgctxt "KCharSelect section name" #~ msgid "Symbols" #~ msgstr "Символы" #~ msgctxt "KCharSelect section name" #~ msgid "Mathematical Symbols" #~ msgstr "Математические символы" #~ msgctxt "KCharSelect section name" #~ msgid "Phonetic Symbols" #~ msgstr "Фонетические символы" #~ msgctxt "KCharSelect section name" #~ msgid "Combining Diacritical Marks" #~ msgstr "Диакритические знаки" #~ msgctxt "KCharSelect section name" #~ msgid "Other" #~ msgstr "Другие" #~ msgctxt "KCharselect unicode block name" #~ msgid "Basic Latin" #~ msgstr "Основная латиница" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin-1 Supplement" #~ msgstr "Дополнение латиницы 1" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-A" #~ msgstr "Расширенная латиница-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-B" #~ msgstr "Расширенная латиница-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "IPA Extensions" #~ msgstr "Расширенный набор IPA" #~ msgctxt "KCharselect unicode block name" #~ msgid "Spacing Modifier Letters" #~ msgstr "Модификаторы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Diacritical Marks" #~ msgstr "Диакритические знаки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Greek and Coptic" #~ msgstr "Греческий и коптский алфавиты" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic" #~ msgstr "Кириллица" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic Supplement" #~ msgstr "Дополнительные символы кириллицы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Armenian" #~ msgstr "Армянский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hebrew" #~ msgstr "Иврит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic" #~ msgstr "Арабское письмо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Syriac" #~ msgstr "Сирийский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic Supplement" #~ msgstr "Дополнительные символы арабского письма" #~ msgctxt "KCharselect unicode block name" #~ msgid "Thaana" #~ msgstr "Тана" #~ msgctxt "KCharselect unicode block name" #~ msgid "NKo" #~ msgstr "Нко" #~ msgctxt "KCharselect unicode block name" #~ msgid "Samaritan" #~ msgstr "Самаритянская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Mandaic" #~ msgstr "Мандейская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Devanagari" #~ msgstr "Деванагари" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bengali" #~ msgstr "Бенгальская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Gurmukhi" #~ msgstr "Гурмукхи" #~ msgctxt "KCharselect unicode block name" #~ msgid "Gujarati" #~ msgstr "Гуджарати" #~ msgctxt "KCharselect unicode block name" #~ msgid "Oriya" #~ msgstr "Ория" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tamil" #~ msgstr "Тамильская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Telugu" #~ msgstr "Телугу" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kannada" #~ msgstr "Каннада" #~ msgctxt "KCharselect unicode block name" #~ msgid "Malayalam" #~ msgstr "Малаялам" #~ msgctxt "KCharselect unicode block name" #~ msgid "Sinhala" #~ msgstr "Сингальская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Thai" #~ msgstr "Тайская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Lao" #~ msgstr "Лаосская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tibetan" #~ msgstr "Тибетская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Myanmar" #~ msgstr "Мьянманская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Georgian" #~ msgstr "Грузинский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Jamo" #~ msgstr "Хангыль" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic" #~ msgstr "Эфиопская слоговая письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic Supplement" #~ msgstr "Дополнительные символы эфиопской письменности" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cherokee" #~ msgstr "Письменность чероки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Unified Canadian Aboriginal Syllabics" #~ msgstr "Канадское слоговое письмо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ogham" #~ msgstr "Огам" #~ msgctxt "KCharselect unicode block name" #~ msgid "Runic" #~ msgstr "Руническая письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tagalog" #~ msgstr "Тагальская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hanunoo" #~ msgstr "Хануноо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Buhid" #~ msgstr "Бухид" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tagbanwa" #~ msgstr "Тагбанва" #~ msgctxt "KCharselect unicode block name" #~ msgid "Khmer" #~ msgstr "Кхмерская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Mongolian" #~ msgstr "Старомонгольская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Unified Canadian Aboriginal Syllabics Extended" #~ msgstr "Расширенное канадское слоговое письмо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Limbu" #~ msgstr "Письменность лимбу" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tai Le" #~ msgstr "Письменность тай лэ" #~ msgctxt "KCharselect unicode block name" #~ msgid "New Tai Lue" #~ msgstr "Новый алфавит тай лы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Khmer Symbols" #~ msgstr "Кхмерские символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Buginese" #~ msgstr "Бугийская письменность" # http://en.wikipedia.org/wiki/Tai_Tham_script --aspotashev # http://ru.wikipedia.org/wiki/Ланна --aspotashev # http://www.omniglot.com/writing/lanna.htm --aspotashev #~ msgctxt "KCharselect unicode block name" #~ msgid "Tai Tham" #~ msgstr "Письменность Ланна" #~ msgctxt "KCharselect unicode block name" #~ msgid "Balinese" #~ msgstr "Балийская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Sundanese" #~ msgstr "Сунданская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Batak" #~ msgstr "Батакская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Lepcha" #~ msgstr "Лепча" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ol Chiki" #~ msgstr "Алфавит сантали" #~ msgctxt "KCharselect unicode block name" #~ msgid "Vedic Extensions" #~ msgstr "Расширение для ведийского санскрита" #~ msgctxt "KCharselect unicode block name" #~ msgid "Phonetic Extensions" #~ msgstr "Фонетические расширения" #~ msgctxt "KCharselect unicode block name" #~ msgid "Phonetic Extensions Supplement" #~ msgstr "Дополнительные фонетические расширения" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Diacritical Marks Supplement" #~ msgstr "Дополнительные комбинируемые диакритические знаки для символов" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended Additional" #~ msgstr "Дополнительная расширенная латиница" #~ msgctxt "KCharselect unicode block name" #~ msgid "Greek Extended" #~ msgstr "Расширенный набор символов греческого алфавита" #~ msgctxt "KCharselect unicode block name" #~ msgid "General Punctuation" #~ msgstr "Знаки пунктуации" #~ msgctxt "KCharselect unicode block name" #~ msgid "Superscripts and Subscripts" #~ msgstr "Надстрочные и подстрочные знаки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Currency Symbols" #~ msgstr "Символы валют" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Diacritical Marks for Symbols" #~ msgstr "Комбинируемые диакритические знаки для символов" #~ msgctxt "KCharselect unicode block name" #~ msgid "Letterlike Symbols" #~ msgstr "Буквообразные символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Number Forms" #~ msgstr "Числовые формы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arrows" #~ msgstr "Стрелки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Mathematical Operators" #~ msgstr "Математические операторы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Technical" #~ msgstr "Разнообразные технические символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Control Pictures" #~ msgstr "Значки управляющих кодов" #~ msgctxt "KCharselect unicode block name" #~ msgid "Optical Character Recognition" #~ msgstr "Символы оптического распознавания" #~ msgctxt "KCharselect unicode block name" #~ msgid "Enclosed Alphanumerics" #~ msgstr "Вложенные буквы и цифры" #~ msgctxt "KCharselect unicode block name" #~ msgid "Box Drawing" #~ msgstr "Символы рисования рамок" #~ msgctxt "KCharselect unicode block name" #~ msgid "Block Elements" #~ msgstr "Символы заполнения" #~ msgctxt "KCharselect unicode block name" #~ msgid "Geometric Shapes" #~ msgstr "Геометрические фигуры" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Symbols" #~ msgstr "Разнообразные символы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Dingbats" #~ msgstr "Знаки орнамента" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Mathematical Symbols-A" #~ msgstr "Разнообразные математические символы-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Arrows-A" #~ msgstr "Дополнительные стрелки-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Braille Patterns" #~ msgstr "Азбука Брайля" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Arrows-B" #~ msgstr "Дополнительные стрелки-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Mathematical Symbols-B" #~ msgstr "Разнообразные математические символы-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Mathematical Operators" #~ msgstr "Дополнительные математические операторы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Miscellaneous Symbols and Arrows" #~ msgstr "Разнообразные символы и стрелки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Glagolitic" #~ msgstr "Глаголица" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-C" #~ msgstr "Расширенная латиница-C" #~ msgctxt "KCharselect unicode block name" #~ msgid "Coptic" #~ msgstr "Коптский алфавит" #~ msgctxt "KCharselect unicode block name" #~ msgid "Georgian Supplement" #~ msgstr "Дополнительные символы грузинского алфавита" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tifinagh" #~ msgstr "Тифинаг" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic Extended" #~ msgstr "Расширенный набор символов эфиопского письма" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic Extended-A" #~ msgstr "Кириллица (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Supplemental Punctuation" #~ msgstr "Дополнительные знаки пунктуации" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Radicals Supplement" #~ msgstr "Дополнительные иероглифические ключи ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kangxi Radicals" #~ msgstr "Иероглифические ключи словаря Канси" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ideographic Description Characters" #~ msgstr "Символы описания иероглифов" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Symbols and Punctuation" #~ msgstr "Символы и пунктуация ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hiragana" #~ msgstr "Хирагана" #~ msgctxt "KCharselect unicode block name" #~ msgid "Katakana" #~ msgstr "Катакана" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bopomofo" #~ msgstr "Бопомофо" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Compatibility Jamo" #~ msgstr "Чамо, комбинируемое с хангылем" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kanbun" #~ msgstr "Канбун" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bopomofo Extended" #~ msgstr "Расширенный набор символов бопомофо" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Strokes" #~ msgstr "Черты ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Katakana Phonetic Extensions" #~ msgstr "Фонетические расширения катаканы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Enclosed CJK Letters and Months" #~ msgstr "Вложенные буквы и месяцы ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Compatibility" #~ msgstr "Знаки совместимости ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Unified Ideographs Extension A" #~ msgstr "Унифицированные иероглифы ККЯ (расширение А)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Yijing Hexagram Symbols" #~ msgstr "Гексаграммы Ицзин" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Unified Ideographs" #~ msgstr "Унифицированные иероглифы ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Yi Syllables" #~ msgstr "Слоги письма и" #~ msgctxt "KCharselect unicode block name" #~ msgid "Yi Radicals" #~ msgstr "Иероглифические ключи письма и" #~ msgctxt "KCharselect unicode block name" #~ msgid "Lisu" #~ msgstr "Письменность лису" #~ msgctxt "KCharselect unicode block name" #~ msgid "Vai" #~ msgstr "Письменность ваи" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cyrillic Extended-B" #~ msgstr "Кириллица (расширение B)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Bamum" #~ msgstr "Письменность бамум" #~ msgctxt "KCharselect unicode block name" #~ msgid "Modifier Tone Letters" #~ msgstr "Символы изменения тона" #~ msgctxt "KCharselect unicode block name" #~ msgid "Latin Extended-D" #~ msgstr "Расширенная латиница-D" #~ msgctxt "KCharselect unicode block name" #~ msgid "Syloti Nagri" #~ msgstr "Силоти Нагри" #~ msgctxt "KCharselect unicode block name" #~ msgid "Common Indic Number Forms" #~ msgstr "Индийские числовые знаки" #~ msgctxt "KCharselect unicode block name" #~ msgid "Phags-pa" #~ msgstr "Квадратное письмо Пагба-ламы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Saurashtra" #~ msgstr "Письменность саураштра" #~ msgctxt "KCharselect unicode block name" #~ msgid "Devanagari Extended" #~ msgstr "Деванагари (расширение)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Kayah Li" #~ msgstr "Письменность кайя" #~ msgctxt "KCharselect unicode block name" #~ msgid "Rejang" #~ msgstr "Письменность реджанг" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Jamo Extended-A" #~ msgstr "Хангыль (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Javanese" #~ msgstr "Яванская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Cham" #~ msgstr "Чамская письменность" #~ msgctxt "KCharselect unicode block name" #~ msgid "Myanmar Extended-A" #~ msgstr "Мьянманская письменность (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Tai Viet" #~ msgstr "Письменность Тай Вьет" #~ msgctxt "KCharselect unicode block name" #~ msgid "Ethiopic Extended-A" #~ msgstr "Эфиопская письменность (расширение A)" #~ msgctxt "KCharselect unicode block name" #~ msgid "Meetei Mayek" #~ msgstr "Письменность манипури" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Syllables" #~ msgstr "Слоги хангыля" #~ msgctxt "KCharselect unicode block name" #~ msgid "Hangul Jamo Extended-B" #~ msgstr "Хангыль (расширение B)" #~ msgctxt "KCharselect unicode block name" #~ msgid "High Surrogates" #~ msgstr "Верхняя часть суррогатных пар" #~ msgctxt "KCharselect unicode block name" #~ msgid "High Private Use Surrogates" #~ msgstr "Верхняя часть суррогатных пар для частного использования" #~ msgctxt "KCharselect unicode block name" #~ msgid "Low Surrogates" #~ msgstr "Нижняя часть суррогатных пар" #~ msgctxt "KCharselect unicode block name" #~ msgid "Private Use Area" #~ msgstr "Область для частного использования" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Compatibility Ideographs" #~ msgstr "Совместимые иероглифы ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Alphabetic Presentation Forms" #~ msgstr "Алфавитные формы представления" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic Presentation Forms-A" #~ msgstr "Формы представления арабских букв-A" #~ msgctxt "KCharselect unicode block name" #~ msgid "Variation Selectors" #~ msgstr "Селекторы вариантов начертания" #~ msgctxt "KCharselect unicode block name" #~ msgid "Vertical Forms" #~ msgstr "Вертикальные формы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Combining Half Marks" #~ msgstr "Комбинируемые половинки символов" #~ msgctxt "KCharselect unicode block name" #~ msgid "CJK Compatibility Forms" #~ msgstr "Формы совместимости ККЯ" #~ msgctxt "KCharselect unicode block name" #~ msgid "Small Form Variants" #~ msgstr "Варианты малого размера" #~ msgctxt "KCharselect unicode block name" #~ msgid "Arabic Presentation Forms-B" #~ msgstr "Формы представления арабских букв-B" #~ msgctxt "KCharselect unicode block name" #~ msgid "Halfwidth and Fullwidth Forms" #~ msgstr "Полуширинные и полноширинные формы" #~ msgctxt "KCharselect unicode block name" #~ msgid "Specials" #~ msgstr "Специальные символы" #~ msgid "Enter a search term or character here" #~ msgstr "Введите критерий поиска или символ" #~ msgctxt "Goes to previous character" #~ msgid "Previous in History" #~ msgstr "Предыдущий символ в списке" #~ msgid "Previous Character in History" #~ msgstr "Предыдущий символ в списке" #~ msgctxt "Goes to next character" #~ msgid "Next in History" #~ msgstr "Следующий символ в списке" #~ msgid "Next Character in History" #~ msgstr "Следующий символ в списке" #~ msgid "Select a category" #~ msgstr "Выбор группы" #~ msgid "Select a block to be displayed" #~ msgstr "Выбор блока" #~ msgid "Set font" #~ msgstr "Задать шрифт" #~ msgid "Set font size" #~ msgstr "Задать размер шрифта" #~ msgid "Character:" #~ msgstr "Символ:" #~ msgid "Name: " #~ msgstr "Имя: " #~ msgid "Annotations and Cross References" #~ msgstr "Аннотации и перекрёстные ссылки" #~ msgid "Alias names:" #~ msgstr "Другие представления:" #~ msgid "Notes:" #~ msgstr "Примечания:" #~ msgid "See also:" #~ msgstr "См. также:" #~ msgid "Equivalents:" #~ msgstr "Эквиваленты:" #~ msgid "Approximate equivalents:" #~ msgstr "Приблизительные эквиваленты:" #~ msgid "CJK Ideograph Information" #~ msgstr "Сведение об иероглифе CJK" #~ msgid "Definition in English: " #~ msgstr "Определение на английском: " #~ msgid "Mandarin Pronunciation: " #~ msgstr "Произношение на мандаринском наречии: " #~ msgid "Cantonese Pronunciation: " #~ msgstr "Произношение на кантонском наречии: " #~ msgid "Japanese On Pronunciation: " #~ msgstr "Произношение на онъёми: " #~ msgid "Japanese Kun Pronunciation: " #~ msgstr "Произношение на кунъёми: " #~ msgid "Tang Pronunciation: " #~ msgstr "Произношение Танг: " #~ msgid "Korean Pronunciation: " #~ msgstr "Произношение на корейском: " #~ msgid "General Character Properties" #~ msgstr "Общие сведения о символе" #~ msgid "Block: " #~ msgstr "Блок: " #~ msgid "Unicode category: " #~ msgstr "Категория Юникода: " #~ msgid "Various Useful Representations" #~ msgstr "Полезные представления" #~ msgid "UTF-8:" #~ msgstr "UTF-8:" #~ msgid "UTF-16: " #~ msgstr "UTF-16: " #~ msgid "C octal escaped UTF-8: " #~ msgstr "Восьмеричный код в UTF-8 на языке C: " #~ msgid "XML decimal entity:" #~ msgstr "Десятичное представление в XML:" #~ msgid "Unicode code point:" #~ msgstr "Код Юникода: " #~ msgctxt "Character" #~ msgid "In decimal:" #~ msgstr "В десятичном виде:" #~ msgid "" #~ msgstr "<заменитель в верхнем регистре>" #~ msgid "" #~ msgstr "<пользовательский заменитель в верхнем регистре>" #~ msgid "" #~ msgstr "<заменитель в нижнем регистре>" #~ msgid "" #~ msgstr "<пользовательский символ>" #~ msgid "" #~ msgstr "<не присвоен>" #~ msgid "Non-printable" #~ msgstr "Непечатный" #~ msgid "Other, Control" #~ msgstr "разное, управляющий" #~ msgid "Other, Format" #~ msgstr "разное, форматирующий" #~ msgid "Other, Not Assigned" #~ msgstr "разное, не присвоенный" #~ msgid "Other, Private Use" #~ msgstr "разное, пользовательский" #~ msgid "Other, Surrogate" #~ msgstr "разное, заменитель" #~ msgid "Letter, Lowercase" #~ msgstr "буква в нижнем регистре" #~ msgid "Letter, Modifier" #~ msgstr "буква, модификатор" #~ msgid "Letter, Other" #~ msgstr "буква, разное" #~ msgid "Letter, Titlecase" #~ msgstr "буква, для заголовков" #~ msgid "Letter, Uppercase" #~ msgstr "буква (верхний регистр)" #~ msgid "Mark, Spacing Combining" #~ msgstr "отметка, промежуток" #~ msgid "Mark, Enclosing" #~ msgstr "отметка, символ в скобках" #~ msgid "Mark, Non-Spacing" #~ msgstr "отметка, без промежутков" #~ msgid "Number, Decimal Digit" #~ msgstr "число, десятичная цифра" #~ msgid "Number, Letter" #~ msgstr "число, буква" #~ msgid "Number, Other" #~ msgstr "число, разное" #~ msgid "Punctuation, Connector" #~ msgstr "знак пунктуации, соединитель" #~ msgid "Punctuation, Dash" #~ msgstr "знак пунктуации, тире" #~ msgid "Punctuation, Close" #~ msgstr "закрывающий знак пунктуации" #~ msgid "Punctuation, Final Quote" #~ msgstr "знак пунктуации, закрывающая кавычка" #~ msgid "Punctuation, Initial Quote" #~ msgstr "знак пунктуации, открывающая кавычка" #~ msgid "Punctuation, Other" #~ msgstr "знак пунктуации, разное" #~ msgid "Punctuation, Open" #~ msgstr "открывающий знак пунктуации" #~ msgid "Symbol, Currency" #~ msgstr "символ валюты" #~ msgid "Symbol, Modifier" #~ msgstr "символ, модификатор" #~ msgid "Symbol, Math" #~ msgstr "математический символ" #~ msgid "Symbol, Other" #~ msgstr "символ, разное" #~ msgid "Separator, Line" #~ msgstr "разделитель строки" #~ msgid "Separator, Paragraph" #~ msgstr "разделитель абзаца" #~ msgid "Separator, Space" #~ msgstr "пробел" #~ msgid "You will be asked to authenticate before saving" #~ msgstr "Перед сохранением настроек нужно будет подтвердить вход в систему" #~ msgid "You are not allowed to save the configuration" #~ msgstr "У вас нет прав на изменение этих настроек" #~ msgctxt "@option next year" #~ msgid "Next Year" #~ msgstr "Следующий год" #~ msgctxt "@option next month" #~ msgid "Next Month" #~ msgstr "Следующий месяц" #~ msgctxt "@option next week" #~ msgid "Next Week" #~ msgstr "Следующая неделя" #~ msgctxt "@option tomorrow" #~ msgid "Tomorrow" #~ msgstr "Завтра" #~ msgctxt "@option today" #~ msgid "Today" #~ msgstr "Сегодня" #~ msgctxt "@option yesterday" #~ msgid "Yesterday" #~ msgstr "Вчера" #~ msgctxt "@option last week" #~ msgid "Last Week" #~ msgstr "Неделю назад" #~ msgctxt "@option last month" #~ msgid "Last Month" #~ msgstr "Месяц назад" #~ msgctxt "@option last year" #~ msgid "Last Year" #~ msgstr "Год назад" #~ msgctxt "@option do not specify a date" #~ msgid "No Date" #~ msgstr "Нет даты" #~ msgctxt "@info" #~ msgid "The date you entered is invalid" #~ msgstr "Введена недопустимая дата" #~ msgctxt "@info" #~ msgid "Date cannot be earlier than %1" #~ msgstr "Дата не может быть раньше %1" #~ msgctxt "@info" #~ msgid "Date cannot be later than %1" #~ msgstr "Дата не может быть позднее %1" #~ msgid "Week %1" #~ msgstr "Неделя %1" #~ msgid "Next year" #~ msgstr "Следующий год" #~ msgid "Previous year" #~ msgstr "Предыдущий год" #~ msgid "Next month" #~ msgstr "Следующий месяц" #~ msgid "Previous month" #~ msgstr "Предыдущий месяц" #~ msgid "Select a week" #~ msgstr "Выберите неделю" #~ msgid "Select a month" #~ msgstr "Выберите месяц" #~ msgid "Select a year" #~ msgstr "Выберите год" #~ msgid "Select the current day" #~ msgstr "Выбрать текущий день" #~ msgctxt "UTC time zone" #~ msgid "UTC" #~ msgstr "UTC" #~ msgctxt "No specific time zone" #~ msgid "Floating" #~ msgstr "Не определён" #~ msgctxt "@info" #~ msgid "" #~ "The entered date and time is before the minimum allowed date and time." #~ msgstr "" #~ "Введённые дата и время раньше минимальных допустимых даты и времени." #~ msgctxt "@info" #~ msgid "" #~ "The entered date and time is after the maximum allowed date and time." #~ msgstr "" #~ "Введённые дата и время позже максимальных допустимых даты и времени." #~ msgid "&Add" #~ msgstr "Доб&авить" #~ msgid "&Remove" #~ msgstr "&Удалить" #~ msgid "Move &Up" #~ msgstr "Переместить вв&ерх" #~ msgid "Move &Down" #~ msgstr "Переместить &вниз" #~ msgid "Clear &History" #~ msgstr "Очистить &хронологию" #~ msgid "No further items in the history." #~ msgstr "Нет больше элементов в списке." #~ msgid "without name" #~ msgstr "без имени" #~ msgctxt "Italic placeholder text in line edits: 0 no, 1 yes" #~ msgid "1" #~ msgstr "1" #~ msgctxt "@action:button Clear current text in the line edit" #~ msgid "Clear text" #~ msgstr "Очистить текст" #~ msgctxt "@title:menu" #~ msgid "Text Completion" #~ msgstr "Дополнение текста" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "None" #~ msgstr "Нет" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Manual" #~ msgstr "Вручную" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Automatic" #~ msgstr "Автоматически" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Dropdown List" #~ msgstr "Из выпадающего списка" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Short Automatic" #~ msgstr "Полуавтоматически" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Dropdown List && Automatic" #~ msgstr "Из выпадающего списка и автоматически" #~ msgctxt "@item:inmenu Text Completion" #~ msgid "Default" #~ msgstr "По умолчанию" #~ msgid "Image Operations" #~ msgstr "Операции с изображением" #~ msgid "&Rotate Clockwise" #~ msgstr "&Повернуть по часовой стрелке" #~ msgid "Rotate &Counterclockwise" #~ msgstr "П&овернуть против часовой стрелки" #~ msgctxt "@action" #~ msgid "Text &Color..." #~ msgstr "&Цвет текста..." #~ msgctxt "@label stroke color" #~ msgid "Color" #~ msgstr "Цвет" #~ msgctxt "@action" #~ msgid "Text &Highlight..." #~ msgstr "Подсветка текста..." #~ msgctxt "@action" #~ msgid "&Font" #~ msgstr "&Шрифт" #~ msgctxt "@action" #~ msgid "Font &Size" #~ msgstr "&Размер шрифта" #~ msgctxt "@action boldify selected text" #~ msgid "&Bold" #~ msgstr "Полу&жирный" #~ msgctxt "@action italicize selected text" #~ msgid "&Italic" #~ msgstr "&Курсив" #~ msgctxt "@action underline selected text" #~ msgid "&Underline" #~ msgstr "&Подчёркнутый" #~ msgctxt "@action" #~ msgid "&Strike Out" #~ msgstr "П&еречёркнутый" #~ msgctxt "@action" #~ msgid "Align &Left" #~ msgstr "По &левому краю" #~ msgctxt "@label left justify" #~ msgid "Left" #~ msgstr "По левому краю" #~ msgctxt "@action" #~ msgid "Align &Center" #~ msgstr "По &центру" #~ msgctxt "@label center justify" #~ msgid "Center" #~ msgstr "По центру" #~ msgctxt "@action" #~ msgid "Align &Right" #~ msgstr "По &правому краю" #~ msgctxt "@label right justify" #~ msgid "Right" #~ msgstr "По правому краю" #~ msgctxt "@action" #~ msgid "&Justify" #~ msgstr "По &ширине" #~ msgctxt "@label justify fill" #~ msgid "Justify" #~ msgstr "По ширине" #~ msgctxt "@action" #~ msgid "Left-to-Right" #~ msgstr "Письмо слева направо" #~ msgctxt "@label left-to-right" #~ msgid "Left-to-Right" #~ msgstr "Слева направо" #~ msgctxt "@action" #~ msgid "Right-to-Left" #~ msgstr "Письмо справа налево" #~ msgctxt "@label right-to-left" #~ msgid "Right-to-Left" #~ msgstr "Справа налево" #~ msgctxt "@title:menu" #~ msgid "List Style" #~ msgstr "Стиль списка" #~ msgctxt "@item:inmenu no list style" #~ msgid "None" #~ msgstr "Нет" #~ msgctxt "@item:inmenu disc list style" #~ msgid "Disc" #~ msgstr "Диски" #~ msgctxt "@item:inmenu circle list style" #~ msgid "Circle" #~ msgstr "Кружки" #~ msgctxt "@item:inmenu square list style" #~ msgid "Square" #~ msgstr "Квадраты" #~ msgctxt "@item:inmenu numbered lists" #~ msgid "123" #~ msgstr "123" #~ msgctxt "@item:inmenu lowercase abc lists" #~ msgid "abc" #~ msgstr "abc" #~ msgctxt "@item:inmenu uppercase abc lists" #~ msgid "ABC" #~ msgstr "ABC" #~ msgctxt "@item:inmenu lower case roman numerals" #~ msgid "i ii iii" #~ msgstr "i ii iii" #~ msgctxt "@item:inmenu upper case roman numerals" #~ msgid "I II III" #~ msgstr "I II III" #~ msgctxt "@action" #~ msgid "Increase Indent" #~ msgstr "Увеличить отступ" #~ msgctxt "@action" #~ msgid "Decrease Indent" #~ msgstr "Уменьшить отступ" #~ msgctxt "@action" #~ msgid "Insert Rule Line" #~ msgstr "Вставить горизонтальную линию" #~ msgctxt "@action" #~ msgid "Link" #~ msgstr "Ссылка" #~ msgctxt "@action" #~ msgid "Format Painter" #~ msgstr "Преобразовать в текст с форматированием" #~ msgctxt "@action" #~ msgid "To Plain Text" #~ msgstr "Преобразовать в обычный текст" #~ msgctxt "@action" #~ msgid "Subscript" #~ msgstr "Нижний индекс" #~ msgctxt "@action" #~ msgid "Superscript" #~ msgstr "Верхний индекс" #~ msgid "&Copy Full Text" #~ msgstr "&Копировать весь текст" #~ msgid "Nothing to spell check." #~ msgstr "Нечего проверять." #~ msgid "Speak Text" #~ msgstr "Зачитать текст" #~ msgid "Starting Jovie Text-to-Speech Service Failed" #~ msgstr "Не удалось запустить службу синтеза речи Jovie" #~ msgid "No suggestions for %1" #~ msgstr "Нет вариантов для %1" #~ msgid "Ignore" #~ msgstr "Пропустить" #~ msgid "Add to Dictionary" #~ msgstr "Добавить в словарь" #~ msgctxt "@info" #~ msgid "The time you entered is invalid" #~ msgstr "Введено недопустимое время" #~ msgctxt "@info" #~ msgid "Time cannot be earlier than %1" #~ msgstr "Время не может быть раньше %1" #~ msgctxt "@info" #~ msgid "Time cannot be later than %1" #~ msgstr "Время не может быть позднее %1" #~ msgctxt "Define an area in the time zone, like a town area" #~ msgid "Area" #~ msgstr "Регион" #~ msgctxt "Time zone" #~ msgid "Region" #~ msgstr "Область" #~ msgid "Comment" #~ msgstr "Комментарий" #~ msgid "Desktop %1" #~ msgstr "Рабочий стол %1" #~ msgid "Builds Qt widget plugins from an ini style description file." #~ msgstr "Создаёт расширения виджетов Qt из файла описания стилей." #~ msgid "Input file" #~ msgstr "Файл ввода" #~ msgid "Output file" #~ msgstr "Файл вывода" #~ msgid "Name of the plugin class to generate" #~ msgstr "Имя создаваемого класса расширения" #~ msgid "Default widget group name to display in designer" #~ msgstr "Имя группы виджетов по умолчанию для показа в дизайнере" #~ msgid "makekdewidgets" #~ msgstr "makekdewidgets" #~ msgid "(C) 2004-2005 Ian Reinhart Geiser" #~ msgstr "© Ian Reinhart Geiser, 2004-2005" #~ msgid "Ian Reinhart Geiser" #~ msgstr "Ian Reinhart Geiser" #~ msgid "Daniel Molkentin" #~ msgstr "Daniel Molkentin" #~ msgid "Call Stack" #~ msgstr "Стек вызовов" #~ msgid "Call" #~ msgstr "Вызов" #~ msgid "Line" #~ msgstr "Строка" #~ msgid "Console" #~ msgstr "Консоль" #~ msgid "Enter" #~ msgstr "Enter" #~ msgid "" #~ "Unable to find the Kate editor component;\n" #~ "please check your KDE installation." #~ msgstr "" #~ "Не удалось найти компонент текстового редактора Kate.\n" #~ "Проверьте правильность установки KDE." #~ msgid "Breakpoint" #~ msgstr "Точка останова" #~ msgid "JavaScript Debugger" #~ msgstr "Отладчик JavaScript" #~ msgid "&Break at Next Statement" #~ msgstr "П&рерывание на следующем операторе" #~ msgid "Break at Next" #~ msgstr "Прервать на следующем операторе" #~ msgid "Continue" #~ msgstr "Продолжить" #~ msgid "Step Over" #~ msgstr "Перейти на следующую строку" #~ msgid "Step Into" #~ msgstr "Войти в функцию" #~ msgid "Step Out" #~ msgstr "Выполнить функцию" #~ msgid "Reindent Sources" #~ msgstr "Выровнять отступы" #~ msgid "Report Exceptions" #~ msgstr "Сообщить об ошибке" #~ msgid "&Debug" #~ msgstr "&Отладка" #~ msgid "Close source" #~ msgstr "Закрыть исходный код" #~ msgid "Ready" #~ msgstr "Готово" #~ msgid "Parse error at %1 line %2" #~ msgstr "Ошибка разбора %1 в строке %2" #~ msgid "" #~ "An error occurred while attempting to run a script on this page.\n" #~ "\n" #~ "%1 line %2:\n" #~ "%3" #~ msgstr "" #~ "Произошла ошибка при попытке выполнить скрипт на этой странице.\n" #~ "\n" #~ "%1 строка %2:\n" #~ "%3" #~ msgid "" #~ "Do not know where to evaluate the expression. Please pause a script or " #~ "open a source file." #~ msgstr "" #~ "Неизвестно, в чём выполнять выражение. Остановите выполнение скрипта или " #~ "откройте файл с исходным кодом." #~ msgid "Evaluation threw an exception %1" #~ msgstr "Появление исключения %1 при выполнении" #~ msgid "JavaScript Error" #~ msgstr "Ошибка JavaScript" #~ msgid "&Do not show this message again" #~ msgstr "&Не выводить больше это сообщение" #~ msgid "Local Variables" #~ msgstr "Локальные переменные" #~ msgid "Reference" #~ msgstr "Ссылка" #~ msgid "Loaded Scripts" #~ msgstr "Загруженные скрипты" #~ msgid "" #~ "A script on this page is causing KHTML to freeze. If it continues to run, " #~ "other applications may become less responsive.\n" #~ "Do you want to stop the script?" #~ msgstr "" #~ "Сценарий на этой странице привёл к зависанию KHTML. Если он продолжит " #~ "работать, другие приложения будут отзываться медленнее.\n" #~ "Прервать работу сценария?" #~ msgid "JavaScript" #~ msgstr "JavaScript" #~ msgid "&Stop Script" #~ msgstr "&Остановить сценарий" #~ msgid "Confirmation: JavaScript Popup" #~ msgstr "Подтверждение: Всплывающее окно Javascript" #~ msgid "" #~ "This site is submitting a form which will open up a new browser window " #~ "via JavaScript.\n" #~ "Do you want to allow the form to be submitted?" #~ msgstr "" #~ "Этот сайт пытается отправить форму, что приведёт к открытию нового окна " #~ "браузера с помощью JavaScript.\n" #~ "Разрешить?" #~ msgid "" #~ "This site is submitting a form which will open

    %1

    in a new " #~ "browser window via JavaScript.
    Do you want to allow the form to be " #~ "submitted?    " #~ msgstr "" #~ " Этот сайт пытается отправить форму, что приведёт к открытию

    %1 в новом окне браузера с помощью JavaScript.
    Разрешить?" #~ msgid "Allow" #~ msgstr "Разрешить" #~ msgid "Do Not Allow" #~ msgstr "Запретить" #~ msgid "" #~ "This site is requesting to open up a new browser window via JavaScript.\n" #~ "Do you want to allow this?" #~ msgstr "" #~ "Этот сайт пытается открыть новое окно с использованием Javascript.\n" #~ "Разрешить открыть окно?" #~ msgid "" #~ "This site is requesting to open

    %1

    in a new browser window via " #~ "JavaScript.
    Do you want to allow this?    " #~ msgstr "" #~ "Этот сайт пытается открыть

    %1

    в новом окне браузера с помощью " #~ "JavaScript.
    Разрешить?    " #~ msgid "Close window?" #~ msgstr "Закрыть окно?" #~ msgid "Confirmation Required" #~ msgstr "Требуется подтверждение" #~ msgid "" #~ "Do you want a bookmark pointing to the location \"%1\" to be added to " #~ "your collection?" #~ msgstr "Добавить закладку на адрес «%1» в вашу коллекцию?" #~ msgid "" #~ "Do you want a bookmark pointing to the location \"%1\" titled \"%2\" to " #~ "be added to your collection?" #~ msgstr "Добавить закладку на адрес «%1» с заголовком «%2» в вашу коллекцию?" #~ msgid "JavaScript Attempted Bookmark Insert" #~ msgstr "JavaScript пытается добавить закладку" #~ msgid "Insert" #~ msgstr "Вставить" #~ msgid "Disallow" #~ msgstr "Запретить" #~ msgid "" #~ "The following files will not be uploaded because they could not be " #~ "found.\n" #~ "Do you want to continue?" #~ msgstr "" #~ "Указанные файлы не могут быть загружены, поскольку они не найдены.\n" #~ "Продолжить?" #~ msgid "Submit Confirmation" #~ msgstr "Подтверждение отправки" #~ msgid "&Submit Anyway" #~ msgstr "&Отправить" #~ msgid "" #~ "You are about to transfer the following files from your local computer to " #~ "the Internet.\n" #~ "Do you really want to continue?" #~ msgstr "" #~ "Была запрошена передача следующих файлов с этого компьютера в Интернет.\n" #~ "Продолжить?" #~ msgid "Send Confirmation" #~ msgstr "Подтверждение передачи" #~ msgid "&Send File" #~ msgid_plural "&Send Files" #~ msgstr[0] "&Отправить файлы" #~ msgstr[1] "&Отправить файлы" #~ msgstr[2] "&Отправить файлы" #~ msgstr[3] "&Отправить файл" #~ msgid "Submit" #~ msgstr "Отправить" #~ msgid "Key Generator" #~ msgstr "Генератор ключа" #~ msgid "" #~ "No plugin found for '%1'.\n" #~ "Do you want to download one from %2?" #~ msgstr "" #~ "Не обнаружено расширение для «%1».\n" #~ "Загрузить его с адреса %2?" #~ msgid "Missing Plugin" #~ msgstr "Отсутствует расширение" #~ msgid "Download" #~ msgstr "Загрузить" #~ msgid "Do Not Download" #~ msgstr "Не загружать" #~ msgid "This is a searchable index. Enter search keywords: " #~ msgstr "Это индекс с возможностью поиска. Введите ключевые слова: " #~ msgid "Document Information" #~ msgstr "Сведения о документе" #~ msgctxt "@title:group Document information" #~ msgid "General" #~ msgstr "Главное" #~ msgid "URL:" #~ msgstr "Ссылка:" #~ msgid "Title:" #~ msgstr "Заголовок:" #~ msgid "Last modified:" #~ msgstr "Последнее изменение:" #~ msgid "Document encoding:" #~ msgstr "Кодировка документа:" #~ msgid "Rendering mode:" #~ msgstr "Режим показа HTML:" #~ msgid "HTTP Headers" #~ msgstr "Заголовки HTTP" #~ msgid "Property" #~ msgstr "Параметр" #~ msgid "Initializing Applet \"%1\"..." #~ msgstr "Открывается аплет «%1»..." #~ msgid "Starting Applet \"%1\"..." #~ msgstr "Запускается аплет «%1»..." #~ msgid "Applet \"%1\" started" #~ msgstr "Аплет «%1» запущен" #~ msgid "Applet \"%1\" stopped" #~ msgstr "Аплет «%1» остановлен" #~ msgid "Loading Applet" #~ msgstr "Загрузка аплета" #~ msgid "Error: java executable not found" #~ msgstr "Ошибка: не найдена программа java" #~ msgid "Signed by (validation: %1)" #~ msgstr "Подписано (подлинность: %1)" #~ msgid "Certificate (validation: %1)" #~ msgstr "Сертификат (подлинность: %1) " #~ msgid "Security Alert" #~ msgstr "Извещение системы безопасности" #~ msgid "Do you grant Java applet with certificate(s):" #~ msgstr "Запускать аплеты Java с сертификатами:" #~ msgid "the following permission" #~ msgstr "следующие права" #~ msgid "&Reject All" #~ msgstr "&Отклонить все" #~ msgid "&Grant All" #~ msgstr "&Принять все" #~ msgid "Applet Parameters" #~ msgstr "Параметры аплета" #~ msgid "Parameter" #~ msgstr "Параметр" #~ msgid "Class" #~ msgstr "Класс" #~ msgid "Base URL" #~ msgstr "Базовый URL" #~ msgid "Archives" #~ msgstr "Архивы" #~ msgid "KDE Java Applet Plugin" #~ msgstr "Поддержка аплетов Java для среды KDE" #~ msgid "HTML Toolbar" #~ msgstr "Панель инструментов HTML" #~ msgid "&Copy Text" #~ msgstr "&Копировать текст" #~ msgid "Open '%1'" #~ msgstr "Открыть %1" #~ msgid "&Copy Email Address" #~ msgstr "Скопировать &адрес электронной почты" #~ msgid "&Save Link As..." #~ msgstr "Сохранить сс&ылку как..." #~ msgid "&Copy Link Address" #~ msgstr "С&копировать адрес ссылки" #~ msgctxt "@title:menu HTML frame/iframe" #~ msgid "Frame" #~ msgstr "Фрейм" #~ msgid "Open in New &Window" #~ msgstr "Открыть в &новом окне" #~ msgid "Open in &This Window" #~ msgstr "Открыть в &текущем окне" #~ msgid "Open in &New Tab" #~ msgstr "Открыть в новой &вкладке" #~ msgid "Reload Frame" #~ msgstr "Обновить фрейм" #~ msgid "Print Frame..." #~ msgstr "Печать фрейма..." #~ msgid "Save &Frame As..." #~ msgstr "Сохранить &фрейм как..." #~ msgid "View Frame Source" #~ msgstr "Просмотреть исходный текст фрейма" #~ msgid "View Frame Information" #~ msgstr "Сведения о фрейме" #~ msgid "Block IFrame..." #~ msgstr "Заблокировать IFrame..." #~ msgid "Save Image As..." #~ msgstr "Сохранить изображение как..." #~ msgid "Send Image..." #~ msgstr "Отправить изображение..." #~ msgid "Copy Image" #~ msgstr "Скопировать изображение" #~ msgid "Copy Image Location" #~ msgstr "Скопировать ссылку на изображение" #~ msgid "View Image (%1)" #~ msgstr "Просмотр изображения (%1)" #~ msgid "Block Image..." #~ msgstr "Заблокировать изображение..." #~ msgid "Block Images From %1" #~ msgstr "Заблокировать изображения от %1" #~ msgid "Stop Animations" #~ msgstr "Остановить анимацию" #~ msgid "Search for '%1' with %2" #~ msgstr "Поиск «%1» в %2" #~ msgid "Search for '%1' with" #~ msgstr "Поиск «%1» в" #~ msgid "Save Link As" #~ msgstr "Сохранить конечный документ как" #~ msgid "Save Image As" #~ msgstr "Сохранить изображение как" #~ msgid "Add URL to Filter" #~ msgstr "Добавление адреса в фильтр" #~ msgid "Enter the URL:" #~ msgstr "Введите адрес:" #~ msgid "" #~ "A file named \"%1\" already exists. Are you sure you want to overwrite it?" #~ msgstr "Файл с именем «%1» уже существует. Заменить его?" #~ msgid "Overwrite File?" #~ msgstr "Заменить файл?" #~ msgid "Overwrite" #~ msgstr "Заменить" #~ msgid "The Download Manager (%1) could not be found in your $PATH " #~ msgstr "Не удалось найти программу менеджера загрузки (%1) в $PATH." #~ msgid "" #~ "Try to reinstall it \n" #~ "\n" #~ "The integration with Konqueror will be disabled." #~ msgstr "" #~ "Попробуйте переустановить программу.\n" #~ "\n" #~ "Интеграция с Konqueror будет выключена." #~ msgid "Default Font Size (100%)" #~ msgstr "Размер шрифта по умолчанию (100%)" #~ msgid "KHTML" #~ msgstr "KHTML" #~ msgid "Embeddable HTML component" #~ msgstr "Встраиваемый компонент для показа HTML" #~ msgid "Lars Knoll" #~ msgstr "Lars Knoll" #~ msgid "Antti Koivisto" #~ msgstr "Antti Koivisto" #~ msgid "Dirk Mueller" #~ msgstr "Dirk Mueller" #~ msgid "Peter Kelly" #~ msgstr "Peter Kelly" #~ msgid "Torben Weis" #~ msgstr "Torben Weis" #~ msgid "Martin Jones" #~ msgstr "Martin Jones" #~ msgid "Simon Hausmann" #~ msgstr "Simon Hausmann" #~ msgid "Tobias Anton" #~ msgstr "Tobias Anton" #~ msgid "View Do&cument Source" #~ msgstr "Просмотреть исходный текст до&кумента" #~ msgid "View Document Information" #~ msgstr "Просмотреть сведения о документе" #~ msgid "Save &Background Image As..." #~ msgstr "Сохранить фоновое &изображение как..." #~ msgid "SSL" #~ msgstr "SSL" #~ msgid "Print Rendering Tree to STDOUT" #~ msgstr "Вывести дерево прорисовки на STDOUT" #~ msgid "Print DOM Tree to STDOUT" #~ msgstr "Вывести дерево DOM на STDOUT" #~ msgid "Print frame tree to STDOUT" #~ msgstr "Вывести дерево фреймов на STDOUT" #~ msgid "Stop Animated Images" #~ msgstr "Остановить анимацию рисунков" #~ msgid "Set &Encoding" #~ msgstr "&Кодировка..." #~ msgid "Use S&tylesheet" #~ msgstr "Использовать таблицу &стилей" #~ msgid "Enlarge Font" #~ msgstr "Увеличить шрифт" #~ msgid "" #~ "Enlarge Font

    Make the font in this window bigger. Click " #~ "and hold down the mouse button for a menu with all available font sizes." #~ msgstr "" #~ "Увеличить шрифт

    Увеличить шрифт в этом окне. Нажмите и " #~ "удерживайте кнопку мыши для показа меню с доступными размерами шрифта." #~ msgid "Shrink Font" #~ msgstr "Уменьшить шрифт" #~ msgid "" #~ "Shrink Font

    Make the font in this window smaller. Click " #~ "and hold down the mouse button for a menu with all available font sizes." #~ msgstr "" #~ "Уменьшить шрифт

    Уменьшить шрифт в этом окне. Нажмите и " #~ "удерживайте кнопку мыши для показа меню с доступными размерами шрифта." #~ msgid "" #~ "Find text

    Shows a dialog that allows you to find text on " #~ "the displayed page.    " #~ msgstr "" #~ "Найти текст

    Диалог поиска текста на текущей странице.    " #~ msgid "" #~ "Find next

    Find the next occurrence of the text that you " #~ "have found using the Find Text function.    " #~ msgstr "" #~ "Найти далее

    Поиск следующего вхождения текста, указанного " #~ "в поле Найти текст.    " #~ msgid "" #~ "Find previous

    Find the previous occurrence of the text " #~ "that you have found using the Find Text function.    " #~ msgstr "" #~ "Найти предыдущее

    Поиск предыдущего вхождения текста, " #~ "указанного в поле Найти текст.    " #~ msgid "Find Text as You Type" #~ msgstr "Поиск текста по мере набора" #~ msgid "" #~ "This shortcut shows the find bar, for finding text in the displayed page. " #~ "It cancels the effect of \"Find Links as You Type\", which sets the " #~ "\"Find links only\" option." #~ msgstr "" #~ "Эта комбинация клавиш вызывает панель для поиска текста на текущей " #~ "странице. Это отключит функцию поиска ссылок по набору." #~ msgid "Find Links as You Type" #~ msgstr "Поиск ссылок по мере набора" #~ msgid "" #~ "This shortcut shows the find bar, and sets the option \"Find links only\"." #~ msgstr "" #~ "Эта комбинация клавиш вызывает панель для поиска ссылок на текущей " #~ "странице." #~ msgid "" #~ "Print Frame

    Some pages have several frames. To print only " #~ "a single frame, click on it and then use this function.    " #~ msgstr "" #~ "Печать фрейма

    Некоторые страницы могут содержать несколько " #~ "фреймов. Чтобы напечатать только один фрейм, нажмите на нем и используйте " #~ "эту функцию.    " #~ msgid "Toggle Caret Mode" #~ msgstr "Переключи&ть режим вставки/замены" #~ msgid "The fake user-agent '%1' is in use." #~ msgstr "Используется подложный идентификатор браузера «%1»." #~ msgid "This web page contains coding errors." #~ msgstr "Эта веб-страница содержит ошибки кодирования." #~ msgid "&Hide Errors" #~ msgstr "&Скрыть ошибки" #~ msgid "&Disable Error Reporting" #~ msgstr "&Запретить сообщения об ошибках" #~ msgid "Error: %1: %2" #~ msgstr "Ошибка: %1: %2" #~ msgid "Error: node %1: %2" #~ msgstr "Ошибка: узел %1: %2" #~ msgid "Display Images on Page" #~ msgstr "Показать изображения на странице" #~ msgid "Error: %1 - %2" #~ msgstr "Ошибка: %1 — %2" #~ msgid "The requested operation could not be completed" #~ msgstr "Не удалось завершить запрошенную операцию" #~ msgid "Technical Reason: " #~ msgstr "Техническая причина: " #~ msgid "Details of the Request:" #~ msgstr "Подробности запроса:" #~ msgid "URL: %1" #~ msgstr "Адрес URL: %1" #~ msgid "Protocol: %1" #~ msgstr "Протокол: %1" #~ msgid "Date and Time: %1" #~ msgstr "Дата и время: %1" #~ msgid "Additional Information: %1" #~ msgstr "Дополнительная информация: %1" #~ msgid "Description:" #~ msgstr "Описание:" #~ msgid "Possible Causes:" #~ msgstr "Возможные причины:" #~ msgid "Possible Solutions:" #~ msgstr "Возможные решения:" #~ msgid "Page loaded." #~ msgstr "Страница загружена." #~ msgid "%1 Image of %2 loaded." #~ msgid_plural "%1 Images of %2 loaded." #~ msgstr[0] "Загружено изображений: %1 из %2" #~ msgstr[1] "Загружено изображений: %1 из %2" #~ msgstr[2] "Загружено изображений: %1 из %2" #~ msgstr[3] "Загружено изображений: %1 из %2" #~ msgid "Automatic Detection" #~ msgstr "Автоматическое определение" #~ msgid " (In new window)" #~ msgstr " (В новом окне)" #~ msgid "Symbolic Link" #~ msgstr "Символическая ссылка" #~ msgid "%1 (Link)" #~ msgstr "%1 (Ссылка)" #~ msgid "%2 (%1 byte)" #~ msgid_plural "%2 (%1 bytes)" #~ msgstr[0] "%2 (%1 байт)" #~ msgstr[1] "%2 (%1 байта)" #~ msgstr[2] "%2 (%1 байт)" #~ msgstr[3] "%2 (%1 байт)" #~ msgid "%2 (%1 K)" #~ msgstr "%2 (%1 К)" #~ msgid " (In other frame)" #~ msgstr " (В другом фрейме)" #~ msgid "Email to: " #~ msgstr "Написать письмо: " #~ msgid " - Subject: " #~ msgstr " - Тема: " #~ msgid " - CC: " #~ msgstr " - Копия: " #~ msgid " - BCC: " #~ msgstr " - Скрытая копия: " #~ msgid "Save As" #~ msgstr "Сохранить как" #~ msgid "" #~ "This untrusted page links to
    %1.
    Do you want to " #~ "follow the link?    " #~ msgstr "" #~ "Данная непроверенная страница содержит ссылку
    %1.
    Перейти по ссылке?    " #~ msgid "Follow" #~ msgstr "Перейти" #~ msgid "Frame Information" #~ msgstr "Сведения о фрейме" #~ msgid " [Properties]" #~ msgstr " [свойства]" #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" #~ msgid "Quirks" #~ msgstr "Режим совместимости" #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" #~ msgid "Almost standards" #~ msgstr "Почти соответствующий стандартам" #~ msgctxt "HTML rendering mode (see http://en.wikipedia.org/wiki/Quirks_mode)" #~ msgid "Strict" #~ msgstr "Строгое соответствие стандартам" #~ msgid "Save Background Image As" #~ msgstr "Сохранить фоновое изображение..." #~ msgid "The peer SSL certificate chain appears to be corrupt." #~ msgstr "Похоже, цепочка сертификатов повреждена." #~ msgid "Save Frame As" #~ msgstr "Сохранить фрейм..." #~ msgid "&Find in Frame..." #~ msgstr "&Поиск во фрейме..." #~ msgid "" #~ "Warning: This is a secure form but it is attempting to send your data " #~ "back unencrypted.\n" #~ "A third party may be able to intercept and view this information.\n" #~ "Are you sure you wish to continue?" #~ msgstr "" #~ "Внимание: это защищённая форма, но она пытается вернуть ваши данные назад " #~ "в незашифрованном виде.\n" #~ "Третья сторона может перехватить и просмотреть эту информацию.\n" #~ "Продолжить?" #~ msgid "Network Transmission" #~ msgstr "Передача по сети" #~ msgid "&Send Unencrypted" #~ msgstr "&Отправить незашифрованным" #~ msgid "" #~ "Warning: Your data is about to be transmitted across the network " #~ "unencrypted.\n" #~ "Are you sure you wish to continue?" #~ msgstr "" #~ "Внимание: ваши данные будут передаваться по сети в незащищённом виде.\n" #~ "Продолжить?" #~ msgid "" #~ "This site is attempting to submit form data via email.\n" #~ "Do you want to continue?" #~ msgstr "" #~ "Попытка передачи данных формы на сайт по электронной почте.\n" #~ "Действительно хотите продолжить?" #~ msgid "&Send Email" #~ msgstr "&Отправить" #~ msgid "" #~ "The form will be submitted to
    %1
    on your local " #~ "filesystem.
    Do you want to submit the form?    " #~ msgstr "" #~ "Форма будет передана файлу
    %1
    на локальной " #~ "файловой системе.
    Отправить данные формы?    " #~ msgid "" #~ "This site attempted to attach a file from your computer in the form " #~ "submission. The attachment was removed for your protection." #~ msgstr "" #~ "Попытка присоединения локального файла к данным формы для отправки на " #~ "сайт. Ради вашей безопасности приложенный файл был удалён." #~ msgid "(%1/s)" #~ msgstr "(%1/с)" #~ msgid "Security Warning" #~ msgstr "Предупреждение системы безопасности" #~ msgid "Access by untrusted page to
    %1
    denied.    " #~ msgstr "" #~ "Доступ с ненадёжной страницы на
    %1
    запрещён.    " #~ msgid "The wallet '%1' is open and being used for form data and passwords." #~ msgstr "Бумажник «%1» открыт и используется для ввода данных и паролей." #~ msgid "&Close Wallet" #~ msgstr "&Закрыть бумажник" #~ msgid "&Allow storing passwords for this site" #~ msgstr "&Позволить сохранять пароли для этого сайта" #~ msgid "Remove password for form %1" #~ msgstr "Удалить пароль для формы %1" #~ msgid "JavaScript &Debugger" #~ msgstr "Отла&дчик JavaScript" #~ msgid "This page was prevented from opening a new window via JavaScript." #~ msgstr "Сайт пытается открыть новое окно с использованием Javascript." #~ msgid "Popup Window Blocked" #~ msgstr "Заблокировано всплывающее окно" #~ msgid "" #~ "This page has attempted to open a popup window but was blocked.\n" #~ "You can click on this icon in the status bar to control this behavior\n" #~ "or to open the popup." #~ msgstr "" #~ "Заблокировано всплывающее окно, которое пыталась открыть страница.\n" #~ "Этой функцией можно управлять, щёлкая на строке состояния,\n" #~ "чтобы разрешить или запретить всплывающее окно." #~ msgid "&Show Blocked Popup Window" #~ msgid_plural "&Show %1 Blocked Popup Windows" #~ msgstr[0] "По&казать %1 заблокированное всплывающее окно" #~ msgstr[1] "По&казать %1 заблокированных всплывающих окна" #~ msgstr[2] "По&казать %1 заблокированных всплывающих окон" #~ msgstr[3] "По&казать %1 заблокированное всплывающее окно" #~ msgid "Show Blocked Window Passive Popup &Notification" #~ msgstr "&Уведомлять о заблокированных всплывающих окнах" #~ msgid "&Configure JavaScript New Window Policies..." #~ msgstr "&Настроить правила для новых окон JavaScript..." #~ msgid "" #~ "

    'Print images'

    If this checkbox is enabled, " #~ "images contained in the HTML page will be printed. Printing may take " #~ "longer and use more ink or toner.

    If this checkbox is disabled, " #~ "only the text of the HTML page will be printed, without the included " #~ "images. Printing will be faster and use less ink or toner.

    " #~ msgstr "" #~ "

    Печатать изображения

    Если этот флажок " #~ "установлен, изображения на веб-странице будут распечатаны вместе с " #~ "текстом. Однако печататься страница с ними будет больше и будет " #~ "использовано больше чернил или тонера.

    Если флажок выключен, будет " #~ "распечатан только текст веб-страницы. В этом случае печать закончиться " #~ "быстрее и вы потратите меньше чернил или тонера.

    " #~ msgid "" #~ "

    'Print header'

    If this checkbox is enabled, " #~ "the printout of the HTML document will contain a header line at the top " #~ "of each page. This header contains the current date, the location URL of " #~ "the printed page and the page number.

    If this checkbox is disabled, " #~ "the printout of the HTML document will not contain such a header line. " #~ msgstr "" #~ "

    Печатать заголовок

    Если этот флажок " #~ "установлен, на каждой странице распечатки документа в формате HTML будет " #~ "заголовок, содержащий текущую дату, адрес (URL) этой страницы и номер " #~ "страницы.

    " #~ msgid "" #~ "

    'Printerfriendly mode'

    If this checkbox is " #~ "enabled, the printout of the HTML document will be black and white only, " #~ "and all colored background will be converted into white. Printout will be " #~ "faster and use less ink or toner.

    If this checkbox is disabled, the " #~ "printout of the HTML document will happen in the original color settings " #~ "as you see in your application. This may result in areas of full-page " #~ "color (or grayscale, if you use a black+white printer). Printout will " #~ "possibly happen more slowly and will probably use more toner or ink.

    " #~ "    " #~ msgstr "" #~ "

    Экономный режим

    Если этот параметр включён, " #~ "распечатка документа в формате HTML будет только черно-белой, любой " #~ "цветной фон будет преобразован в белый. Печать будет быстрее и будет " #~ "использоваться меньше чернил или тонера.

    Если этот параметр " #~ "выключен, распечатка документа в формате HTML будет иметь такие же цвета, " #~ "как вы видите в приложении. Результатом может быть полностью цветная " #~ "страница (или с градациями серого, если принтер черно-белый). Печать " #~ "будет идти медленнее и использовать намного больше тонера или чернил.

    " #~ "    " #~ msgid "HTML Settings" #~ msgstr "Настройка HTML" #~ msgid "Printer friendly mode (black text, no background)" #~ msgstr "Экономный режим (чёрный текст, без фона)" #~ msgid "Print images" #~ msgstr "Печатать изображения" #~ msgid "Print header" #~ msgstr "Печатать заголовок" #~ msgid "Filter error" #~ msgstr "Ошибка фильтра" #~ msgid "Inactive" #~ msgstr "Неактивный" #~ msgid "%1 (%2 - %3x%4 Pixels)" #~ msgstr "%1 (%2 - %3x%4 пиксел)" #~ msgid "%1 - %2x%3 Pixels" #~ msgstr "%1 - %2x%3 пиксел" #~ msgid "%1 (%2x%3 Pixels)" #~ msgstr "%1 (%2x%3 пиксел)" #~ msgid "Image - %1x%2 Pixels" #~ msgstr "Изображение - %1x%2 пикселов" #~ msgid "Done." #~ msgstr "Готово." #~ msgid "Access Keys activated" #~ msgstr "Включено использование ключей доступа" #~ msgid "JavaScript Errors" #~ msgstr "Ошибки JavaScript" #~ msgid "" #~ "This dialog provides you with notification and details of scripting " #~ "errors that occur on web pages. In many cases it is due to an error in " #~ "the web site as designed by its author. In other cases it is the result " #~ "of a programming error in Konqueror. If you suspect the former, please " #~ "contact the webmaster of the site in question. Conversely if you suspect " #~ "an error in Konqueror, please file a bug report at http://bugs.kde.org/. " #~ "A test case which illustrates the problem will be appreciated." #~ msgstr "" #~ "В этом диалоге показаны ошибки скриптов на веб-страницах. Чаще всего они " #~ "обусловлены ошибками при создании веб-страниц, но иногда - ошибками в " #~ "Konqueror. В первом случае известите об ошибке веб-мастера сайта, если " #~ "же это всё-таки ошибка в Konqueror, отправьте сообщение об ошибке на " #~ "http://bugs.kde.org/. Пример, иллюстрирующий ошибку, поможет её " #~ "устранить." #~ msgid "KMultiPart" #~ msgstr "KMultiPart" #~ msgid "Embeddable component for multipart/mixed" #~ msgstr "Встраиваемый компонент для multipart/mixed" #~ msgid "Copyright 2001-2011, David Faure faure@kde.org" #~ msgstr "© David Faure faure@kde.org, 2001-2011" #~ msgid "No handler found for %1." #~ msgstr "Не найден обработчик для %1." #~ msgid "Play" #~ msgstr "Воспроизвести" #~ msgid "Pause" #~ msgstr "Пауза" #~ msgid "New Web Shortcut" #~ msgstr "Новое веб-сокращение" #~ msgid "%1 is already assigned to %2" #~ msgstr "%1 уже назначено для %2" #~ msgid "Search &provider name:" #~ msgstr "&Название поисковой системы:" #~ msgid "New search provider" #~ msgstr "Новая поисковая система" #~ msgid "UR&I shortcuts:" #~ msgstr "&Сокращения:" #~ msgid "Create Web Shortcut" #~ msgstr "Создать веб-сокращение" #~ msgid "Directory containing tests, basedir and output directories." #~ msgstr "" #~ "Каталог, содержащий тесты, базовый каталог и каталоги для сохранения " #~ "выводимых данных." #~ msgid "Do not suppress debug output" #~ msgstr "Показывать вывод отладки" #~ msgid "Regenerate baseline (instead of checking)" #~ msgstr "Восстановить исходный (вместо проверки)" #~ msgid "Do not show the window while running tests" #~ msgstr "Не показывать окно при выполнении тестов" #~ msgid "Only run a single test. Multiple options allowed." #~ msgstr "Запустить один тест. Можно указать несколько таких параметров." #~ msgid "Only run .js tests" #~ msgstr "Запустить только тесты .js" #~ msgid "Only run .html tests" #~ msgstr "Запустить только тесты .html" #~ msgid "Do not use Xvfb" #~ msgstr "Не использовать Xvfb" #~ msgid "Put output in <directory> instead of <base_dir>/output" #~ msgstr "" #~ "Сохранить вывод в <каталог> вместо файла <базовый_каталог>/" #~ "output" #~ msgid "" #~ "Use <directory> as reference instead of <base_dir>/baseline" #~ msgstr "" #~ "Использовать <каталог> в качестве каталога эталонных результатов " #~ "вместо <базовый_каталог>/baseline" #~ msgid "" #~ "Directory containing tests, basedir and output directories. Only regarded " #~ "if -b is not specified." #~ msgstr "" #~ "Каталог, содержащий тесты, базовый каталог и каталоги для сохранения " #~ "выводимых данных. Используется, если не указан параметр -b." #~ msgid "" #~ "Relative path to testcase, or directory of testcases to be run " #~ "(equivalent to -t)." #~ msgstr "Относительный путь к тестам или каталог с тестами (эквивалент -t)." #~ msgid "TestRegression" #~ msgstr "TestRegression" #~ msgid "Regression tester for khtml" #~ msgstr "Проверка регрессии в khtml" #~ msgid "KHTML Regression Testing Utility" #~ msgstr "Программа проверки KHTML на регрессию" #~ msgid "0" #~ msgstr "0" #~ msgid "Regression testing output" #~ msgstr "Вывод проверки на регрессию" #~ msgid "Pause/Continue regression testing process" #~ msgstr "Пауза или продолжение проверки на регрессию" #~ msgid "" #~ "You may select a file where the log content is stored, before the " #~ "regression testing is started." #~ msgstr "Перед началом проверки можно выбрать файл для сохранения протокола." #~ msgid "Output to File..." #~ msgstr "Сохранить результат проверки в файл..." #~ msgid "Regression Testing Status" #~ msgstr "Состояние проверки" #~ msgid "View HTML Output" #~ msgstr "Просмотреть вывод в HTML" #~ msgid "Settings" #~ msgstr "Настройка" #~ msgid "Tests" #~ msgstr "Тесты" #~ msgid "Only Run JS Tests" #~ msgstr "Запустить только проверку JS" #~ msgid "Only Run HTML Tests" #~ msgstr "Запустить только проверку HTML" #~ msgid "Do Not Suppress Debug Output" #~ msgstr "Показывать вывод отладки" #~ msgid "Run Tests..." #~ msgstr "Запустить проверку..." #~ msgid "Run Single Test..." #~ msgstr "Запустить отдельный тест..." #~ msgid "Specify tests Directory..." #~ msgstr "Укажите каталог с тестами..." #~ msgid "Specify khtml Directory..." #~ msgstr "Укажите каталог khtml..." #~ msgid "Specify Output Directory..." #~ msgstr "Укажите каталог вывода..." #~ msgid "TestRegressionGui" #~ msgstr "TestRegressionGui" #~ msgid "GUI for the khtml regression tester" #~ msgstr "Графический интерфейс для поиска регрессии в khtml" #~ msgid "Available Tests: 0" #~ msgstr "Доступных тестов: 0" #~ msgid "Please choose a valid 'khtmltests/regression/' directory." #~ msgstr "Укажите правильный каталог «khtmltests/regression/»." #~ msgid "Please choose a valid 'khtml/' build directory." #~ msgstr "Укажите правильный каталог «khtml/»." #~ msgid "Available Tests: %1 (ignored: %2)" #~ msgstr "Доступных тестов: %1 (игнорировано: %2)" #~ msgid "Cannot find testregression executable." #~ msgstr "Не удалось найти программу testregression." #~ msgid "Run test..." #~ msgstr "Запустить тест..." #~ msgid "Add to ignores..." #~ msgstr "Игнорировать тест..." #~ msgid "Remove from ignores..." #~ msgstr "Вернуть тест из игнорируемых..." #~ msgid "URL to open" #~ msgstr "Открываемый URL" #~ msgid "Testkhtml" #~ msgstr "Testkhtml" #~ msgid "a basic web browser using the KHTML library" #~ msgstr "простой веб-браузер на базе движка KHTML" #~ msgid "Find &links only" #~ msgstr "Искать только &ссылки" #~ msgid "No more matches for this search direction." #~ msgstr "Не найдено вхождений в выбранном направлении" #~ msgid "F&ind:" #~ msgstr "&Искать:" #~ msgid "&Next" #~ msgstr "&Следующее" #~ msgid "Opt&ions" #~ msgstr "&Параметры" #~ msgid "Do you want to store this password?" #~ msgstr "Сохранить пароль?" #~ msgid "Do you want to store this password for %1?" #~ msgstr "Сохранить пароль для %1?" #~ msgid "&Store" #~ msgstr "&Сохранить" #~ msgid "Ne&ver store for this site" #~ msgstr "&Никогда для этого сайта" #~ msgid "Do ¬ store this time" #~ msgstr "В другой &раз" #~ msgid "Basic Page Style" #~ msgstr "Основной стиль страницы" #~ msgid "the document is not in the correct file format" #~ msgstr "документ содержит данные некорректного формата" #~ msgid "fatal parsing error: %1 in line %2, column %3" #~ msgstr "критическая ошибка обработки: %1 в строке %2, позиция %3" #~ msgid "XML parsing error" #~ msgstr "ошибка при разборе XML" #~ msgid "" #~ "Unable to start new process.\n" #~ "The system may have reached the maximum number of open files possible or " #~ "the maximum number of open files that you are allowed to use has been " #~ "reached." #~ msgstr "" #~ "Не удалось запустить процесс.\n" #~ "Возможно, превышен предел количества открытых файлов в системе или для " #~ "пользователя." #~ msgid "" #~ "Unable to create new process.\n" #~ "The system may have reached the maximum number of processes possible or " #~ "the maximum number of processes that you are allowed to use has been " #~ "reached." #~ msgstr "" #~ "Не удалось создать процесс.\n" #~ "Возможно, превышен предел количества запущенных процессов в системе или " #~ "для пользователя." #~ msgid "Could not find '%1' executable." #~ msgstr "Не удалось найти исполняемый файл «%1»." #~ msgid "" #~ "Could not open library '%1'.\n" #~ "%2" #~ msgstr "" #~ "Не удалось открыть библиотеку «%1».\n" #~ "%2" #~ msgid "" #~ "Could not find 'kdemain' in '%1'.\n" #~ "%2" #~ msgstr "" #~ "Не удалось найти «kdemain» в «%1».\n" #~ "%2" #~ msgid "KDEInit could not launch '%1'" #~ msgstr "KDEInit не может запустить «%1»" #~ msgid "Could not find service '%1'." #~ msgstr "Не удалось найти службу «%1»." #~ msgid "Service '%1' must be executable to run." #~ msgstr "Служба «%1» должна быть сделана выполняемой для запуска." #~ msgid "Service '%1' is malformatted." #~ msgstr "Служба «%1» имеет неверный формат." #~ msgid "Launching %1" #~ msgstr "Запускается %1" #~ msgid "Unknown protocol '%1'.\n" #~ msgstr "Неизвестный протокол «%1».\n" #~ msgid "Error loading '%1'.\n" #~ msgstr "Ошибка загрузки «%1»:\n" #~ msgid "" #~ "klauncher: This program is not supposed to be started manually.\n" #~ "klauncher: It is started automatically by kdeinit4.\n" #~ msgstr "" #~ "klauncher: программа не должна запускаться вручную.\n" #~ "klauncher: запускается автоматически из kdeinit4.\n" #~ msgid "Evaluation error" #~ msgstr "Ошибка вычисления" #~ msgid "Range error" #~ msgstr "Ошибка границ" #~ msgid "Reference error" #~ msgstr "Ошибка ссылки" #~ msgid "Syntax error" #~ msgstr "Синтаксическая ошибка" #~ msgid "Type error" #~ msgstr "Ошибка типа" #~ msgid "URI error" #~ msgstr "Ошибка URI" #~ msgid "JS Calculator" #~ msgstr "Калькулятор JS" #~ msgctxt "addition" #~ msgid "+" #~ msgstr "+" #~ msgid "AC" #~ msgstr "Сброс" #~ msgctxt "subtraction" #~ msgid "-" #~ msgstr "-" #~ msgctxt "evaluation" #~ msgid "=" #~ msgstr "=" #~ msgid "CL" #~ msgstr "CL" #~ msgid "5" #~ msgstr "5" #~ msgid "3" #~ msgstr "3" #~ msgid "7" #~ msgstr "7" #~ msgid "8" #~ msgstr "8" #~ msgid "MainWindow" #~ msgstr "MainWindow" #~ msgid "

    KJSEmbed Documentation Viewer

    " #~ msgstr "

    Просмотр документации по KJSEmbed

    " #~ msgid "Execute" #~ msgstr "Выполнить" #~ msgid "File" #~ msgstr "Файл" #~ msgid "Open Script" #~ msgstr "Открыть скрипт" #~ msgid "Open a script..." #~ msgstr "Открытие скрипта..." #~ msgid "Ctrl+O" #~ msgstr "Ctrl+O" #~ msgid "Close Script" #~ msgstr "Закрыть скрипт" #~ msgid "Close script..." #~ msgstr "Закрытие скрипта..." #~ msgid "Quit" #~ msgstr "Выход" #~ msgid "Quit application..." #~ msgstr "Выход из приложения..." #~ msgid "Run" #~ msgstr "Запустить" #~ msgid "Run script..." #~ msgstr "Запуск скрипта..." #~ msgid "Run To..." #~ msgstr "Выполнение до позиции..." #~ msgid "Run to breakpoint..." #~ msgstr "Выполнение до точки останова..." #~ msgid "Step" #~ msgstr "Перейти на следующую строку" #~ msgid "Step to next line..." #~ msgstr "Продолжение выполнения до следующей строки..." #~ msgid "Step execution..." #~ msgstr "Остановка выполнения..." #~ msgid "KJSCmd" #~ msgstr "KJSCmd" #~ msgid "Utility for running KJSEmbed scripts \n" #~ msgstr "Программа для запуска скриптов KJSEmbed \n" #~ msgid "(C) 2005-2006 The KJSEmbed Authors" #~ msgstr "© Разработчики KJSEmbed, 2005-2006" #~ msgid "Execute script without gui support" #~ msgstr "Выполнить скрипт без графического интерфейса" #~ msgid "start interactive kjs interpreter" #~ msgstr "запустить интерактивный интерпретатор kjs" #~ msgid "start without KDE KApplication support." #~ msgstr "запустить без поддержки KDE KApplication." #~ msgid "Script to execute" #~ msgstr "Имя выполняемого скрипта" #~ msgid "Error encountered while processing include '%1' line %2: %3" #~ msgstr "Ошибка при выполнении include «%1» на строке %2: %3" #~ msgid "include only takes 1 argument, not %1." #~ msgstr "директива include требует один аргумент, а не %1." #~ msgid "File %1 not found." #~ msgstr "Файл %1 не найден." #~ msgid "library only takes 1 argument, not %1." #~ msgstr "библиотека требует один аргумент, а не %1." #~ msgid "Alert" #~ msgstr "Тревога" #~ msgid "Confirm" #~ msgstr "Подтверждение" #~ msgid "Bad event handler: Object %1 Identifier %2 Method %3 Type: %4." #~ msgstr "" #~ "Неверный обработчик событий: объект %1, идентификатор %2, метод %3, тип " #~ "%4." #~ msgid "Exception calling '%1' function from %2:%3:%4" #~ msgstr "Возникло исключение при вызове функции «%1» из %2:%3:%4" #~ msgid "Could not open file '%1'" #~ msgstr "Не удалось открыть файл «%1»" #~ msgid "Could not create temporary file." #~ msgstr "Не удалось создать временный файл." #~ msgid "%1 is not a function and cannot be called." #~ msgstr "%1 не является функцией и не может быть вызвано." #~ msgid "%1 is not an Object type" #~ msgstr "%1 не является объектом" #~ msgid "Action takes 2 args." #~ msgstr "Действие требует 2 аргумента." #~ msgid "ActionGroup takes 2 args." #~ msgstr "ActionGroup требует 2 аргумента." #~ msgid "Must supply a valid parent." #~ msgstr "Необходимо указать правильный родительский объект." #~ msgid "There was an error reading the file '%1'" #~ msgstr "Ошибка чтения из файла «%1»" #~ msgid "Could not read file '%1'" #~ msgstr "Не удалось открыть файл «%1»" #~ msgid "Must supply a filename." #~ msgstr "Необходимо указать имя файла." #~ msgid "'%1' is not a valid QLayout." #~ msgstr "«%1» не является правильным объектом QLayout." #~ msgid "Must supply a layout name." #~ msgstr "Необходимо указать имя компоновки." #~ msgid "Wrong object type." #~ msgstr "Неверное имя объекта." #~ msgid "First argument must be a QObject." #~ msgstr "Первый аргумент должен быть объектом QObject." #~ msgid "Incorrect number of arguments." #~ msgstr "Неверное количество аргументов." #~ msgid "The slot asked for %1 argument" #~ msgid_plural "The slot asked for %1 arguments" #~ msgstr[0] "Слот требует %1 аргумент" #~ msgstr[1] "Слот требует %1 аргумента" #~ msgstr[2] "Слот требует %1 аргументов" #~ msgstr[3] "Слот требует %1 аргумент" #~ msgid "but there is only %1 available" #~ msgid_plural "but there are only %1 available" #~ msgstr[0] "но есть только %1 аргумент" #~ msgstr[1] "но есть только %1 аргумента" #~ msgstr[2] "но есть только %1 аргументов" #~ msgstr[3] "но есть только %1 аргумент" #~ msgctxt "" #~ "%1 is 'the slot asked for foo arguments', %2 is 'but there are only bar " #~ "available'" #~ msgid "%1, %2." #~ msgstr "%1, %2." #~ msgid "Failure to cast to %1 value from Type %2 (%3)" #~ msgstr "Не удалось преобразовать значение от типа %2 к типу %1 (%3)" #~ msgid "No such method '%1'." #~ msgstr "Нет метода «%1»." #~ msgid "Call to method '%1' failed, unable to get argument %2: %3" #~ msgstr "Ошибка вызова метода «%1»: не удалось получить аргумент %2: %3" #~ msgid "Call to '%1' failed." #~ msgstr "Ошибка вызова «%1»." #~ msgid "Could not construct value" #~ msgstr "Не удалось запустить конструктор значения" #~ msgid "Not enough arguments." #~ msgstr "Недостаточно аргументов." #~ msgid "Failed to create Action." #~ msgstr "Не удалось создать Action." #~ msgid "Failed to create ActionGroup." #~ msgstr "Не удалось создать ActionGroup." #~ msgid "No classname specified" #~ msgstr "Не указано имя класса" #~ msgid "Failed to create Layout." #~ msgstr "Не удалось создать Layout." #~ msgid "No classname specified." #~ msgstr "Имя класса не указано." #~ msgid "Failed to create Widget." #~ msgstr "Не удалось создать Widget." #~ msgid "Could not open file '%1': %2" #~ msgstr "Не удалось открыть файл «%1»: %2" #~ msgid "Failed to load file '%1'" #~ msgstr "Ошибка открытия файла «%1»" #~ msgid "'%1' is not a valid QWidget." #~ msgstr "«%1» не является правильным объектом QWidget." #~ msgid "Must supply a widget name." #~ msgstr "Необходимо указать имя виджета." #~ msgid "Bad slot handler: Object %1 Identifier %2 Method %3 Signature: %4." #~ msgstr "" #~ "Неверный обработчик слота: объект %1, идентификатор %2, метод %3, " #~ "сигнатура %4." #~ msgid "Exception calling '%1' slot from %2:%3:%4" #~ msgstr "Возникло исключение при вызове слота «%1» из %2:%3:%4" #~ msgid "loading %1" #~ msgstr "Загрузка %1" #~ msgctxt "describes the feed of the latest posted entries" #~ msgid "Latest" #~ msgstr "Самые последние" #~ msgid "Highest Rated" #~ msgstr "С наивысшим рейтингом" #~ msgid "Most Downloads" #~ msgstr "Самые популярные" #~ msgid "" #~ "Cannot start gpg and retrieve the available keys. Make sure " #~ "that gpg is installed, otherwise verification of downloaded " #~ "resources will not be possible." #~ msgstr "" #~ "Не удалось запустить программу gpg и получить все доступные " #~ "ключи. Проверьте, что программа gpg установлена, иначе проверка " #~ "достоверности скачиваемых материалов будет невозможна." #~ msgid "" #~ "Enter passphrase for key 0x%1, belonging to
    %2<" #~ "%3>
    :    " #~ msgstr "" #~ "Введите ключевую фразу для ключа 0x%1, принадлежащего
    " #~ "%2<%3>
    :    " #~ msgid "" #~ "Cannot start gpg and check the validity of the file. Make sure " #~ "that gpg is installed, otherwise verification of downloaded " #~ "resources will not be possible." #~ msgstr "" #~ "Не удалось запустить программу gpg и проверить целостность " #~ "файла. Проверьте, что программа gpg установлена, иначе проверка " #~ "достоверности скачиваемых материалов будет невозможна." #~ msgid "Select Signing Key" #~ msgstr "Выберите ключ для подписи" #~ msgid "Key used for signing:" #~ msgstr "Ключ, использовавшийся для подписи:" #~ msgid "" #~ "Cannot start gpg and sign the file. Make sure that gpg " #~ "is installed, otherwise signing of the resources will not be possible." #~ msgstr "" #~ "Не удалось запустить программу gpg и подписать файл. " #~ "Проверьте, что программа gpg установлена, иначе подписывание " #~ "материалов будет невозможно." #~ msgid "Get Hot New Stuff" #~ msgstr "Загрузка материалов из Интернета" #~ msgctxt "Program name followed by 'Add On Installer'" #~ msgid "%1 Add-On Installer" #~ msgstr "Программа установки дополнений для %1" #~ msgid "Add Rating" #~ msgstr "Повысить рейтинг" #~ msgid "Add Comment" #~ msgstr "Добавить комментарий" #~ msgid "View Comments" #~ msgstr "Просмотреть комментарии" #~ msgid "Re: %1" #~ msgstr "Re: %1" #~ msgid "Timeout. Check Internet connection." #~ msgstr "Время ожидания истекло. Проверьте подключение к Интернету." #~ msgid "Entries failed to load" #~ msgstr "Ошибка загрузки" #~ msgid "
    Provider: %1" #~ msgstr "
    Поставщик: %1" #~ msgid "Provider information" #~ msgstr "Сведения о поставщике" #~ msgid "Could not install %1" #~ msgstr "Не удалось установить %1" #~ msgid "Get Hot New Stuff!" #~ msgstr "Загрузка материалов из Интернета" #~ msgid "There was an error loading data providers." #~ msgstr "При загрузке списка поставщиков произошла ошибка." #~ msgid "A protocol fault has occurred. The request has failed." #~ msgstr "Ошибка протокола. Запрос не выполнен." #~ msgid "Desktop Exchange Service" #~ msgstr "Служба доставки материалов" #~ msgid "A network error has occurred. The request has failed." #~ msgstr "Ошибка сети. Запрос не выполнен." #~ msgid "&Source:" #~ msgstr "&Источник:" #~ msgid "?" #~ msgstr "?" #~ msgid "&Order by:" #~ msgstr "&Выше ставить:" #~ msgid "Enter search phrase here" #~ msgstr "Введите текст для поиска" #~ msgid "Collaborate" #~ msgstr "Совместная работа" #~ msgid "Rating: " #~ msgstr "Рейтинг: " #~ msgid "Downloads: " #~ msgstr "Загрузок: " #~ msgid "Install" #~ msgstr "Установить" #~ msgid "Uninstall" #~ msgstr "Удалить" #~ msgid "

    No Downloads

    " #~ msgstr "

    Не было загрузок

    " #~ msgid "

    Downloads: %1

    \n" #~ msgstr "

    Загрузок: %1

    \n" #~ msgid "Update" #~ msgstr "Обновить материал" #~ msgid "Rating: %1" #~ msgstr "Рейтинг: %1" #~ msgid "No Preview" #~ msgstr "Миниатюра отсутствует" #~ msgid "Loading Preview" #~ msgstr "Загрузка миниатюры..." #~ msgid "Comments" #~ msgstr "Комментарии" #~ msgid "Changelog" #~ msgstr "История изменений" #~ msgid "Switch version" #~ msgstr "Изменить версию" #~ msgid "Contact author" #~ msgstr "Связаться с автором" #~ msgid "Collaboration" #~ msgstr "Совместная работа" #~ msgid "Translate" #~ msgstr "Перевести" #~ msgid "Subscribe" #~ msgstr "Подписаться на изменения" #~ msgid "Report bad entry" #~ msgstr "Сообщить об ошибке" #~ msgid "Send Mail" #~ msgstr "Отправить письмо" #~ msgid "Contact on Jabber" #~ msgstr "Связаться через Jabber" #~ msgid "Provider: %1" #~ msgstr "Поставщик: %1" #~ msgid "Version: %1" #~ msgstr "Версия: %1" #~ msgid "Removal of entry" #~ msgstr "Удаление записи" #~ msgid "The removal request failed." #~ msgstr "Ошибка обработки запроса на удаление." #~ msgid "The subscription was successfully completed." #~ msgstr "Вы подписаны на изменения." #~ msgid "Subscription to entry" #~ msgstr "Подписка на изменения" #~ msgid "The subscription request failed." #~ msgstr "Ошибка подписки." #~ msgid "The rating was submitted successfully." #~ msgstr "Запрос на повышение рейтинга принят." #~ msgid "Rating for entry" #~ msgstr "Рейтинг" #~ msgid "The rating could not be submitted." #~ msgstr "Ошибка обработки запроса на повышение рейтинга." #~ msgid "The comment was submitted successfully." #~ msgstr "Комментарий принят." #~ msgid "Comment on entry" #~ msgstr "Комментарий" #~ msgid "The comment could not be submitted." #~ msgstr "Ошибка обработки запроса с комментарием." #~ msgid "KNewStuff contributions" #~ msgstr "Помощь в улучшении" #~ msgid "This operation requires authentication." #~ msgstr "Операция требует аутентификации." #~ msgid "Version %1" #~ msgstr "Версия %1" #~ msgid "Leave a comment" #~ msgstr "Оставить комментарий" #~ msgid "User comments" #~ msgstr "Комментарии пользователей" #~ msgid "Rate this entry" #~ msgstr "Рейтинг материала" #~ msgid "Translate this entry" #~ msgstr "Перевести этот элемент" #~ msgid "Payload" #~ msgstr "Нагрузка" #~ msgid "Download New Stuff..." #~ msgstr "Загрузить материалы..." #~ msgid "Hot New Stuff Providers" #~ msgstr "Поставщики материалов" #~ msgid "Please select one of the providers listed below:" #~ msgstr "Выберите поставщика из списка:" #~ msgid "No provider selected." #~ msgstr "Поставщик не выбран." #~ msgid "Share Hot New Stuff" #~ msgstr "Публикация материалов" #~ msgctxt "Program name followed by 'Add On Uploader'" #~ msgid "%1 Add-On Uploader" #~ msgstr "Программа публикации дополнений для %1" #~ msgid "Please put in a name." #~ msgstr "Введите имя." #~ msgid "Old upload information found, fill out fields?" #~ msgstr "Обнаружены параметры прежней публикации. Использовать их?" #~ msgid "Fill Out" #~ msgstr "Да" #~ msgid "Do Not Fill Out" #~ msgstr "Нет" #~ msgid "Author:" #~ msgstr "Автор:" #~ msgid "Email address:" #~ msgstr "Адрес электронной почты:" #~ msgid "License:" #~ msgstr "Лицензия:" #~ msgid "GPL" #~ msgstr "GPL" #~ msgid "LGPL" #~ msgstr "LGPL" #~ msgid "BSD" #~ msgstr "BSD" #~ msgid "Preview URL:" #~ msgstr "URL миниатюры:" #~ msgid "Language:" #~ msgstr "Язык:" #~ msgid "In which language did you describe the above?" #~ msgstr "На каком языке описано указанное выше?" #~ msgid "Please describe your upload." #~ msgstr "Опишите загружаемые материалы." #~ msgid "Summary:" #~ msgstr "Сводка:" #~ msgid "Please give some information about yourself." #~ msgstr "Укажите информацию о себе." #~ msgctxt "" #~ "the price of a download item, parameter 1 is the currency, 2 is the price" #~ msgid "" #~ "This item costs %1 %2.\n" #~ "Do you want to buy it?" #~ msgstr "" #~ "Стоимость обозначенного составляет %1 %2.\n" #~ "Хотите купить?" #~ msgid "" #~ "Your account balance is too low:\n" #~ "Your balance: %1\n" #~ "Price: %2" #~ msgstr "" #~ "Недостаточно средств на счёте.\n" #~ "Остаток на счёте: %1\n" #~ "Цена: %2" #~ msgctxt "voting for an item (good/bad)" #~ msgid "Your vote was recorded." #~ msgstr "Ваш голос учтён." #~ msgid "You are now a fan." #~ msgstr "Теперь вы фанат этого дополнения." #~ msgid "Network error. (%1)" #~ msgstr "Сетевая ошибка (%1)." #~ msgid "Too many requests to server. Please try again in a few minutes." #~ msgstr "" #~ "Слишком много обращений на сервер. Повторите попытку через несколько " #~ "минут." #~ msgid "Unknown Open Collaboration Service API error. (%1)" #~ msgstr "Неизвестная ошибка Open Collaboration Service (%1)." #~ msgid "Initializing" #~ msgstr "Инициализация" #~ msgid "Configuration file not found: \"%1\"" #~ msgstr "Файл конфигурации не найден: «%1»" #~ msgid "Configuration file is invalid: \"%1\"" #~ msgstr "Неверный файл конфигурации: «%1»" #~ msgid "Loading provider information" #~ msgstr "Загрузка информации о сервере" #~ msgid "Could not load get hot new stuff providers from file: %1" #~ msgstr "Не удалось загрузить список поставщиков из файла: %1" #~ msgid "Error initializing provider." #~ msgstr "Ошибка инициализации поставщика." #~ msgid "Loading data" #~ msgstr "Загрузка данных" #~ msgid "Loading data from provider" #~ msgstr "Загрузка данных от поставщика" #~ msgid "Loading of providers from file: %1 failed" #~ msgstr "Ошибка загрузки поставщиков из файла: %1" #~ msgid "Loading one preview" #~ msgid_plural "Loading %1 previews" #~ msgstr[0] "Загрузка %1 миниатюры..." #~ msgstr[1] "Загрузка %1 миниатюр..." #~ msgstr[2] "Загрузка %1 миниатюр..." #~ msgstr[3] "Загрузка %1 миниатюры..." #~ msgid "Installing" #~ msgstr "Установка" #~ msgid "Invalid item." #~ msgstr "Неподдерживаемый элемент." #~ msgid "Download of item failed: no download URL for \"%1\"." #~ msgstr "Ошибка загрузки: не указан адрес URL для «%1»." #~ msgid "Download of \"%1\" failed, error: %2" #~ msgstr "Ошибка загрузки «%1»: %2" #~ msgid "" #~ "The downloaded file is a html file. This indicates a link to a website " #~ "instead of the actual download. Would you like to open the site with a " #~ "browser instead?" #~ msgstr "" #~ "Вы пытаетесь загрузить файл HTML. Это означает, что ссылка указывает на " #~ "веб-страницу, а не на файл. Открыть ссылку в браузере?" #~ msgid "Possibly bad download link" #~ msgstr "Возможно, неверная ссылка" #~ msgid "Downloaded file was a HTML file. Opened in browser." #~ msgstr "Попытка загрузки файла HTML. Ссылка будет открыта в браузере." #~ msgid "Could not install \"%1\": file not found." #~ msgstr "Не удалось установить «%1»: файл не найден" # BUGME: quotes are not translatable #~ msgid "Overwrite existing file?" #~ msgstr "Заменить существующий файл?" # [https://bugs.kde.org/show_bug.cgi?id=265438] BUGME: colon in caption #~ msgid "Download File" #~ msgstr "Загрузка файла" #~ msgid "Icons view mode" #~ msgstr "Значки" #~ msgid "Details view mode" #~ msgstr "Список" #~ msgid "All Providers" #~ msgstr "Все поставщики материалов" #~ msgid "All Categories" #~ msgstr "Все категории" #~ msgid "Provider:" #~ msgstr "Поставщик:" #~ msgid "Category:" #~ msgstr "Категория:" #~ msgid "Newest" #~ msgstr "Новые" #~ msgid "Rating" #~ msgstr "Высоко оценённые" #~ msgid "Most downloads" #~ msgstr "Самые популярные" #~ msgid "Installed" #~ msgstr "Установленные" #~ msgid "Order by:" #~ msgstr "Выше ставить:" #~ msgid "Search:" #~ msgstr "Поиск:" #~ msgid "Homepage" #~ msgstr "Домашняя страница" #~ msgid "Become a Fan" #~ msgstr "Стать фанатом" #~ msgid "Details for %1" #~ msgstr "Сведения о %1" #~ msgid "Changelog:" #~ msgstr "История изменений:" #~ msgctxt "A link to the description of this Get Hot New Stuff item" #~ msgid "Homepage" #~ msgstr "Веб-сайт" #~ msgctxt "" #~ "A link to make a donation for a Get Hot New Stuff item (opens a web " #~ "browser)" #~ msgid "Make a donation" #~ msgstr "Сделать пожертвование" # BUGME: wrong usage of plurals ("no entries" for n=1) #~ msgctxt "A link to the knowledgebase (like a forum) (opens a web browser)" #~ msgid "Knowledgebase (no entries)" #~ msgid_plural "Knowledgebase (%1 entries)" #~ msgstr[0] "База знаний (%1 вхождение)" #~ msgstr[1] "База знаний (%1 вхождения)" #~ msgstr[2] "База знаний (%1 вхождений)" #~ msgstr[3] "База знаний (нет вхождений)" #~ msgctxt "Tooltip for a link in a dialog" #~ msgid "Opens in a browser window" #~ msgstr "Открыть в браузере" #~ msgid "Rating: %1%" #~ msgstr "Рейтинг: %1%" #~ msgctxt "Show the author of this item in a list" #~ msgid "By %1" #~ msgstr "Автор: %1" #~ msgctxt "fan as in supporter" #~ msgid "1 fan" #~ msgid_plural "%1 fans" #~ msgstr[0] "%1 фанат" #~ msgstr[1] "%1 фаната" #~ msgstr[2] "%1 фанатов" #~ msgstr[3] "%1 фанат" #~ msgid "1 download" #~ msgid_plural "%1 downloads" #~ msgstr[0] "%1 загрузка" #~ msgstr[1] "%1 загрузки" #~ msgstr[2] "%1 загрузок" #~ msgstr[3] "%1 загрузка" #~ msgid "Updating" #~ msgstr "Обновление" #~ msgid "Install Again" #~ msgstr "Установить заново" #~ msgid "Fetching license data from server..." #~ msgstr "Получение лицензии с сервера..." #~ msgid "Fetching content data from server..." #~ msgstr "Получение данных с сервера..." #~ msgid "Register a new account" #~ msgstr "Зарегистрировать новую учётную запись" #~ msgid "Checking login..." #~ msgstr "Попытка входа..." #~ msgid "Fetching your previously updated content..." #~ msgstr "Получение ранее обновлённого содержимого..." #~ msgid "Could not verify login, please try again." #~ msgstr "Не удалось проверить данные регистрации. Попробуйте позже." #~ msgid "Fetching your previously updated content finished." #~ msgstr "Получение ранее обновлённого содержимого завершено." #~ msgid "Fetching content data from server finished." #~ msgstr "Получение содержимого с сервера завершено." #~ msgctxt "" #~ "A link to the website where the get hot new stuff upload can be seen" #~ msgid "Visit website" #~ msgstr "Посетить веб-сайт" #~ msgid "File not found: %1" #~ msgstr "Файл %1 не найден." #~ msgid "Upload Failed" #~ msgstr "Не удалось загрузить файл на сервер" #~ msgid "" #~ "The server does not recognize the category %2 to which you are trying to " #~ "upload." #~ msgid_plural "" #~ "The server does not recognize any of the categories to which you are " #~ "trying to upload: %2" #~ msgstr[0] "" #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " #~ "загрузку." #~ msgstr[1] "" #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " #~ "загрузку." #~ msgstr[2] "" #~ "Сервер не поддерживает категорий (%2), в которые вы хотите выполнить " #~ "загрузку." #~ msgstr[3] "" #~ "Сервер не поддерживает категорию (%2), в которую вы хотите выполнить " #~ "загрузку." #~ msgid "The selected category \"%1\" is invalid." #~ msgstr "Выбрана недопустимая категория «%1»." #~ msgid "Select preview image" #~ msgstr "Выбор изображения для миниатюры" #~ msgid "There was a network error." #~ msgstr "Произошла ошибка сети." #~ msgid "Uploading Failed" #~ msgstr "Не удалось загрузить файл на сервер" #~ msgid "Authentication error." #~ msgstr "Ошибка аутентификации." #~ msgid "Upload failed: %1" #~ msgstr "Загрузка на сервер не удалась: %1" #~ msgid "File to upload:" #~ msgstr "Файл для публикации:" #~ msgid "New Upload" #~ msgstr "Новый материал" #~ msgid "Please fill out the information about your upload in English." #~ msgstr "Опишите загружаемые материалы на английском языке." #~ msgid "Name of the file as it will appear on the website" #~ msgstr "Имя, под которым файл будет показан на сайте" #~ msgid "" #~ "This should clearly describe the file content. It can be the same text as " #~ "the title of the kvtml file." #~ msgstr "Имя должно ясно описывать содержимое файла." #~ msgid "Preview Images" #~ msgstr "Миниатюры" #~ msgid "Select Preview..." #~ msgstr "Выбрать..." #~ msgid "Set a price for this item" #~ msgstr "Установить цену" #~ msgid "Price" #~ msgstr "Цена" #~ msgid "Price:" #~ msgstr "Цена:" #~ msgid "Reason for price:" #~ msgstr "Обоснование цены:" #~ msgid "Fetch content link from server" #~ msgstr "Получение от сервера ссылки на материалы" #~ msgid "Upload content" #~ msgstr "Загрузка материалов на сервер" #~ msgid "Upload first preview" #~ msgstr "Загрузка первой миниатюры на сервер" #~ msgid "Note: You can edit, update and delete your content on the website." #~ msgstr "" #~ "Примечание: вы можете редактировать, обновлять и удалять свои материалы " #~ "на веб-сайте." #~ msgid "Upload second preview" #~ msgstr "Загрузка второй миниатюры на сервер" #~ msgid "Upload third preview" #~ msgstr "Загрузка третьей миниатюры на сервер" #~ msgid "" #~ "I ensure that this content does not violate any existing copyright, law " #~ "or trademark. I agree for my IP address to be logged. (Distributing " #~ "content without the permission of the copyright holder is illegal.)" #~ msgstr "" #~ "Я подтверждаю, что эти материалы не нарушают авторских прав, законов или " #~ "прав на торговые марки. Я разрешаю записать мой IP-адрес. " #~ "(Распространение материалов без разрешения правообладателя незаконно.)" #~ msgid "Start Upload" #~ msgstr "Начать загрузку" #~ msgid "Play a &sound" #~ msgstr "Воспроизвести &звук" #~ msgid "Select the sound to play" #~ msgstr "Выберите звуковой файл" #~ msgid "Show a message in a &popup" #~ msgstr "Показать &сообщение во всплывающем окне" #~ msgid "Log to a file" #~ msgstr "&Сохранять в файле журнала" #~ msgid "Mark &taskbar entry" #~ msgstr "Выдели&ть программу в панели задач" #~ msgid "Run &command" #~ msgstr "Выполнить &программу" #~ msgid "Select the command to run" #~ msgstr "Выберите программу" #~ msgid "Sp&eech" #~ msgstr "З&ачитать" #~ msgid "" #~ "Specifies how Jovie should speak the event when received. If you " #~ "select \"Speak custom text\", enter the text in the box. You may use the " #~ "following substitution strings in the text:
    %e
    Name of the " #~ "event
    %a
    Application that sent the event
    %m
    The message sent by the application
    " #~ msgstr "" #~ "Что произносить при возникновении события. В случае выбора варианта " #~ "«Зачитать указанный мною текст», введите текст в соответствующее поле. " #~ "Возможно использование следующих обозначений:
    %e
    категория " #~ "события
    %a
    приложение-источник события
    %m
    сообщение, переданное приложением
    " #~ msgid "Speak Event Message" #~ msgstr "Зачитать содержание события" #~ msgid "Speak Event Name" #~ msgstr "Зачитать название события" #~ msgid "Speak Custom Text" #~ msgstr "Зачитать указанный мною текст" #~ msgid "Configure Notifications" #~ msgstr "Настройка уведомлений" #~ msgctxt "State of the notified event" #~ msgid "State" #~ msgstr "Состояние" #~ msgctxt "Title of the notified event" #~ msgid "Title" #~ msgstr "Заголовок" #~ msgctxt "Description of the notified event" #~ msgid "Description" #~ msgstr "Описание" #~ msgid "Do you want to search the Internet for %1?" #~ msgstr "Выполнить поиск %1 в Интернете?" #~ msgid "Internet Search" #~ msgstr "Поиск в Интернет" #~ msgid "&Search" #~ msgstr "&Поиск" #~ msgctxt "@label Type of file" #~ msgid "Type: %1" #~ msgstr "Тип: %1" #~ msgctxt "@label:checkbox" #~ msgid "Remember action for files of this type" #~ msgstr "В будущем поступать с файлами этого типа так же" #~ msgctxt "@label:button" #~ msgid "&Open with %1" #~ msgstr "&Открыть в программе «%1»" #~ msgctxt "@action:inmenu" #~ msgid "Open &with %1" #~ msgstr "Открыть &в программе «%1»" #~ msgctxt "@info" #~ msgid "Open '%1'?" #~ msgstr "Открыть «%1»?" #~ msgctxt "@label:button" #~ msgid "&Open with..." #~ msgstr "&Открыть с помощью..." #~ msgctxt "@label:button" #~ msgid "&Open with" #~ msgstr "&Открыть с помощью..." #~ msgctxt "@label:button" #~ msgid "&Open" #~ msgstr "&Открыть" #~ msgctxt "@label File name" #~ msgid "Name: %1" #~ msgstr "Имя файла: %1" #~ msgctxt "@info:whatsthis" #~ msgid "This is the file name suggested by the server" #~ msgstr "Имя файла, предложенное сервером." #~ msgid "Do you really want to execute '%1'?" #~ msgstr "Выполнить «%1»?" #~ msgid "Execute File?" #~ msgstr "Выполнить файл?" #~ msgid "Accept" #~ msgstr "Принять" #~ msgid "Reject" #~ msgstr "Отклонить" #~ msgid "Untitled" #~ msgstr "Безымянный" #~ msgid "" #~ "The document \"%1\" has been modified.\n" #~ "Do you want to save your changes or discard them?" #~ msgstr "" #~ "Документ «%1» был изменён.\n" #~ "Сохранить изменения или отклонить их?" #~ msgid "Close Document" #~ msgstr "Закрыть документ" #~ msgid "Error reading from PTY" #~ msgstr "Ошибка чтения из PTY" #~ msgid "Error writing to PTY" #~ msgstr "Ошибка записи в PTY" #~ msgid "PTY operation timed out" #~ msgstr "Истекло время ожидания завершения операции PTY" #~ msgid "Error opening PTY" #~ msgstr "Ошибка открытия PTY" #~ msgid "Kross" #~ msgstr "Kross" #~ msgid "KDE application to run Kross scripts." #~ msgstr "Приложение KDE для запуска скриптов Kross." #~ msgid "(C) 2006 Sebastian Sauer" #~ msgstr "© Sebastian Sauer, 2006" #~ msgid "Run Kross scripts." #~ msgstr "Запуск скриптов Kross." #~ msgid "Sebastian Sauer" #~ msgstr "Sebastian Sauer" #~ msgid "Scriptfile" #~ msgstr "Скрипт" #~ msgid "Scriptfile \"%1\" does not exist." #~ msgstr "Файл скрипта «%1» не найден." #~ msgid "Failed to determine interpreter for scriptfile \"%1\"" #~ msgstr "Не удалось определить интерпретатор для скрипта «%1»" #~ msgid "Failed to open scriptfile \"%1\"" #~ msgstr "Не удалось открыть файл скрипта «%1»" #~ msgid "Failed to load interpreter \"%1\"" #~ msgstr "Не удалось загрузить интерпретатор «%1»" #~ msgid "No such interpreter \"%1\"" #~ msgstr "Неизвестный интерпретатор «%1»" #~ msgid "Failed to create script for interpreter \"%1\"" #~ msgstr "Не удалось создать скрипт для интерпретатора «%1»" #~ msgid "Level of safety of the Ruby interpreter" #~ msgstr "Уровень безопасности интерпретатора Ruby" #~ msgid "Cancel?" #~ msgstr "Отменить?" #~ msgid "No such function \"%1\"" #~ msgstr "Функция «%1» не существует" #~ msgid "Text:" #~ msgstr "Текст:" #~ msgid "Comment:" #~ msgstr "Комментарий:" #~ msgid "Icon:" #~ msgstr "Значок:" #~ msgid "Interpreter:" #~ msgstr "Интерпретатор:" #~ msgid "File:" #~ msgstr "Файл:" #~ msgid "Execute the selected script." #~ msgstr "Запустить выбранный скрипт." #~ msgid "Stop execution of the selected script." #~ msgstr "Остановить выполнение выбранного скрипта." #~ msgid "Edit..." #~ msgstr "Изменить..." #~ msgid "Edit selected script." #~ msgstr "Изменить выбранный скрипт." #~ msgid "Add..." #~ msgstr "Добавить..." #~ msgid "Add a new script." #~ msgstr "Создать новый скрипт." #~ msgid "Remove selected script." #~ msgstr "Удалить выбранный скрипт." #~ msgid "Edit" #~ msgstr "Правка" #~ msgctxt "@title:group Script properties" #~ msgid "General" #~ msgstr "Главное" #~ msgid "The module %1 could not be found." #~ msgstr "Модуль %1 не найден." #~ msgid "" #~ "

    The diagnosis is:
    The desktop file %1 could not be found." #~ msgstr "

    Проблема:
    не удалось найти файл %1.

    " #~ msgid "The module %1 is disabled." #~ msgstr "Модуль %1 отключен." #~ msgid "" #~ "

    Either the hardware/software the module configures is not " #~ "available or the module has been disabled by the administrator.

    " #~ msgstr "" #~ "

    Не найдено оборудование или программное обеспечение для работы " #~ "модуля или использование модуля отключено администратором.

    " #~ msgid "The module %1 is not a valid configuration module." #~ msgstr "Модуль %1 не является правильным модулем настройки KDE." #~ msgid "" #~ "The diagnosis is:
    The desktop file %1 does not specify a library." #~ "    " #~ msgstr "Проблема:
    файл %1 не содержит имя библиотеки.    " #~ msgid "There was an error loading the module." #~ msgstr "При загрузке модуля произошла ошибка." #~ msgid "" #~ "The diagnosis is:
    %1

    Possible reasons:

    • An error " #~ "occurred during your last KDE upgrade leaving an orphaned control module
    • You have old third party modules lying around.

    Check " #~ "these points carefully and try to remove the module mentioned in the " #~ "error message. If this fails, consider contacting your distributor or " #~ "packager.

    " #~ msgstr "" #~ "Проблема:
    %1

    Возможные причины:

    • Ошибка при " #~ "последнем обновлении KDE, в результате которой остался модуль управления " #~ "от предыдущей версии;
    • У вас установлены сторонние модули " #~ "настройки.

    Внимательно проверьте эти пункты и удалите " #~ "перечисленные выше модули. Если ошибка повторяется, обратитесь к " #~ "поставщику пакетов.

    " #~ msgid "" #~ "

    Possible reasons:

    • An error occurred during your last KDE " #~ "upgrade leaving an orphaned control module
    • You have old third " #~ "party modules lying around.

    Check these points carefully " #~ "and try to remove the module mentioned in the error message. If this " #~ "fails, consider contacting your distributor or packager.

    " #~ msgstr "" #~ "

    Возможные причины:

    • Ошибка при последнем обновлении KDE, в " #~ "результате которой остался модуль настройки от предыдущей версии
    • У вас установлены сторонние модули настройки.

    Внимательно проверьте эти пункты и удалите перечисленные выше " #~ "модули. Если ошибка повторяется, обратитесь к поставщику пакетов.

    " #~ msgctxt "Argument is application name" #~ msgid "This configuration section is already opened in %1" #~ msgstr "Этот модуль настройки уже открыт в %1" #~ msgid "" #~ "The settings of the current module have changed.\n" #~ "Do you want to apply the changes or discard them?" #~ msgstr "" #~ "В текущем модуле имеются несохранённые изменения.\n" #~ "Применить их?" #~ msgid "Apply Settings" #~ msgstr "Сохранение параметров" #~ msgid "Distance between desktop icons" #~ msgstr "Расстояние между значками на рабочем столе" #~ msgid "The distance between icons specified in pixels." #~ msgstr "Расстояние между значками в пикселах." #~ msgid "Widget style to use" #~ msgstr "Стиль элементов интерфейса" #~ msgid "" #~ "The name of the widget style, for example \"keramik\" or \"plastik\". " #~ "Without quotes." #~ msgstr "" #~ "Название стиля элементов интерфейса, например, «keramik» или " #~ "«plastik» (без кавычек)." #~ msgid "Use the PC speaker" #~ msgstr "Использовать динамик, встроенный в системный блок" #~ msgid "" #~ "Whether the ordinary PC speaker should be used instead of KDE's own " #~ "notifications system." #~ msgstr "" #~ "Использовать ли динамик, встроенный в системный блок, вместо системы " #~ "уведомлений KDE." #~ msgid "What terminal application to use" #~ msgstr "Какое терминальное приложение использовать" #~ msgid "" #~ "Whenever a terminal application is launched this terminal emulator " #~ "program will be used.\n" #~ msgstr "Какое приложение использовать для терминала.\n" #~ msgid "Fixed width font" #~ msgstr "Моноширинный шрифт" #~ msgid "" #~ "This font is used when a fixed font is needed. A fixed font has a " #~ "constant width.\n" #~ msgstr "" #~ "Этот шрифт будет использован при выводе текста моноширинным шрифтом. Все " #~ "символы моноширинного шрифта имеют одинаковую ширину.\n" #~ msgid "System wide font" #~ msgstr "Системный шрифт" #~ msgid "Font for menus" #~ msgstr "Шрифт меню" #~ msgid "What font to use for menus in applications." #~ msgstr "Шрифт, который будет использоваться для меню." #~ msgid "Color for links" #~ msgstr "Цвет ссылок" #~ msgid "What color links should be that have not yet been clicked on" #~ msgstr "Цвет не посещённых ссылок" #~ msgid "Color for visited links" #~ msgstr "Цвет посещённых ссылок" #~ msgid "Font for the taskbar" #~ msgstr "Шрифт панели задач" #~ msgid "" #~ "What font to use for the panel at the bottom of the screen, where the " #~ "currently running applications are." #~ msgstr "" #~ "Шрифт, который будет использован для панели со списком запущенных " #~ "программ." #~ msgid "Fonts for toolbars" #~ msgstr "Шрифт панелей инструментов" #~ msgid "Shortcut for taking screenshot" #~ msgstr "Комбинация клавиш для создания снимка экрана" #~ msgid "Shortcut for toggling Clipboard Actions on and off" #~ msgstr "" #~ "Комбинация клавиш для включения и выключения действий с содержимым буфера " #~ "обмена" #~ msgid "Shortcut for shutting down the computer without confirmation" #~ msgstr "Комбинация клавиш для выключения компьютера без подтверждения" #~ msgid "Show directories first" #~ msgstr "Папки в начале" #~ msgid "" #~ "Whether directories should be placed at the top when displaying files" #~ msgstr "Помещать ли папки перед списком файлов" #~ msgid "The URLs recently visited" #~ msgstr "Посещённые ссылки" #~ msgid "Used for auto-completion in file dialogs, for example" #~ msgstr "Используется для автодополнения в диалогах, например" #~ msgid "Show file preview in file dialog" #~ msgstr "Показывать предварительный просмотр в диалогах выбора файла" #~ msgid "Show hidden files" #~ msgstr "Показывать скрытые файлы" #~ msgid "" #~ "Whether files starting with a dot (convention for hidden files) should be " #~ "shown" #~ msgstr "" #~ "При включении этого параметра будут показываться скрытые файлы и папки " #~ "(имена которых начинается с точки)" #~ msgid "Show speedbar" #~ msgstr "Показать панель быстрого доступа" #~ msgid "" #~ "Whether the shortcut icons to the left in the file dialog should be shown" #~ msgstr "" #~ "Показывать панель со значками быстрого доступа к папкам с левой стороны " #~ "диалога выбора файла" #~ msgid "What country" #~ msgstr "Страна" #~ msgid "" #~ "Used to determine how to display numbers, currency and time/date, for " #~ "example" #~ msgstr "" #~ "Используется для определения формата показа чисел, денежных сумм, даты и " #~ "времени" #~ msgid "What language to use to display text" #~ msgstr "Язык текста" #~ msgid "Character used for indicating positive numbers" #~ msgstr "Символ, используемый для показа положительных чисел" #~ msgid "Most countries have no character for this" #~ msgstr "Большинство стран не использует такой символ" #~ msgid "Path to the autostart directory" #~ msgstr "Путь к папке автозапуска" #~ msgid "" #~ "Path to the directory containing executables to be run on session login" #~ msgstr "" #~ "Путь к папке, содержащей исполняемые файлы, которые выполняются в начале " #~ "сеанса KDE" #~ msgid "Enable SOCKS support" #~ msgstr "Включить поддержку SOCKS" #~ msgid "Whether SOCKS version 4 and 5 should be enabled in KDE's sub systems" #~ msgstr "Использовать поддержку SOCKS версии 4 и 5 в KDE" #~ msgid "Path to custom SOCKS library" #~ msgstr "Путь к библиотеке SOCKS" #~ msgid "Highlight toolbar buttons on mouse over" #~ msgstr "" #~ "Подсвечивать кнопки на панелях инструментов при наведении на них курсором " #~ "мыши" #~ msgid "Show text on toolbar icons " #~ msgstr "Показывать надписи на кнопках панелей инструментов" #~ msgid "Whether text should be shown in addition to icons on toolbar icons" #~ msgstr "" #~ "Показывать надписи на кнопках панелей инструментов в дополнении к значкам" #~ msgid "Password echo type" #~ msgstr "Показ символов при вводе пароля" #~ msgid "" #~ "Automatic changes have been performed due to plugin dependencies. Click " #~ "here for further information" #~ msgstr "" #~ "Для удовлетворения зависимости расширения будут предприняты некоторые " #~ "автоматические изменения. Нажмите здесь для получения дополнительной " #~ "информации" #~ msgid "" #~ "Automatic changes have been performed in order to satisfy plugin " #~ "dependencies:\n" #~ msgstr "" #~ "Для удовлетворения зависимости расширения будут предприняты следующие " #~ "автоматические изменения:\n" #~ msgid "" #~ "\n" #~ " %1 plugin has been automatically checked because of the dependency of " #~ "%2 plugin" #~ msgstr "" #~ "\n" #~ " Расширение %1 будет выбрано, так как от него зависит расширение %2" #~ msgid "" #~ "\n" #~ " %1 plugin has been automatically unchecked because of its dependency " #~ "on %2 plugin" #~ msgstr "" #~ "\n" #~ " Расширение %1 не будет выбрано, так как зависит от расширения %2" #~ msgid "Dependency Check" #~ msgstr "Проверка зависимостей" #~ msgid "%1 plugin automatically added due to plugin dependencies" #~ msgid_plural "%1 plugins automatically added due to plugin dependencies" #~ msgstr[0] "%1 расширение автоматически добавлено при проверке зависимостей" #~ msgstr[1] "%1 расширения автоматически добавлены при проверке зависимостей" #~ msgstr[2] "%1 расширений автоматически добавлены при проверке зависимостей" #~ msgstr[3] "%1 расширение автоматически добавлено при проверке зависимостей" #~ msgid ", " #~ msgstr ", " #~ msgid "%1 plugin automatically removed due to plugin dependencies" #~ msgid_plural "%1 plugins automatically removed due to plugin dependencies" #~ msgstr[0] "%1 расширение автоматически удалено при проверке зависимостей" #~ msgstr[1] "%1 расширения автоматически удалены при проверке зависимостей" #~ msgstr[2] "%1 расширений автоматически удалены при проверке зависимостей" #~ msgstr[3] "%1 расширение автоматически удалено при проверке зависимостей" #~ msgid "Search Plugins" #~ msgstr "Поиск расширений" #~ msgctxt "Used only for plugins" #~ msgid "About %1" #~ msgstr "О расширении %1" #~ msgid "Could not load print preview part" #~ msgstr "Не удалось загрузить компонент предварительного просмотра" #~ msgid "Print Preview" #~ msgstr "Предварительный просмотр" #~ msgid "Select Components" #~ msgstr "Выберите компоненты" #~ msgid "Enable component" #~ msgstr "Включить компонент" #~ msgid "Success" #~ msgstr "Выполнено" #~ msgid "Communication error" #~ msgstr "Ошибка связи" #~ msgid "Invalid type in Database" #~ msgstr "Недопустимый тип в базе данных" #~ msgctxt "" #~ "@title UDS_DISPLAY_NAME for a KIO directory listing. %1 is the query the " #~ "user entered." #~ msgid "Query Results from '%1'" #~ msgstr "Результаты поиска «%1»" #~ msgctxt "@title UDS_DISPLAY_NAME for a KIO directory listing." #~ msgid "Query Results" #~ msgstr "Результаты поиска" #~ msgctxt "" #~ "Boolean AND keyword in desktop search strings. You can add several " #~ "variants separated by spaces, e.g. retain the English one alongside the " #~ "translation; keywords are not case sensitive. Make sure there is no " #~ "conflict with the OR keyword." #~ msgid "and" #~ msgstr "and и" #~ msgctxt "" #~ "Boolean OR keyword in desktop search strings. You can add several " #~ "variants separated by spaces, e.g. retain the English one alongside the " #~ "translation; keywords are not case sensitive. Make sure there is no " #~ "conflict with the AND keyword." #~ msgid "or" #~ msgstr "or или" #~ msgid "Nepomuk Resource Class Generator" #~ msgstr "Генератор классов ресурсов Nepomuk" #~ msgid "(c) 2006-2009, Sebastian Trüg" #~ msgstr "© Sebastian Trüg, 2006-2009" #~ msgid "Sebastian Trüg" #~ msgstr "Sebastian Trüg" #~ msgid "Maintainer" #~ msgstr "Сопровождающий" #~ msgid "Tobias Koenig" #~ msgstr "Tobias Koenig" #~ msgid "Major cleanup - Personal hero of maintainer" #~ msgstr "Подчистка кода; личный герой сопровождающего" #~ msgid "Verbose output debugging mode." #~ msgstr "Подробный вывод для отладки." #~ msgid "" #~ "Generate simple and fast wrapper classes not based on Nepomuk::Resource " #~ "which do not provide any data integrity checking" #~ msgstr "" #~ "Генерация компактных и быстрых классов, не базирующихся на Nepomuk::" #~ "Resource, который не обеспечивает проверки целостности данных." #~ msgid "Actually generate the code." #~ msgstr "Генерация кода." #~ msgid "List all includes (deprecated)." #~ msgstr "Список всех включаемых файлов (устаревшее)." #~ msgid "" #~ "List all header files that will be generated via the --writeall command." #~ msgstr "Список всех включаемых файлов, генерируемых командой --writeall." #~ msgid "" #~ "List all source files that will be generated via the --writeall command." #~ msgstr "Список всех файлов кода, генерируемых командой --writeall." #~ msgid "" #~ "The ontology files containing the ontologies to be generated, a space " #~ "separated list (deprecated: use arguments instead.)" #~ msgstr "" #~ "Файл онтологий, для которых нужно сгенерировать онтологии. Файлы " #~ "указываются в виде разделённого пробелами списка (устаревшее, вместо " #~ "этого используйте отдельные параметры командной строки)." #~ msgid "Include path prefix (deprecated)" #~ msgstr "Префикс пути к заголовочным файлам (устаревшее)" #~ msgid "Specify the target folder to store generated files into." #~ msgstr "Папка для генерируемых файлов." #~ msgid "Templates to be used (deprecated)." #~ msgstr "Используемые шаблоны (устаревшее)." #~ msgid "" #~ "Optionally specify the classes to be generated. Use option multiple times " #~ "(defaults to all classes)" #~ msgstr "" #~ "Необязательное указание генерируемых классов (по умолчанию — все классы). " #~ "Этот ключ можно использовать несколько раз для указания нескольких " #~ "классов." #~ msgid "" #~ "Serialization used in the ontology files. Will default to primitive file " #~ "extension detection." #~ msgstr "" #~ "Используемый тип сериализации в файлах онтологий. По умолчанию " #~ "определяется по расширению файла." #~ msgid "" #~ "Set the used visibility in case the classes are to be used in public API. " #~ " will be used to construct the export macro name and the " #~ "export header. By default classes will not be exported." #~ msgstr "" #~ "Видимость классов для публичного API. Для генерации экспортирующего " #~ "заголовочного файла и имён макросов используется . По " #~ "умолчанию классы не экспортируются." #~ msgid "The ontology files containing the ontologies to be generated." #~ msgstr "Файлы онтологий для генерируемой онтологии." #~ msgctxt "@title:window" #~ msgid "Change Tags" #~ msgstr "Изменение меток" #~ msgctxt "@title:window" #~ msgid "Add Tags" #~ msgstr "Добавление меток" #~ msgctxt "@label:textbox" #~ msgid "Configure which tags should be applied." #~ msgstr "Выберите метки для объектов." #~ msgctxt "@label" #~ msgid "Create new tag:" #~ msgstr "Новая метка:" #~ msgctxt "@info" #~ msgid "Delete tag" #~ msgstr "Удалить метку" #~ msgctxt "@info" #~ msgid "" #~ "Should the tag %1 really be deleted for all files?" #~ msgstr "Убрать метку %1 со всех файлов?" #~ msgctxt "@title" #~ msgid "Delete tag" #~ msgstr "Удаление метки" #~ msgctxt "@action:button" #~ msgid "Delete" #~ msgstr "Удалить" #~ msgctxt "@action:button" #~ msgid "Cancel" #~ msgstr "Отмена" #~ msgid "Changing annotations" #~ msgstr "Изменение аннотаций" #~ msgctxt "@label" #~ msgid "Show all tags..." #~ msgstr "Показать все метки..." #~ msgctxt "@label" #~ msgid "Add Tags..." #~ msgstr "Добавить..." #~ msgctxt "@label" #~ msgid "Change..." #~ msgstr "Изменить..." #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Anytime" #~ msgstr "Дата не важна" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Today" #~ msgstr "Сегодня" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Yesterday" #~ msgstr "Вчера" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "This Week" #~ msgstr "На этой неделе" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Last Week" #~ msgstr "На прошлой неделе" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "This Month" #~ msgstr "В этом месяце" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Last Month" #~ msgstr "В прошлом месяце" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "This Year" #~ msgstr "В этом году" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources" #~ msgid "Last Year" #~ msgstr "В прошлом году" #~ msgctxt "" #~ "referring to a filter on the modification and usage date of files/" #~ "resources that will open a dialog to choose a date range" #~ msgid "Custom..." #~ msgstr "Другая дата..." #~ msgid "This Week" #~ msgstr "На этой неделе" #~ msgid "This Month" #~ msgstr "В этом месяце" #~ msgid "Anytime" #~ msgstr "В любое время" #~ msgid "Before" #~ msgstr "До" #~ msgid "After" #~ msgstr "После" #~ msgctxt "" #~ "@option:check An item in a list of resources that allows to query for " #~ "more resources to put in the list" #~ msgid "More..." #~ msgstr "Дополнительно..." #~ msgctxt "@option:check A filter on file type" #~ msgid "Documents" #~ msgstr "Документы" #~ msgctxt "@option:check A filter on file type - audio files" #~ msgid "Audio" #~ msgstr "Аудиофайлы" #~ msgctxt "@option:check A filter on file type - media video" #~ msgid "Video" #~ msgstr "Видеофайлы" #~ msgctxt "@option:check A filter on file type" #~ msgid "Images" #~ msgstr "Изображения" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "No priority" #~ msgstr "Без приоритета" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "Last modified" #~ msgstr "Последние изменённые" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "Most important" #~ msgstr "Наиболее важные" #~ msgctxt "" #~ "@option:radio A filter on prioritizing/sorting a selection of resources" #~ msgid "Never opened" #~ msgstr "Ни разу не открытые" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "Any Rating" #~ msgstr "Оценка не важна" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "1 or more" #~ msgstr "1 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "2 or more" #~ msgstr "2 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "3 or more" #~ msgstr "3 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "4 or more" #~ msgstr "4 и выше" #~ msgctxt "@option:radio A filter on the rating of a resource" #~ msgid "Max Rating" #~ msgstr "Максимальная оценка" #~ msgctxt "" #~ "@title KCategorizedSortFilterProxyModel grouping for all Nepomukj " #~ "resources that are of type rdfs:Resource" #~ msgid "Miscellaneous" #~ msgstr "Разное" #~ msgctxt "@title:column The Nepomuk resource label and icon" #~ msgid "Resource" #~ msgstr "Источник" #~ msgctxt "@title:column The Nepomuk resource's RDF type" #~ msgid "Resource Type" #~ msgstr "Тип источника" #~ msgid "Enter Search Terms..." #~ msgstr "Введите текст для поиска..." #~ msgctxt "@option:check A filter on resource type" #~ msgid "Contacts" #~ msgstr "Контакты" #~ msgctxt "@option:check A filter on resource type" #~ msgid "Emails" #~ msgstr "Адреса электронной почты" #~ msgctxt "@option:check A filter on resource type" #~ msgid "Tasks" #~ msgstr "Задачи" #~ msgctxt "@option:check A filter on resource type" #~ msgid "Tags" #~ msgstr "Метки" #~ msgctxt "@option:check Do filter on type - show only files" #~ msgid "Files" #~ msgstr "Файлы" #~ msgctxt "@option:check Do filter on type - show everything but files" #~ msgid "Other" #~ msgstr "Другое" #~ msgid "ThreadWeaver Jobs Examples" #~ msgstr "Примеры заданий ThreadWeaver" #~ msgid "" #~ "The program executes 100 jobs in 4 threads. Each job waits for a random " #~ "number of milliseconds between 1 and 1000." #~ msgstr "" #~ "Программа запускает 100 заданий в 4 потоках. Каждое задание находится в " #~ "ожидании случайный период от 1 до 1000 миллисекунд." #~ msgid "" #~ "Check to see logging information about thread activity. Watch the console " #~ "output to see the log information." #~ msgstr "" #~ "Установите флажок для вывода информации по активности программных потоков " #~ "на консоль." #~ msgid "Log thread activity" #~ msgstr "Вывод активности потоков" #~ msgid "Displays Thread Activity" #~ msgstr "Показывает активность потоков" #~ msgid "Start" #~ msgstr "Запуск" #~ msgid "GUI based example for the Weaver Thread Manager" #~ msgstr "Пример использования ThreadWeaver с графическим интерфейсом" #~ msgid "Remaining number of jobs:" #~ msgstr "Оставшееся число заданий:" #~ msgid "What time is it? Click to update." #~ msgstr "Сколько времени? Нажмите для обновления." #~ msgid "" #~ "

    (do not know yet)

    " #~ msgstr "" #~ "

    (нет данных)

    " #~ msgid "Select Files..." #~ msgstr "Выбор файлов..." #~ msgid "Cancel" #~ msgstr "Отмена" #~ msgid "Suspend" #~ msgstr "Приостановить" #~ msgid "Anonymous" #~ msgstr "Анонимно"