Index: trunk/l10n-support/gl/summit/messages/extragear-office/kile.po =================================================================== --- trunk/l10n-support/gl/summit/messages/extragear-office/kile.po (revision 1557103) +++ trunk/l10n-support/gl/summit/messages/extragear-office/kile.po (revision 1557104) @@ -1,14629 +1,15522 @@ # translation of kile.po to galician # Martina Ramilo Pereira , 2004, 2005. # mvillarino , 2006, 1904, 2008, 2009. # Xabi G. Feal , 2006. # Marce Villarino , 2008, 2009. # marce villarino , 2009. # Marce Villarino , 2012, 2013, 2014. # Xosé , 2013. # Adrián Chaves Fernández , 2013, 2015, 2016, 2017. # Adrián Chaves (Gallaecio) , 2017, 2018, 2019. # marce, 2009. msgid "" msgstr "" "Project-Id-Version: kile\n" "Report-Msgid-Bugs-To: https://bugs.kde.org\n" "POT-Creation-Date: 2019-11-23 10:27+0100\n" -"PO-Revision-Date: 2019-07-21 10:46+0200\n" +"PO-Revision-Date: 2019-11-28 00:39+0100\n" "Last-Translator: Adrián Chaves (Gallaecio) \n" -"Language-Team: Galician \n" +"Language-Team: Galician \n" "Language: gl\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=n != 1;\n" +"X-Generator: Lokalize 19.08.3\n" #. +> trunk5 #, kde-format msgctxt "NAME OF TRANSLATORS" msgid "Your names" msgstr "" "Martina Ramilo Pereira,\n" "Xabi G. Feal,\n" "mvillarino,\n" "Xosé" #. +> trunk5 #, kde-format msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" msgstr "" -"martina.ramilo@hispalinux.es, xabigf@gmx.net, mvillarino@users.sourceforge.net,\n" +"martina.ramilo@hispalinux.es, xabigf@gmx.net," +" mvillarino@users.sourceforge.net,\n" "xosecalvo@gmail.com" #. +> trunk5 #: abbreviationmanager.cpp:101 #, kde-format msgid "" "Could not save the local abbreviation list.\n" "Error code %1." msgstr "Non se puido gardar a lista de abreviaturas local. Código de erro %1." #. +> trunk5 #: abbreviationmanager.cpp:102 #, kde-format msgid "Saving Problem" msgstr "Problema de garda" #. +> trunk5 #: configtester.cpp:223 #, kde-format msgid "Running in Kile" msgstr "Estase a executar en Kile" #. +> trunk5 #: configtester.cpp:247 #, kde-format msgid "" "Tool not found.\n" -"Kile is not configured correctly. Go to Settings->Configure Kile->Tools and either fix the problem or change to the default settings." +"Kile is not configured correctly. Go to Settings->Configure Kile->Tools and" +" either fix the problem or change to the default settings." msgstr "" "Non foi posíbel atopar a ferramenta.\n" -"Kile non está configurado correctamente. Abra «Configuración → Configurar Kile → Ferramentas» e solucione o problema ou cambie as opcións predeterminadas." +"Kile non está configurado correctamente. Abra «Configuración → Configurar" +" Kile → Ferramentas» e solucione o problema ou cambie as opcións" +" predeterminadas." #. +> trunk5 #: configtester.cpp:269 configtester.cpp:466 dialogs/configcheckerdialog.cpp:80 #, kde-format msgid "Passed" msgstr "Aprobado" #. +> trunk5 #: configtester.cpp:279 configtester.cpp:477 #, kde-format msgid "Failed" msgstr "Fallou" #. +> trunk5 #: configtester.cpp:298 #, kde-format msgid "Version" msgstr "Versión" #. +> trunk5 #: configtester.cpp:325 #, kde-format msgid "Embedding of Okular is supported" msgstr "Permítese a incrustación de Okular." #. +> trunk5 #: configtester.cpp:337 #, kde-format msgid "Binary" msgstr "Binario" #. +> trunk5 #: configtester.cpp:364 #, kde-format msgctxt "additional failure message given as argument" msgid "Could not find the binary for this essential tool. %1" msgstr "Non se puido atopar o executábel desta utilidade esencial. %1" #. +> trunk5 #: configtester.cpp:368 #, kde-format msgctxt "additional failure message given as argument" msgid "No executable '%1' found. %2" msgstr "Non foi posíbel atopar o executábel «%1». %2" #. +> trunk5 #: configtester.cpp:373 #, kde-format msgid "Could not find the binary for this essential tool" msgstr "Non se puido atopar o binario desta utilidade esencial." #. +> trunk5 #: configtester.cpp:376 #, kde-format msgid "No executable '%1' found" msgstr "Non foi posíbel atopar o executábel «%1»" #. +> trunk5 #: configtester.cpp:382 #, kde-format msgctxt "executable => path" msgid "Found (%1 => %2)" msgstr "Atopado ( %1 => %2)" #. +> trunk5 #: configtester.cpp:397 #, kde-format msgid "Simple Test" msgstr "Proba simple" #. +> trunk5 #: configtester.cpp:474 #, kde-format msgid "This essential tool does not work; please check your installation." msgstr "Esta utilidade esencial non funciona; comprobe a instalación." #. +> trunk5 #: configtester.cpp:489 #, kde-format msgid "Source Specials Switch" msgstr "Conmutar a trazabilidade da orixe" #. +> trunk5 #: configtester.cpp:521 #, kde-format -msgid "Supported, use the 'Modern' configuration for (La)TeX to auto-enable inverse and forward search capabilities." -msgstr "Admitido; empregue a configuración «Moderna» para (La)TeX e PDF(La)TeX para activar automaticamente as capacidades da busca inversa e avanzada." +msgid "" +"Supported, use the 'Modern' configuration for (La)TeX to auto-enable inverse" +" and forward search capabilities." +msgstr "" +"Admitido; empregue a configuración «Moderna» para (La)TeX e PDF(La)TeX para" +" activar automaticamente as capacidades da busca inversa e avanzada." #. +> trunk5 #: configtester.cpp:528 #, kde-format -msgid "Not supported, use the srcltx package to enable the inverse and forward search capabilities." -msgstr "Non se admite; use o paquete srcltx para activar as capacidades de busca inversa e avanzada." +msgid "" +"Not supported, use the srcltx package to enable the inverse and forward" +" search capabilities." +msgstr "" +"Non se admite; use o paquete srcltx para activar as capacidades de busca" +" inversa e avanzada." #. +> trunk5 #: configtester.cpp:539 #, kde-format msgid "SyncTeX Support" msgstr "Compatibilidade con SyncTeX" #. +> trunk5 #: configtester.cpp:548 #, kde-format -msgid "Supported, use the 'Modern' configuration for PDFLaTeX and XeLaTeX to auto-enable inverse and forward search capabilities." -msgstr "Admitido; empregue a configuración «Moderna» para (La)TeX e PDF(La)TeX para activar automaticamente as capacidades da busca inversa e avanzada." +msgid "" +"Supported, use the 'Modern' configuration for PDFLaTeX and XeLaTeX to" +" auto-enable inverse and forward search capabilities." +msgstr "" +"Admitido; empregue a configuración «Moderna» para (La)TeX e PDF(La)TeX para" +" activar automaticamente as capacidades da busca inversa e avanzada." #. +> trunk5 #: configtester.cpp:555 #, kde-format msgid "Not supported" msgstr "Non admitido" #. +> trunk5 #: configtester.cpp:797 #, kde-format msgid "PNG previews cannot be used for mathgroups in the bottom preview pane" -msgstr "Non poden usarse as vistas previas de PNG para mathgroups no panel de vista previa do fondo." +msgstr "" +"Non poden usarse as vistas previas de PNG para mathgroups no panel de vista" +" previa do fondo." #. +> trunk5 #: configtester.cpp:807 #, kde-format -msgid "PNG previews cannot be used with conversions 'dvi->ps->png' and 'pdf->png' in the bottom preview pane" -msgstr "Non poden usarse as vistas previas de PNG empregada coas conversións «dvi->ps->png» en «pdf->png» no panel de vista previa do fondo." +msgid "" +"PNG previews cannot be used with conversions 'dvi->ps->png' and 'pdf->png' in" +" the bottom preview pane" +msgstr "" +"Non poden usarse as vistas previas de PNG empregada coas conversións «dvi-" +">ps->png» en «pdf->png» no panel de vista previa do fondo." #. +> trunk5 #: dialogs/abbreviationinputdialog.cpp:44 #, kde-format msgid "Add Abbreviation" msgstr "Engadir unha abreviatura" #. +> trunk5 #: dialogs/abbreviationinputdialog.cpp:53 #, kde-format msgid "Edit Abbreviation" msgstr "Editar a abreviatura" #. +> trunk5 #: dialogs/abbreviationinputdialog.cpp:60 #, kde-format msgid "&Abbreviation:" msgstr "&Abreviatura:" #. +> trunk5 #: dialogs/abbreviationinputdialog.cpp:62 #, kde-format msgid "&Expanded Text:" msgstr "Texto &expandido:" #. +> trunk5 #: dialogs/cleandialog.cpp:39 #, kde-format msgid "Delete Files" msgstr "Eliminar os ficheiros" #. +> trunk5 #: dialogs/cleandialog.cpp:62 #, kde-format msgid "Do you really want to delete these files?" msgstr "Seguro que quere eliminar estes ficheiros?" #. +> trunk5 #: dialogs/cleandialog.cpp:70 dialogs/listselector.cpp:59 #, kde-format msgid "Files" msgstr "Ficheiros" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:84 #, kde-format msgid "Critical failure, Kile will not function properly" msgstr "Fallo crítico; Kile non funcionará correctamente" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:88 #, kde-format msgid "Failed, but not critical" msgstr "Fallou, pero non é crítico." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:105 #, kde-format msgid "System Check" msgstr "Comprobación do sistema" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:113 #, kde-format msgid "" -"

This configuration assistant will check whether your system is set up correctly to process LaTeX documents. It will also allow to fine-tune the configuration of Kile while taking the results of the tests into account.

" -"

It is recommended to run this assistant before using Kile for the first time.

" +"

This configuration assistant will check whether your system is set up" +" correctly to process LaTeX documents. It will also allow to fine-tune the" +" configuration of Kile while taking the results of the tests into account.

" +"

It is recommended to run this assistant before using Kile for the first" +" time.

" "

Please press 'Next' now to start the test procedure.

" msgstr "" -"

Este asistente de configuración comproba se o sistema está configurado axeitadamente para procesar documentos en LaTeX. Tamén permite afinar a configuración de Kile tendo en conta os resultados das probas.

" -"

Recoméndase executar este asistente antes de empregar Kile pola primeira vez.

" +"

Este asistente de configuración comproba se o sistema está configurado" +" axeitadamente para procesar documentos en LaTeX. Tamén permite afinar a" +" configuración de Kile tendo en conta os resultados das probas.

" +"

Recoméndase executar este asistente antes de empregar Kile pola primeira" +" vez.

" "

Prema «Seguinte» agora para iniciar o procedemento de proba.

" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:124 #, kde-format msgid "System Check & Configuration Assistant" msgstr "Asistente de comprobación do sistema e configuración" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:127 #, kde-format msgid "Checking whether the system is set up correctly..." msgstr "Comprobando se o sistema está correctamente configurado…" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:147 #, kde-format msgid "Configure the viewer tools to use the document viewer" -msgstr "Configurar as ferramentas de visualización para empregar o visor de documentos" +msgstr "" +"Configurar as ferramentas de visualización para empregar o visor de documentos" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:149 #, kde-format msgid "Use the 'modern' configuration for the TeX, PDFTeX, and LaTeX tools" -msgstr "Empregar a configuración «moderna» para as ferramentas de TeX, PDFTeX e LaTeX" +msgstr "" +"Empregar a configuración «moderna» para as ferramentas de TeX, PDFTeX e LaTeX" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:151 #, kde-format -msgid "Use the 'modern' configuration for the PDFLaTeX, LuaLaTeX and XeLaTeX tools" -msgstr "Empregar a configuración «moderna» para as ferramentas de PDFLaTeX, LuaLaTeX e XeLaTeX" +msgid "" +"Use the 'modern' configuration for the PDFLaTeX, LuaLaTeX and XeLaTeX tools" +msgstr "" +"Empregar a configuración «moderna» para as ferramentas de PDFLaTeX, LuaLaTeX" +" e XeLaTeX" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:153 #, kde-format msgid "" "
" "Please press 'Finish' now to accept the recommended configuration changes." msgstr "" "
" "Prema «Rematar» agora para aceptar os cambios de configuración recomendados." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:156 dialogs/configcheckerdialog.cpp:230 #, kde-format msgid "Test Results" msgstr "Resultados da proba" #. +> trunk5 #: dialogs/configcheckerdialog.cpp:233 #, kde-format msgid "" "The following critical tests did not succeed:
" "
" "%1
" "
" -"Kile cannot function correctly on your system. Please consult the test results
" +"Kile cannot function correctly on your system. Please consult the test" +" results
" "to determine which programs have to be fixed." msgstr "" "As seguintes probas
" "críticas
" " non superaron satisfactorias:%1
" "
" -"Kile non pode funcionar correctamente neste sistema. Consulte os resultados das probas
" +"Kile non pode funcionar correctamente neste sistema. Consulte os resultados" +" das probas
" "para determinar que programas hai que arranxar." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:239 #, kde-format msgid "" "The following tests did not succeed:
" "
" "%1
" "
" -"You will still be able to use Kile; however, not all features are guaranteed to work." +"You will still be able to use Kile; however, not all features are guaranteed" +" to work." msgstr "" "As probas seguintes non foron satisfactorias:
" "
" "%1
" "
" -"Aínda así, pódese usar Kile; porén, non se garante que funcionen todas as funcionalidades." +"Aínda así, pódese usar Kile; porén, non se garante que funcionen todas as" +" funcionalidades." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:244 #, kde-format -msgid "No problems were detected. Kile will work correctly on your system." -msgstr "Non se detectaron problemas. Kile pode funcionar correctamente neste sistema." +msgid "" +"No problems were detected. Kile will work correctly on your system." +msgstr "" +"Non se detectaron problemas. Kile pode funcionar correctamente neste" +" sistema." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:257 #, kde-format -msgid "The embedded document viewer is available and live preview is supported." -msgstr "O visor de documentos incorporado está dispoñíbel e admítese a previsualización ao vivo." +msgid "" +"The embedded document viewer is available and live preview is supported." +msgstr "" +"O visor de documentos incorporado está dispoñíbel e admítese a" +" previsualización ao vivo." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:260 #, kde-format msgid "" -"The embedded document viewer is available, but the installed version of PDFLaTeX is
" +"The embedded document viewer is available, but the installed version of" +" PDFLaTeX is
" "not compatible with live preview." msgstr "" -"O visor de documentos incorporado está dispoñíbel, pero a versión do PDFLaTeX instalada
" +"O visor de documentos incorporado está dispoñíbel, pero a versión do PDFLaTeX" +" instalada
" "non é compatíbel coa previsualización ao vivo." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:268 #, kde-format msgid "" -"The embedded document viewer is not available (as Okular is either not available or the installed
" +"The embedded document viewer is not available (as Okular is either not" +" available or the installed
" "version is too old). Live preview is hence not supported." msgstr "" -"O visor de documentos incorporado non está dispoñíbel (dado que Okular ou non está dispoñíbel ou
" -"a versión instalada é vella de máis). Por esta razón non son posíbeis as previsualizacións ao vivo." +"O visor de documentos incorporado non está dispoñíbel (dado que Okular" +" ou non está dispoñíbel ou
" +"a versión instalada é vella de máis). Por esta razón non son posíbeis as" +" previsualizacións ao vivo." #. +> trunk5 #: dialogs/configcheckerdialog.cpp:291 #, kde-format msgid "" "
" -"The tests could not be finished correctly. Please check the available disk space." +"The tests could not be finished correctly. Please" +" check the available disk space." msgstr "" "
" -"Non se puideron rematar as probas correctamente. Comprobe o espazo de disco que hai dispoñíbel." +"Non se puideron rematar as probas correctamente." +" Comprobe o espazo de disco que hai dispoñíbel." #. i18n: ectx: property (windowTitle), widget (QWidget, UserMenuDialog) #. i18n: ectx: property (windowTitle), widget (QWidget, ToolConfigWidget) #. +> trunk5 #: dialogs/configurationdialog.cpp:59 #: dialogs/usermenu/usermenudialog_base.ui:26 #: widgets/maintoolconfigwidget.ui:26 #, kde-format msgid "Configure" msgstr "Configurar" #. +> trunk5 #: dialogs/configurationdialog.cpp:69 main.cpp:106 #, kde-format msgid "Kile" msgstr "Kile" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetEnvironmentConfig) #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetLatexConfig) #. +> trunk5 #: dialogs/configurationdialog.cpp:70 kile.cpp:673 kile.cpp:1020 #: kileinfo.cpp:355 widgets/environmentconfigwidget.ui:20 #: widgets/latexconfigwidget.ui:14 #, kde-format msgid "LaTeX" msgstr "LaTeX" #. i18n: ectx: ToolBar (toolsToolBar) #. +> trunk5 #: dialogs/configurationdialog.cpp:71 kileui.rc:534 #, kde-format msgid "Tools" msgstr "Utilidades" #. +> trunk5 #: dialogs/configurationdialog.cpp:72 #, kde-format msgid "Editor" msgstr "Editor" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetGeneralConfig) #. i18n: ectx: attribute (title), widget (QWidget, tab) #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. +> trunk5 #: dialogs/configurationdialog.cpp:200 dialogs/configurationdialog.cpp:287 #: widgets/appearanceconfigwidget.ui:20 widgets/generalconfigwidget.ui:26 #: widgets/maintoolconfigwidget.ui:265 #, kde-format msgid "General" msgstr "Xeral" #. +> trunk5 #: dialogs/configurationdialog.cpp:200 #, kde-format msgid "General Settings" msgstr "Opcións xerais" #. +> trunk5 #: dialogs/configurationdialog.cpp:209 #, kde-format msgid "Build" msgstr "Xerar" #. +> trunk5 #: dialogs/configurationdialog.cpp:220 #, kde-format msgid "Scripting" msgstr "Scripts" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetScriptingConfig) #. +> trunk5 #: dialogs/configurationdialog.cpp:220 widgets/scriptingconfigwidget.ui:21 #, kde-format msgid "Scripting Support" msgstr "Funcionalidade de scripting" #. i18n: ectx: Menu (menu_usermenu) #. +> trunk5 #: dialogs/configurationdialog.cpp:229 kileui.rc:477 usermenu/usermenu.cpp:69 #, kde-format msgid "User Menu" msgstr "Menú do usuario" #. +> trunk5 #: dialogs/configurationdialog.cpp:241 #, kde-format msgid "Complete" msgstr "Completar" #. +> trunk5 #: dialogs/configurationdialog.cpp:241 #, kde-format msgid "Code Completion" msgstr "Completado de código" #. +> trunk5 #: dialogs/configurationdialog.cpp:251 kile.cpp:723 #, kde-format msgid "Preview" msgstr "Previsualizar" #. i18n: ectx: Menu (quickpreview) #. +> trunk5 #: dialogs/configurationdialog.cpp:251 kileui.rc:141 #, kde-format msgid "Quick Preview" msgstr "Vista previa rápida" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetHelpConfig) #. +> trunk5 #: dialogs/configurationdialog.cpp:259 kilehelp.cpp:323 #: widgets/helpconfigwidget.ui:20 #, kde-format msgid "Help" msgstr "Axuda" #. i18n: ectx: Menu (menu_livepreview) #. +> trunk5 #: dialogs/configurationdialog.cpp:267 kileui.rc:138 #, kde-format msgid "Live Preview" msgstr "Previsualizar ao vivo" #. +> trunk5 #: dialogs/configurationdialog.cpp:275 #, kde-format msgid "Appearance" msgstr "Aparencia" #. i18n: ectx: attribute (title), widget (QWidget, pageEnvironments) #. +> trunk5 #: dialogs/configurationdialog.cpp:294 dialogs/latexcommanddialog_base.ui:41 #, kde-format msgid "Environments" msgstr "Ambientes" #. +> trunk5 #: dialogs/configurationdialog.cpp:301 widgets/previewconfigwidget.cpp:246 #: widgets/previewconfigwidget.cpp:247 #, kde-format msgid "installed" msgstr "instalado" #. +> trunk5 #: dialogs/configurationdialog.cpp:301 widgets/previewconfigwidget.cpp:246 #: widgets/previewconfigwidget.cpp:247 #, kde-format msgid "not installed" msgstr "non instalado" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetGraphicsConfig) #. +> trunk5 #: dialogs/configurationdialog.cpp:302 widgets/graphicsconfigwidget.ui:14 #, kde-format msgid "Graphics" msgstr "Gráficos" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetStructureViewConfig) #. +> trunk5 #: dialogs/configurationdialog.cpp:309 widgets/structureviewconfigwidget.ui:26 #, kde-format msgid "Structure View" msgstr "Vista da estrutura" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetSymbolViewConfig) #. +> trunk5 #: dialogs/configurationdialog.cpp:316 widgets/symbolviewconfigwidget.ui:14 #, kde-format msgid "Symbol View" msgstr "Vista de símbolos" #. +> trunk5 #: dialogs/findfilesdialog.cpp:95 dialogs/projectdialogs.cpp:58 #, kde-format msgid "Project" msgstr "Proxecto" #. +> trunk5 #: dialogs/findfilesdialog.cpp:101 dialogs/managetemplatesdialog.cpp:84 #: dialogs/tabular/newtabulardialog.cpp:128 #, kde-format msgid "Name:" msgstr "Nome:" #. +> trunk5 #: dialogs/findfilesdialog.cpp:104 dialogs/findfilesdialog.cpp:187 #, kde-format msgid "Directory:" msgstr "Directorio:" #. +> trunk5 #: dialogs/findfilesdialog.cpp:119 dialogs/texdocumentationdialog.cpp:70 #, kde-format msgid "Search" msgstr "Buscar" #. +> trunk5 #: dialogs/findfilesdialog.cpp:125 #, kde-format msgid "Pattern:" msgstr "Padrón:" #. +> trunk5 #: dialogs/findfilesdialog.cpp:136 #, kde-format msgid "Template:" msgstr "Modelo:" #. +> trunk5 #: dialogs/findfilesdialog.cpp:142 #, kde-format msgid "Normal" msgstr "Normal" #. i18n: ectx: property (text), widget (QTreeWidget, commands) #. +> trunk5 #: dialogs/findfilesdialog.cpp:143 dialogs/latexcommanddialog_base.ui:133 #, kde-format msgid "Command" msgstr "Orde" #. +> trunk5 #: dialogs/findfilesdialog.cpp:144 #, kde-format msgid "Command[]" msgstr "Orde[]" #. i18n: ectx: property (text), widget (QTreeWidget, environments) #. i18n: ectx: property (title), widget (QGroupBox, groupBox) #. +> trunk5 #: dialogs/findfilesdialog.cpp:145 dialogs/floatdialog_base.ui:29 #: dialogs/latexcommanddialog_base.ui:69 dialogs/mathenvironmentdialog.cpp:56 #: dialogs/tabular/newtabulardialog.cpp:124 kile.cpp:941 #, kde-format msgid "Environment" msgstr "Ambiente" #. +> trunk5 #: dialogs/findfilesdialog.cpp:146 #, kde-format msgid "Image" msgstr "Imaxe" #. +> trunk5 #: dialogs/findfilesdialog.cpp:147 kilestdactions.cpp:127 #: kilestdactions.cpp:128 usermenu/usermenu.cpp:908 #, kde-format msgid "Label" msgstr "Etiqueta" #. +> trunk5 #: dialogs/findfilesdialog.cpp:148 kilestdactions.cpp:133 #: usermenu/usermenu.cpp:913 #, kde-format msgid "Reference" msgstr "Referencia" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) #. +> trunk5 #: dialogs/findfilesdialog.cpp:149 dialogs/includegraphicsdialog_base.ui:17 #: dialogs/projectdialogs.cpp:234 #, kde-format msgid "File" msgstr "Ficheiro" #. +> trunk5 #: dialogs/findfilesdialog.cpp:172 #, kde-format msgid "Directory Options" msgstr "Configuración do directorio" #. +> trunk5 #: dialogs/findfilesdialog.cpp:178 #, kde-format msgid "Filter:" msgstr "Filtro:" #. +> trunk5 #: dialogs/findfilesdialog.cpp:198 #, kde-format msgid "Scan directories recursively" msgstr "Examinar os directorios recursivamente" #. +> trunk5 #: dialogs/findfilesdialog.cpp:216 dialogs/findfilesdialog.cpp:586 #: dialogs/texdocumentationdialog.cpp:79 #, kde-format msgid "&Search" msgstr "&Buscar" #. +> trunk5 #: dialogs/findfilesdialog.cpp:222 #, kde-format msgid "&Clear" msgstr "&Limpar" #. +> trunk5 #: dialogs/findfilesdialog.cpp:258 #, kde-format msgid "" "Enter the regular expression you want to search for here.
" "Possible meta characters are:
" "
    " "
  •  . - Matches any character
    • " "
  •  ^ - Matches the beginning of a line
    • " "
  •  $ - Matches the end of a line
    • " "
  •  \\\\\\< - Matches the beginning of a word
    • " "
  •  \\\\\\> - Matches the end of a word
    • " "
" "The following repetition operators exist:" "
    " "
  •  ? - The preceding item is matched at most once
    • " "
  •  * - The preceding item is matched zero or more times
    • " "
  •  + - The preceding item is matched one or more times
    • " -"
  •  {n} - The preceding item is matched exactly n times
    • " -"
  •  {n,} - The preceding item is matched n or more times
    • " -"
  •  {,n} - The preceding item is matched at most n times
    • " -"
  •  {n,m} - The preceding item is matched at least n, but at most m times.
    • " +"
  •  {n} - The preceding item is matched exactly n" +" times
    • " +"
  •  {n,} - The preceding item is matched n or more" +" times
    • " +"
  •  {,n} - The preceding item is matched at most n" +" times
    • " +"
  •  {n,m} - The preceding item is matched at least" +" n, but at most m times.
    • " "
" -"Furthermore, backreferences to bracketed subexpressions are available via the notation \\\\n." +"Furthermore, backreferences to bracketed subexpressions are available via the" +" notation \\\\n." msgstr "" "Insira aquí a expresión regular que queira buscar.
" "Os posíbeis meta-caracteres son:
" " " "
    " "
  •  . -Calquera carácter coincide
    • " " " "
  •  ^ - O inicio dunha liña coincide
    • " " " "
  •  $ - O final dunha liña coincide
    • " " " "
  •  \\\\\\< - O inicio dunha palabra coincide
    • " " " "
  •  \\\\\\>. - A fin dunha palabra coincide
    • " "
" " Existen os seguintes operadores de repetición: " "
    " "
  •  ? - O elemento precedente coincide como moito unha vez
    • " " " -"
  •  * - O elemento precedente coincide ningunha ou máis veces
    • " +"
  •  * - O elemento precedente coincide ningunha ou máis veces<" +"/li>" " " "
  •  + - O elemento precedente coincide unha ou máis veces
    • " " " -"
  •  {n} - O elemento precedente coincide exactamente n veces
    • " +"
  •  {n} - O elemento precedente coincide exactamente n veces
    • " " " -"
  •  {n,} - O elemento precedente coincide n ou máis veces
    • " +"
  •  {n,} - O elemento precedente coincide n ou" +" máis veces
    • " " " -"
  •  {,n} - O elemento precedente coincide como moito n veces
    • " +"
  •  {,n} - O elemento precedente coincide como moito n veces
    • " " " -"
  •  {n,m} - O elemento precedente coincide a lo menos n, pero menos de m veces.
    • " +"
  •  {n,m} - O elemento precedente coincide a lo" +" menos n, pero menos de m veces.
    • " "
" -" Ademais, están dispoñíbeis referencias cara atrás para subexpresións entre corchetes coa notación \\\\n." +" Ademais, están dispoñíbeis referencias cara atrás para subexpresións entre" +" corchetes coa notación \\\\n." #. +> trunk5 #: dialogs/findfilesdialog.cpp:282 #, kde-format -msgid "Enter the file name pattern of the files to search here. You may give several patterns separated by commas." -msgstr "Insira aquí o padrón dos nomes dos ficheiros a buscar. Pode fornecer varios formatos separados por comas." +msgid "" +"Enter the file name pattern of the files to search here. You may give several" +" patterns separated by commas." +msgstr "" +"Insira aquí o padrón dos nomes dos ficheiros a buscar. Pode fornecer varios" +" formatos separados por comas." #. +> trunk5 #: dialogs/findfilesdialog.cpp:285 #, kde-format msgid "" -"Choose one search mode. For the first modes, the search pattern is built from the editable template, where '%s' is replaced by the given pattern.
" +"Choose one search mode. For the first modes, the search pattern is built from" +" the editable template, where '%s' is replaced by the given pattern.
" "
" -"There are additional fixed predefined modes for environments, graphics, labels, references and input files. If the pattern is empty, Kile will search for all commands of this mode. If a pattern is given, it will be inserted as a parameter. For example, in environment mode with pattern 'center', Kile will search for '\\begin{center}', and in graphics mode with pattern '.*\\.png', Kile will search for all png files." -msgstr "" -"Escolla un modo de busca. Para os primeiros modos, o padrón de buscas é obtido a partir do modelo editábel, onde «%s» é substituído polo padrón dado.
" +"There are additional fixed predefined modes for environments, graphics," +" labels, references and input files. If the pattern is empty, Kile will" +" search for all commands of this mode. If a pattern is given, it will be" +" inserted as a parameter. For example, in environment mode with pattern" +" 'center', Kile will search for '\\begin{center}', and in graphics mode with" +" pattern '.*\\.png', Kile will search for all png files." +msgstr "" +"Escolla un modo de busca. Para os primeiros modos, o padrón de buscas é" +" obtido a partir do modelo editábel, onde «%s» é substituído polo padrón" +" dado.
" "
" -"Hai modos fixos adicionais predefinidos para ambientes, gráficos, marcas, referencias e campos de entrada. Se o padrón estiver baleiro, Kile busca por todas os ordes do modo. Se se indicar un padrón, insírese como parámetro. Por exemplo, no modo ambiente con padrón «centrado», Kile busca «\\begin{center}» e no modo gráficos co padrón '.*\\.png', Kile busca todos os ficheiros png." +"Hai modos fixos adicionais predefinidos para ambientes, gráficos, marcas," +" referencias e campos de entrada. Se o padrón estiver baleiro, Kile busca por" +" todas os ordes do modo. Se se indicar un padrón, insírese como parámetro." +" Por exemplo, no modo ambiente con padrón «centrado», Kile busca" +" «\\begin{center}» e no modo gráficos co padrón '.*\\.png', Kile busca todos" +" os ficheiros png." #. +> trunk5 #: dialogs/findfilesdialog.cpp:293 #, kde-format -msgid "For the first three modes you can choose a template for the pattern from the combo box and edit it here. The string %s in the template is replaced by the pattern input field, resulting in the regular expression to search for. In all other modes this template is ignored." -msgstr "Nos tres primeiros modos pode escoller un modelo para o padrón desde a caixa de selección e editalo aquí. A cadea %s no modelo é substituída polo padrón do campo de entrada, resultando na expresión regular a buscar. Nos outros modos este modelo é ignorado." +msgid "" +"For the first three modes you can choose a template for the pattern from the" +" combo box and edit it here. The string %s in the template is replaced by the" +" pattern input field, resulting in the regular expression to search for. In" +" all other modes this template is ignored." +msgstr "" +"Nos tres primeiros modos pode escoller un modelo para o padrón desde a caixa" +" de selección e editalo aquí. A cadea %s no modelo é substituída polo padrón" +" do campo de entrada, resultando na expresión regular a buscar. Nos outros" +" modos este modelo é ignorado." #. +> trunk5 #: dialogs/findfilesdialog.cpp:298 #, kde-format msgid "Enter the directory which contains the files you want to search in." msgstr "Insira o directorio que contén os ficheiros nos que quere buscar." #. +> trunk5 #: dialogs/findfilesdialog.cpp:300 #, kde-format msgid "Check this box to search in all subdirectories." msgstr "Marque esta opción para buscar en todos os subdirectorios." #. +> trunk5 #: dialogs/findfilesdialog.cpp:302 #, kde-format -msgid "The results of the grep run are listed here. Select a filename/line number combination with a mouse click on the item or with the cursor to show the respective line in the editor." -msgstr "Aquí lístanse os resultados da execución de grep. Escolla unha combinación de nome de ficheiro e número de liña premendo o elemento co rato ou co cursor para mostrar a liña correspondente no editor." +msgid "" +"The results of the grep run are listed here. Select a filename/line number" +" combination with a mouse click on the item or with the cursor to show the" +" respective line in the editor." +msgstr "" +"Aquí lístanse os resultados da execución de grep. Escolla unha combinación de" +" nome de ficheiro e número de liña premendo o elemento co rato ou co cursor" +" para mostrar a liña correspondente no editor." #. +> trunk5 #: dialogs/findfilesdialog.cpp:309 #, kde-format msgid "Find in Files" msgstr "Atopar nos ficheiros" #. +> trunk5 #: dialogs/findfilesdialog.cpp:313 #, kde-format msgid "Find in Project" msgstr "Atopar no proxecto" #. +> trunk5 #: dialogs/findfilesdialog.cpp:414 #, kde-format msgid "no project opened" msgstr "non hai ningún proxecto aberto" #. +> trunk5 #: dialogs/findfilesdialog.cpp:558 #, kde-format msgid "" "Error:" "

" msgstr "" "Erro:" "

" #. +> trunk5 #: dialogs/findfilesdialog.cpp:558 dialogs/findfilesdialog.cpp:692 #, kde-format msgid "Grep Tool Error" msgstr "Erro da utilidade Grep" #. +> trunk5 #: dialogs/findfilesdialog.cpp:692 #, kde-format msgid "Invalid regular expression: %1" msgstr "A expresión regular é incorrecta: %1" #. +> trunk5 #: dialogs/findfilesdialog.cpp:697 #, kde-format msgid "&Cancel" msgstr "&Cancelar" #. +> trunk5 #: dialogs/floatdialog.cpp:105 #, kde-format msgid "Figure Environment" msgstr "Ambiente de figura" #. +> trunk5 #: dialogs/floatdialog.cpp:109 #, kde-format msgid "Table Environment" msgstr "Ambiente de táboa" #. i18n: ectx: property (text), widget (QRadioButton, m_rbFigure) #. +> trunk5 #: dialogs/floatdialog_base.ui:35 kilestdactions.cpp:63 #, kde-format msgid "Figure" msgstr "Figura" #. i18n: ectx: property (text), widget (QRadioButton, m_rbTable) #. +> trunk5 #: dialogs/floatdialog_base.ui:45 kilestdactions.cpp:58 #, kde-format msgid "Table" msgstr "Táboa" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. +> trunk5 #: dialogs/floatdialog_base.ui:55 #, kde-format msgid "Position" msgstr "Posición" #. i18n: ectx: property (text), widget (QCheckBox, m_cbHere) #. +> trunk5 #: dialogs/floatdialog_base.ui:61 #, kde-format msgid "Here exact" msgstr "Aquí exactamente" #. i18n: ectx: property (text), widget (QCheckBox, m_cbBottom) #. +> trunk5 #: dialogs/floatdialog_base.ui:71 #, kde-format msgid "Bottom of page" msgstr "Fondo da páxina" #. i18n: ectx: property (text), widget (QCheckBox, m_cbTop) #. +> trunk5 #: dialogs/floatdialog_base.ui:78 #, kde-format msgid "Top of page" msgstr "Cume da páxina" #. i18n: ectx: property (text), widget (QCheckBox, m_cbPage) #. +> trunk5 #: dialogs/floatdialog_base.ui:88 #, kde-format msgid "Extra page" msgstr "Páxina extra" #. i18n: ectx: property (text), widget (QCheckBox, m_cbCenter) #. +> trunk5 #: dialogs/floatdialog_base.ui:116 dialogs/tabular/newtabulardialog.cpp:160 #: kilestdactions.cpp:46 #, kde-format msgid "Center" msgstr "Centrar" #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (text), widget (QLabel, label_16) #. i18n: ectx: property (text), widget (QLabel, label_18) #. +> trunk5 #: dialogs/floatdialog_base.ui:126 dialogs/includegraphicsdialog_base.ui:328 #: dialogs/includegraphicsdialog_base.ui:434 #, kde-format msgid "Caption:" msgstr "Título:" #. i18n: ectx: property (text), widget (QLabel, label_3) #. i18n: ectx: property (text), widget (QLabel, label_10) #. i18n: ectx: property (text), widget (QLabel, label_17) #. +> trunk5 #: dialogs/floatdialog_base.ui:139 dialogs/includegraphicsdialog_base.ui:314 #: dialogs/includegraphicsdialog_base.ui:427 #, kde-format msgid "Label:" msgstr "Etiqueta:" #. i18n: ectx: property (title), widget (QGroupBox, m_bgGraphics) #. +> trunk5 #: dialogs/includegraphicsdialog.cpp:49 widgets/graphicsconfigwidget.ui:20 #, kde-format msgid "Include Graphics" msgstr "Incluír gráficos" #. +> trunk5 #: dialogs/includegraphicsdialog.cpp:417 #, kde-format msgid "*.png *.jpg *.pdf *.ps *.eps|Graphics\n" msgstr "*.png *.jpg *.pdf *.ps *.eps|Gráficos\n" #. +> trunk5 #: dialogs/includegraphicsdialog.cpp:423 #, kde-format msgid "*.png *.jpg *.eps.gz *.eps|Graphics\n" msgstr "*.png *.jpg *.eps.gz *.eps|Gráficos\n" #. +> trunk5 #: dialogs/includegraphicsdialog.cpp:618 #, kde-format msgid "You must include the wrapfig package to use the text wrapping options" -msgstr "Debe instalar o paquete wrapfig para empregar as opcións de rodeo de texto" +msgstr "" +"Debe instalar o paquete wrapfig para empregar as opcións de rodeo de texto" #. +> trunk5 #: dialogs/includegraphicsdialog.cpp:618 editorextension.cpp:3242 #, kde-format msgid "Missing Package" msgstr "Falta un paquete" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:29 #, kde-format msgid "Picture:" msgstr "Imaxe:" #. i18n: ectx: property (text), widget (QLabel, label_2) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:39 #, kde-format msgid "Info:" msgstr "Información:" #. i18n: ectx: property (text), widget (QLabel, infolabel) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:46 #, kde-format msgid "---" msgstr "---" #. i18n: ectx: property (text), widget (QLabel, label_4) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:53 #, kde-format msgid "Output:" msgstr "Saída:" #. i18n: ectx: property (text), widget (QCheckBox, cb_center) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:60 #, kde-format msgid "Center picture" msgstr "Centrar a imaxe" #. i18n: ectx: property (text), widget (QLabel, label_5) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:70 #, kde-format msgid "Path:" msgstr "Ruta:" #. i18n: ectx: property (text), widget (QCheckBox, cb_graphicspath) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:77 #, kde-format msgid "Use \\graphicspath command of LaTeX" msgstr "Empregar a orde \\graphicspath de LaTeX" #. i18n: ectx: attribute (title), widget (QWidget, tab_5) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:97 #, kde-format msgid "Image options" msgstr "Opcións da imaxe" #. i18n: ectx: property (text), widget (QLabel, label_6) #. i18n: ectx: property (text), widget (QLabel, label_21) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:118 #: dialogs/includegraphicsdialog_base.ui:441 #, kde-format msgid "Width:" msgstr "Anchura:" #. i18n: ectx: property (text), widget (QLabel, label_7) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:128 #, kde-format msgid "Height:" msgstr "Alto:" #. i18n: ectx: property (text), widget (QLabel, label_8) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:138 #, kde-format msgid "Angle:" msgstr "Ángulo:" #. i18n: ectx: property (text), widget (QLabel, label_24) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:148 #, kde-format msgid "Bounding box:" msgstr "Caixa contedora:" #. i18n: ectx: property (text), widget (QCheckBox, cb_bb) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:158 #, kde-format msgid "Use bounding box" msgstr "Empregar a caixa contedora" #. i18n: ectx: property (text), widget (QLabel, label_3) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:165 #, kde-format msgid "Scale:" msgstr "Escala:" #. i18n: ectx: property (text), widget (QCheckBox, cb_keepAspect) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:175 #, kde-format msgid "Keep aspect ratio" msgstr "Manter as proporcións" #. i18n: ectx: attribute (title), widget (QWidget, tab_6) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:186 #, kde-format msgid "Trim image" msgstr "Recortar a imaxe" #. i18n: ectx: property (toolTip), widget (QGroupBox, cb_clip) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:192 #, kde-format msgid "Trim image by the specified lengths" msgstr "Recortar a imaxe nas lonxitudes indicadas" #. i18n: ectx: property (title), widget (QGroupBox, cb_clip) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:195 #, kde-format msgid "Trim Image" msgstr "Recortar a imaxe" #. i18n: ectx: property (text), widget (QLabel, label_12) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:207 #, kde-format msgid "Left:" msgstr "Esquerda:" #. i18n: ectx: property (text), widget (QLabel, label_13) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:214 #, kde-format msgid "Top:" msgstr "Arriba:" #. i18n: ectx: property (text), widget (QLabel, label_14) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:221 #, kde-format msgid "Right:" msgstr "Dereita:" #. i18n: ectx: property (text), widget (QLabel, label_15) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:228 #, kde-format msgid "Bottom:" msgstr "Fondo:" #. i18n: ectx: property (text), widget (QLineEdit, edit_trimLeft) #. i18n: ectx: property (text), widget (QLineEdit, edit_trimTop) #. i18n: ectx: property (text), widget (QLineEdit, edit_trimRight) #. i18n: ectx: property (text), widget (QLineEdit, edit_trimBottom) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:235 #: dialogs/includegraphicsdialog_base.ui:242 #: dialogs/includegraphicsdialog_base.ui:249 #: dialogs/includegraphicsdialog_base.ui:256 #, kde-format msgid "0pt" msgstr "0pt" #. i18n: ectx: attribute (title), widget (QWidget, tab) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:296 #, kde-format msgid "figure" msgstr "figura" #. i18n: ectx: property (title), widget (QGroupBox, cb_figure) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:302 #, kde-format msgid "Use figure environment" msgstr "Empregar o ambiente de figura" #. i18n: ectx: property (text), widget (QLineEdit, edit_label) #. i18n: ectx: property (text), widget (QLineEdit, edit_wraplabel) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:321 #: dialogs/includegraphicsdialog_base.ui:458 #, kde-format msgid "fig:" msgstr "figura:" #. i18n: ectx: property (text), widget (QLabel, label_11) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:338 #, kde-format msgid "Position:" msgstr "Posición:" #. i18n: ectx: property (text), widget (QCheckBox, cb_Bottom) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:345 #, kde-format msgid "Bottom of page (b)" msgstr "Fondo da páxina" #. i18n: ectx: property (text), widget (QCheckBox, cb_Page) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:355 #, kde-format msgid "Extra page (p)" msgstr "Páxina extra" #. i18n: ectx: property (text), widget (QCheckBox, cb_Here) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:365 #, kde-format msgid "Here (h)" msgstr "Aquí" #. i18n: ectx: property (text), widget (QCheckBox, cb_Top) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:375 #, kde-format msgid "Top of page (t)" msgstr "Cume da páxina" #. i18n: ectx: property (text), widget (QCheckBox, cb_Force) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:385 #, kde-format msgid "Force Positioning (!)" msgstr "Forzar a posición (!)" #. i18n: ectx: property (text), widget (QCheckBox, cb_custom) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:395 #, kde-format msgid "Custom:" msgstr "Personalizado:" #. i18n: ectx: attribute (title), widget (QWidget, tab_2) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:409 #, kde-format msgid "wrapfigure" msgstr "rodearfigura" #. i18n: ectx: property (title), widget (QGroupBox, cb_wrapfigure) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:415 #, kde-format msgid "Use wrapfigure environment" msgstr "Empregar o ambiente de rodeo de figura" #. i18n: ectx: property (text), widget (QLineEdit, edit_wrapwidth) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:448 #, kde-format msgid "3.5in" msgstr "3.5in" #. i18n: ectx: property (text), widget (QLabel, label_22) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:465 #, kde-format msgid "Lines to break:" msgstr "Liña que quebrar:" #. i18n: ectx: property (text), widget (QCheckBox, cb_wrapleft) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:475 #, kde-format msgid "Left (L/l)" msgstr "Esquerda" #. i18n: ectx: property (text), widget (QCheckBox, cb_wrapoutside) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:482 #, kde-format msgid "Outside (O/o)" msgstr "Fóra" #. i18n: ectx: property (text), widget (QCheckBox, cb_wrapright) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:489 #, kde-format msgid "Right (R/r)" msgstr "Dereita" #. i18n: ectx: property (text), widget (QCheckBox, cb_wrapinside) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:499 #, kde-format msgid "Inside (I/i)" msgstr "Dentro" #. i18n: ectx: property (text), widget (QCheckBox, cb_wrapfloat) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:506 #, kde-format msgid "Float figure" msgstr "Figura flutuante" #. i18n: ectx: property (text), widget (QLabel, label_20) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:516 #, kde-format msgid "Overhang:" msgstr "Suspensión:" #. i18n: ectx: property (text), widget (QLabel, label_19) #. +> trunk5 #: dialogs/includegraphicsdialog_base.ui:529 #, kde-format msgid "Placement:" msgstr "Colocación:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:94 #, kde-format msgid "Attributes" msgstr "Atributos" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:99 #, kde-format msgid "Group:" msgstr "Grupo:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:100 dialogs/mathenvironmentdialog.cpp:59 #, kde-format msgid "&Name:" msgstr "&Nome:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:102 #, kde-format msgid "Include *-&version:" msgstr "Incluír *-&versión:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:115 #, kde-format msgid "Name of the group, to which this environment or command belongs." msgstr "O nome do grupo ao que pertence este ambiente ou orde." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:117 #, kde-format msgid "Name of the new environment or command." msgstr "O nome do novo ambiente ou orde." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:120 #, kde-format msgid "Name of the environment or command to edit." msgstr "O nome do ambiente ou orde a editar." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:122 #, kde-format msgid "Does this environment or command also exist in a starred version?" msgstr "Existe este ambiente ou orde tamén nunha versión con estrela?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:126 #, kde-format msgid "\\\\ is end of &line:" msgstr "\\\\ é fin de &liña:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:127 #, kde-format msgid "Needs &math mode:" msgstr "Precisa do modo &matemático:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:128 #, kde-format msgid "&Tabulator:" msgstr "&Tabulador:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:143 #, kde-format msgid "Shall 'Smart New Line' insert \\\\?" msgstr "Debe a «Nova liña intelixente» inserir \\\\?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:144 #, kde-format msgid "Does this environment need math mode?" msgstr "Precisa este ambiente do modo matemático?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:145 #, kde-format msgid "Define the standard tabulator of this environment." msgstr "Definir o tabulador estándar deste ambiente." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:156 #, kde-format msgid "Opt&ion:" msgstr "&Opción:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:167 #, kde-format msgid "Define an optional alignment parameter." msgstr "Define un parámetro opcional de aliñamento." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:170 #, kde-format msgid "Does this command need an optional parameter?" msgstr "Precisa esta orde dun parámetro adicional?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:178 #, kde-format msgid "&Parameter:" msgstr "&Parámetro:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:190 #, kde-format -msgid "Does this environment need an additional parameter like {n} for an integer number, {w} for a width or { } for any other parameter?" -msgstr "Precisa este ambiente dun parámetro adicional como {n} para un número enteiro, {w} para unha lonxitude ou { } para calquera outro parámetro?" +msgid "" +"Does this environment need an additional parameter like {n} for an integer" +" number, {w} for a width or { } for any other parameter?" +msgstr "" +"Precisa este ambiente dun parámetro adicional como {n} para un número" +" enteiro, {w} para unha lonxitude ou { } para calquera outro parámetro?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:196 #, kde-format msgid "Does this command need an argument?" msgstr "Precisa esta orde dun argumento?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:209 #, kde-format msgid "Define a new LaTeX environment:" msgstr "Defina un novo ambiente LaTeX:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:213 #, kde-format msgid "Define a new LaTeX command:" msgstr "Defina unha nova orde de LaTeX:" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:228 #, kde-format msgid "Edit a LaTeX Environment" msgstr "Editar un ambiente de LaTeX" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:245 #, kde-format msgid "Edit a LaTeX Command" msgstr "Editar unha orde de LaTeX" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:310 dialogs/quickdocumentdialog.cpp:2309 #, kde-format msgid "An empty string is not allowed." msgstr "Non se permite unha cadea baleira." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:320 #, kde-format msgid "This environment already exists." msgstr "Este ambiente xa existe." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:321 #, kde-format msgid "This command already exists." msgstr "Esta orde xa existe." #. +> trunk5 #: dialogs/latexcommanddialog.cpp:339 #, kde-format msgid "LaTeX Configuration" msgstr "Configuración de LaTeX" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:390 #, kde-format msgid "AMS-Math" msgstr "AMS-Matemática" #. i18n: ectx: property (text), widget (QTreeWidget, environments) #. i18n: ectx: ToolBar (mathToolBar) #. +> trunk5 #: dialogs/latexcommanddialog.cpp:391 dialogs/latexcommanddialog_base.ui:84 #: kile.cpp:974 kileui.rc:563 #, kde-format msgid "Math" msgstr "Matemáticas" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:392 #, kde-format msgid "Lists" msgstr "Listas" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:393 kile.cpp:970 kilestdactions.cpp:79 #, kde-format msgid "Tabular" msgstr "Tabular" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:394 kilestdactions.cpp:53 #, kde-format msgid "Verbatim" msgstr "Copia literal" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:396 widgets/structurewidget.cpp:328 #, kde-format msgid "Labels" msgstr "Etiquetas" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:397 #, kde-format msgid "References" msgstr "Referencias" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:398 #, kde-format msgid "Bibliographies" msgstr "Bibliografías" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:399 #, kde-format msgid "Citations" msgstr "Citas" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:400 #, kde-format msgid "Includes" msgstr "Inclusións" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:627 #, kde-format msgid "LaTeX Environments" msgstr "Ambientes de LaTeX" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:631 dialogs/latexcommanddialog.cpp:703 #, kde-format msgid "LaTeX Commands" msgstr "Ordes de LaTeX" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:670 #, kde-format msgid "Do you want to delete this environment?" msgstr "Quere eliminar este ambiente?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:674 #, kde-format msgid "Do you want to delete this command?" msgstr "Quere eliminar esta orde?" #. i18n: ectx: property (text), widget (QPushButton, m_pbDelete) #. +> trunk5 #: dialogs/latexcommanddialog.cpp:679 dialogs/quickdocumentdialog.cpp:1905 #: dialogs/quickdocumentdialog.cpp:2078 #: dialogs/usermenu/usermenudialog_base.ui:113 #, kde-format msgid "Delete" msgstr "Eliminar" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:698 #, kde-format msgid "LaTeX Environment" msgstr "Ambiente de LaTeX" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:766 #, kde-format -msgid "All your 'environment' settings will be overwritten with the default settings, are you sure you want to continue?" -msgstr "Todas as súas opcións de «environment» (ambiente) sobrescribiranse coas opcións predeterminadas, seguro que quere continuar?" +msgid "" +"All your 'environment' settings will be overwritten with the default" +" settings, are you sure you want to continue?" +msgstr "" +"Todas as súas opcións de «environment» (ambiente) sobrescribiranse coas" +" opcións predeterminadas, seguro que quere continuar?" #. +> trunk5 #: dialogs/latexcommanddialog.cpp:767 #, kde-format -msgid "All your 'command' settings will be overwritten with the default settings, are you sure you want to continue?" -msgstr "Todas as súas opcións de «command» (orde) sobrescribiranse coas opcións predeterminadas, seguro que quere continuar?" +msgid "" +"All your 'command' settings will be overwritten with the default settings," +" are you sure you want to continue?" +msgstr "" +"Todas as súas opcións de «command» (orde) sobrescribiranse coas opcións" +" predeterminadas, seguro que quere continuar?" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:30 #, kde-format msgid "Define LaTeX Environments and Commands for Kile" msgstr "Definir os ambientes e ordes de LaTeX para Kile" #. i18n: ectx: property (whatsThis), widget (QTreeWidget, environments) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:62 #, kde-format -msgid "List of known environments with a lot of additional information that Kile can potentially use. You can add your own environments, which will then be recognized by autocompletion of environments; 'Smart Newline' and 'Smart Tabulator', for example. Note that you can only edit and delete user-defined environments." -msgstr "Unha lista de ambientes coñecidos con moita información adicional, que quizais poida empregar Kile. Pode engadir outros ambientes, que se recoñecerán pola completado automático dos ambientes, por exemplo «Nova liña intelixente» e «Tabulador intelixente». Por suposto só pode editar e eliminar ambientes definidos polo usuario." +msgid "" +"List of known environments with a lot of additional information that Kile can" +" potentially use. You can add your own environments, which will then be" +" recognized by autocompletion of environments; 'Smart Newline' and 'Smart" +" Tabulator', for example. Note that you can only edit and delete user-defined" +" environments." +msgstr "" +"Unha lista de ambientes coñecidos con moita información adicional, que" +" quizais poida empregar Kile. Pode engadir outros ambientes, que se" +" recoñecerán pola completado automático dos ambientes, por exemplo «Nova liña" +" intelixente» e «Tabulador intelixente». Por suposto só pode editar e" +" eliminar ambientes definidos polo usuario." #. i18n: ectx: property (text), widget (QTreeWidget, environments) #. i18n: ectx: property (text), widget (QTreeWidget, commands) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:74 dialogs/latexcommanddialog_base.ui:138 #, kde-format msgid "Starred" msgstr "Estrelada" #. i18n: ectx: property (text), widget (QTreeWidget, environments) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:79 #, kde-format msgid "EOL" msgstr "Fin de liña" #. i18n: ectx: property (text), widget (QTreeWidget, environments) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:89 #, kde-format msgid "Tab" msgstr "Tabulador" #. i18n: ectx: property (text), widget (QTreeWidget, environments) #. i18n: ectx: property (text), widget (QTreeWidget, commands) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:94 #: dialogs/latexcommanddialog_base.ui:143 dialogs/quickdocumentdialog.cpp:221 #, kde-format msgid "Option" msgstr "Opción" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) #. i18n: ectx: property (title), widget (QGroupBox, m_gbParameter) #. i18n: ectx: property (text), widget (QTreeWidget, environments) #. i18n: ectx: property (text), widget (QTreeWidget, commands) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:99 #: dialogs/latexcommanddialog_base.ui:148 #: dialogs/pdf-wizard/pdfdialog_base.ui:200 #: dialogs/postscriptdialog_base.ui:29 #: dialogs/usermenu/usermenudialog_base.ui:639 #, kde-format msgid "Parameter" msgstr "Parámetro" #. i18n: ectx: attribute (title), widget (QWidget, pageCommands) #. i18n: ectx: property (title), widget (QGroupBox, m_bgCommands) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:108 widgets/latexconfigwidget.ui:26 #, kde-format msgid "Commands" msgstr "Ordes" #. i18n: ectx: property (whatsThis), widget (QPushButton, addButton) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:176 #, kde-format msgid "Add a new environment." msgstr "Engade un ambiente novo." #. i18n: ectx: property (text), widget (QPushButton, addButton) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:179 dialogs/quickdocumentdialog.cpp:244 #: dialogs/userhelpdialog.cpp:75 #, kde-format msgid "&Add..." msgstr "&Engadir…" #. i18n: ectx: property (whatsThis), widget (QPushButton, deleteButton) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:186 #, kde-format msgid "Delete a user-defined environment." msgstr "Eliminar un ambiente definido polo usuario." #. i18n: ectx: property (text), widget (QPushButton, deleteButton) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:189 dialogs/quickdocumentdialog.cpp:256 #: dialogs/quickdocumentdialog.cpp:313 #, kde-format msgid "De&lete" msgstr "&Eliminar" #. i18n: ectx: property (whatsThis), widget (QPushButton, editButton) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:196 #, kde-format msgid "Edit a user-defined environment." msgstr "Editar un ambiente definido polo usuario." #. i18n: ectx: property (text), widget (QPushButton, editButton) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:199 #, kde-format msgid "&Edit..." msgstr "&Editar…" #. i18n: ectx: property (text), widget (QCheckBox, showOnlyUserDefined) #. +> trunk5 #: dialogs/latexcommanddialog_base.ui:222 #, kde-format msgid "Show only user-defined environments and commands" msgstr "Mostrar só os ambientes e ordes definidos polo usuario" #. +> trunk5 #: dialogs/listselector.cpp:64 #, kde-format msgid "1 item found." msgid_plural "%1 items found." msgstr[0] "Atopouse un elemento." msgstr[1] "Atopáronse %1 elementos." #. +> trunk5 #: dialogs/listselector.cpp:150 #, kde-format msgid "File Name" msgstr "Nome do ficheiro" #. +> trunk5 #: dialogs/listselector.cpp:150 widgets/codecompletionconfigwidget.cpp:96 #, kde-format msgid "Local File" msgstr "Ficheiro local" #. +> trunk5 #: dialogs/listselector.cpp:150 #, kde-format msgid "Add File?" msgstr "Engadir un ficheiro?" #. +> trunk5 #: dialogs/listselector.cpp:170 #, kde-format msgid "Add selected files" msgstr "Engadir os ficheiros escollidos" #. +> trunk5 #: dialogs/listselector.cpp:171 #, kde-format msgid "Add all the selected files" msgstr "Engadir todos os ficheiros escollidos" #. +> trunk5 #: dialogs/listselector.cpp:172 #, kde-format msgid "Install custom files" msgstr "Instalar ficheiros personalizados" #. +> trunk5 #: dialogs/listselector.cpp:173 #, kde-format msgid "Install your own completion files" msgstr "Instalar os seus propios ficheiros de completado" #. +> trunk5 #: dialogs/listselector.cpp:174 #, kde-format msgid "Manage custom files" msgstr "Xestionar os ficheiros personalizados" #. +> trunk5 #: dialogs/listselector.cpp:175 #, kde-format msgid "Manage the local completion files in the file manager" msgstr "Xestionar os ficheiros de completado locais no xestor de ficheiros" #. +> trunk5 #: dialogs/listselector.cpp:209 dialogs/listselector.cpp:263 #: dialogs/listselector.cpp:268 dialogs/pdf-wizard/pdfdialog.cpp:282 #: dialogs/pdf-wizard/pdfdialog.cpp:946 dialogs/postscriptdialog.cpp:217 #: widgets/codecompletionconfigwidget.cpp:198 #: widgets/codecompletionconfigwidget.cpp:357 #, kde-format msgid "yes" msgstr "si" #. i18n: ectx: property (text), widget (QLabel, m_lbEncryption) #. +> trunk5 #: dialogs/listselector.cpp:213 dialogs/pdf-wizard/pdfdialog.cpp:282 #: dialogs/pdf-wizard/pdfdialog.cpp:946 #: dialogs/pdf-wizard/pdfdialog_base.ui:521 dialogs/postscriptdialog.cpp:217 #: widgets/codecompletionconfigwidget.cpp:203 #: widgets/codecompletionconfigwidget.cpp:360 #, kde-format msgid "no" msgstr "non" #. +> trunk5 #: dialogs/listselector.cpp:229 #, kde-format msgid "Select Completion Files to Install Locally" msgstr "Escolla os ficheiros de completado que desexe instalar localmente" #. +> trunk5 #: dialogs/listselector.cpp:229 #, kde-format msgid "Completion files (*.cwl)" msgstr "Ficheiros de completado (*.cwl)" #. +> trunk5 #: dialogs/listselector.cpp:240 #, kde-format msgid "" "A local completion file with the name \"%1\" already exists.\n" "Do you want to replace this file?" msgstr "" "Xa existe un ficheiro de completado local co nome «%1».\n" "Quere substituír este ficheiro?" #. +> trunk5 #: dialogs/listselector.cpp:241 #, kde-format msgid "Replace Local File?" msgstr "Substituír o ficheiro local?" #. +> trunk5 #: dialogs/listselector.cpp:244 #, kde-format msgid "" "An error occurred while removing the file \"%1\".\n" "Please check the file permissions." msgstr "" "Produciuse un erro ao retirar o ficheiro «%1».\n" "Comprobe os permisos do ficheiro." #. +> trunk5 #: dialogs/listselector.cpp:245 #, kde-format msgid "Remove Error" msgstr "Erro ao retirar" #. +> trunk5 #: dialogs/listselector.cpp:256 #, kde-format msgid "" "Cannot copy the file to the local directory!\n" "Please check the access permissions of the directory \"%1\"." msgstr "" "Non se pode copiar o ficheiro ao directorio local!\n" "Comprobe os permisos de acceso ao directorio «%1»." #. +> trunk5 #: dialogs/listselector.cpp:257 #, kde-format msgid "Copy Error" msgstr "Erro de copiado" #. +> trunk5 #: dialogs/listselector.cpp:280 #, kde-format msgid "The custom files have been installed and preselected for adding." -msgstr "Os ficheiros personalizados instaláronse e preseleccionáronse para engadirse." +msgstr "" +"Os ficheiros personalizados instaláronse e preseleccionáronse para engadirse." #. +> trunk5 #: dialogs/listselector.cpp:281 #, kde-format msgid "Installation Successful" msgstr "A instalación tivo éxito" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:96 #, kde-format msgid "Type: %1" msgstr "Tipo: %1" #. i18n: ectx: property (text), widget (QLabel, m_lbIcon) #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:97 #: dialogs/usermenu/usermenudialog_base.ui:445 #, kde-format msgid "Icon:" msgstr "Icona:" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:103 #, kde-format msgid "Select..." msgstr "Escoller…" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:110 dialogs/managetemplatesdialog.cpp:167 #, kde-format msgctxt "marked" msgid "M" msgstr "M" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:111 dialogs/managetemplatesdialog.cpp:168 #, kde-format msgid "Existing Templates" msgstr "Modelos existentes" #. i18n: ectx: property (title), widget (QGroupBox, groupBox2) #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:112 dialogs/managetemplatesdialog.cpp:169 #: widgets/newdocumentwidget.ui:32 #, kde-format msgid "Document Type" msgstr "Tipo do documento" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:120 #, kde-format msgid "Show all the templates" msgstr "Mostrar todos os modelos" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:131 #, kde-format msgid "Clear Selection" msgstr "Limpar a selección" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:135 #, kde-format msgid "" -"Select an existing template if you want to overwrite it with your new template.\n" +"Select an existing template if you want to overwrite it with your new" +" template.\n" "Note that you cannot overwrite templates marked with an asterisk:\n" "if you do select such a template, a new template with the same name\n" "will be created in a location you have write access to." msgstr "" "Escolla un modelo se quere sobrescribir este co seu novo modelo.\n" "Recorde que non pode sobrescribir modelos marcados cun asterisco:\n" "se escolleu un destes modelos crearase un novo modelo co mesmo nome\n" "nun lugar no que teña acceso de escritura." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:176 #, kde-format msgid "" "Please select the template that you want to remove.\n" -"Note that you cannot delete templates marked with an asterisk (for which you lack the necessary deletion permissions)." +"Note that you cannot delete templates marked with an asterisk (for which you" +" lack the necessary deletion permissions)." msgstr "" "Escolla o modelo que queira retirar.\n" -"Recorda que non pode eliminar modelos marcados cun asterisco (nestes non ten permisos para eliminalos)." +"Recorda que non pode eliminar modelos marcados cun asterisco (nestes non ten" +" permisos para eliminalos)." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:251 #, kde-format msgid "" "The template name that you have entered is invalid.\n" "Please enter a new name." msgstr "" "O nome do modelo que inseriu é incorrecto.\n" "Insira un nome novo." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:259 #, kde-format msgid "Please choose an icon first." msgstr "Escolla antes unha icona." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:267 #, kde-format msgid "" "The icon file: %1\n" "does not seem to exist. Please choose a new icon." msgstr "" "O ficheiro da icona: %1\n" "semella non existir. Escolla unha icona nova." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:275 #, kde-format msgid "" "The file: %1\n" "does not seem to exist. Maybe you forgot to save the file?" msgstr "" "O ficheiro: %1\n" "semella non existir. Esquecería gardar o ficheiro?" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:282 #, kde-format msgid "" "A template named \"%1\" already exists.\n" "Please remove it first." msgstr "" "Xa existe un modelo chamado «%1».\n" "Retíreo primeiro." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:291 #, kde-format msgid "You are about to replace the template \"%1\"; are you sure?" -msgstr "Está a piques de substituír o modelo %1. Está seguro de que quere isto?" +msgstr "" +"Está a piques de substituír o modelo %1. Está seguro de que quere isto?" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:301 #, kde-format msgid "Failed to create the template." msgstr "Non se puido crear o modelo." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:311 #, kde-format msgid "Please select a template that should be removed." msgstr "Escolla o modelo que deba retirarse." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:327 #, kde-format -msgid "Sorry, but you do not have the necessary permissions to remove the selected template." +msgid "" +"Sorry, but you do not have the necessary permissions to remove the selected" +" template." msgstr "Non ten os permisos para retirar o modelo escollido." #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:331 #, kde-format msgid "You are about to remove the template \"%1\"; are you sure?" msgstr "Está a piques de retirar o modelo «%1». Está seguro de que quere isto?" #. +> trunk5 #: dialogs/managetemplatesdialog.cpp:336 #, kde-format msgid "The template could not be removed." msgstr "Non se puido retirar o modelo." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:49 #, kde-format msgid "Math Environments" msgstr "Ambientes Matemáticos" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:60 #, kde-format msgid "Without n&umbering:" msgstr "Sen n&umeración:" #. i18n: ectx: property (text), widget (QLabel, label_2) #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:61 dialogs/tabbingdialog_base.ui:46 #, kde-format msgid "Number of &rows:" msgstr "Número de &filas:" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:62 #, kde-format msgid "Number of c&ols:" msgstr "Número de c&olumnas:" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:63 #, kde-format msgid "" "Space command\n" "to &separate groups:" msgstr "" "Orde de espazo\n" "para &separar grupos:" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:64 #, kde-format msgid "Standard &tabulator:" msgstr "&Tabulador estándar:" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:65 #, kde-format msgid "Display&math mode:" msgstr "&Modo «displaymath»:" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:66 #, kde-format msgid "Use &bullets:" msgstr "Usar &viñetas:" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:146 #: dialogs/tabular/newtabulardialog.cpp:174 #, kde-format msgid "Choose an environment." msgstr "Escoller un ambiente." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:147 #: dialogs/tabular/newtabulardialog.cpp:180 #, kde-format msgid "Use the starred version of this environment." msgstr "Empregar a versión estrelada deste ambiente." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:148 #: dialogs/tabular/newtabulardialog.cpp:176 #, kde-format msgid "Choose the number of table rows." msgstr "Escoller o número de filas da táboa." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:149 #, kde-format msgid "Choose the number of table columns or alignment groups." msgstr "Escoller o número de columnas da táboa ou grupos de aliñamento." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:150 #, kde-format msgid "Define an extra LaTeX command to separate alignment groups." msgstr "Definir unha orde extra de LaTeX para separar grupos de aliñamento." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:151 #, kde-format msgid "Choose one of some predefined tabulators." msgstr "Escoller un dos tabuladores predefinidos." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:152 #, kde-format -msgid "Some environments are only valid in math mode. You can surround them with one of these display math modes." -msgstr "Algúns ambientes só son correctos no modo matemático. O usuario poderá rodealos cun destes modos de visualización matemática." +msgid "" +"Some environments are only valid in math mode. You can surround them with one" +" of these display math modes." +msgstr "" +"Algúns ambientes só son correctos no modo matemático. O usuario poderá" +" rodealos cun destes modos de visualización matemática." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:153 #, kde-format -msgid "Insert bullets in each cell. Alt+Ctrl+Right and Alt+Ctrl+Left will move very quick from one cell to another." -msgstr "Inserir viñetas en cada cela. Con Alt+Ctrl+Dereita e Alt+Ctrl+Esquerda moverase moi rápido dunha cela a outra." +msgid "" +"Insert bullets in each cell. Alt+Ctrl+Right and Alt+Ctrl+Left will move very" +" quick from one cell to another." +msgstr "" +"Inserir viñetas en cada cela. Con Alt+Ctrl+Dereita e Alt+Ctrl+Esquerda" +" moverase moi rápido dunha cela a outra." #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:207 #: dialogs/tabular/newtabulardialog.cpp:146 #, kde-format msgid "Number of cols:" msgstr "Número de columnas:" #. +> trunk5 #: dialogs/mathenvironmentdialog.cpp:228 #, kde-format msgid "Number of groups:" msgstr "Número de grupos:" #. +> trunk5 #: dialogs/newfilewizard.cpp:48 #, kde-format msgid "New File" msgstr "Novo ficheiro" #. +> trunk5 #: dialogs/newfilewizard.cpp:76 #, kde-format msgid "LaTeX Document" msgstr "Documento LaTeX" #. +> trunk5 #: dialogs/newfilewizard.cpp:77 #, kde-format msgid "BibTeX Document" msgstr "Documento BibTeX" #. +> trunk5 #: dialogs/newfilewizard.cpp:78 #, kde-format msgid "Kile Script" msgstr "Script de Kile" #. +> trunk5 #: dialogs/newtoolwizard.cpp:23 #, kde-format msgid "Tool Name" msgstr "Nome da ferramenta" #. +> trunk5 #: dialogs/newtoolwizard.cpp:27 #, kde-format msgid "Class" msgstr "Clase" #. +> trunk5 #: dialogs/newtoolwizard.cpp:47 #, kde-format msgid "" msgstr "" #. +> trunk5 #: dialogs/newtoolwizard.cpp:66 #, kde-format msgid "Error: A tool by this name exists already." msgstr "Erro: xa existe unha ferramenta con este nome." #. +> trunk5 #: dialogs/newtoolwizard.cpp:70 #, kde-format msgid "Error: The name may not contain a slash '/'." msgstr "Erro: O nome non pode conter unha barra «/»." #. +> trunk5 #: dialogs/newtoolwizard.cpp:74 #, kde-format msgid "Error: The name may not contain a (, ), [, or ]." msgstr "Erro: O nome non pode conter (,),[ nin ]." #. i18n: ectx: property (text), widget (QLabel, m_lbBehavior) #. +> trunk5 #: dialogs/newtoolwizard_class_page.ui:25 #, kde-format msgid "" "Select the default &behavior (class)\n" "of this tool. It will inherit all properties\n" "of the tool it is based upon.\n" "\n" "For example, selecting \"LaTeX\" will\n" "cause your tool to behave just like\n" "the standard \"LaTeX\" tool." msgstr "" "Escolla o comportamento (clase) predeterminado\n" -"desta ferramenta. Herdará todas as propiedadeda ferramenta na que está baseada.\n" +"desta ferramenta. Herdará todas as propiedadeda ferramenta na que está" +" baseada.\n" "\n" "Por exemplo, se escolle «LaTeX» fará que a\n" "ferramenta se comporte como a ferramenta «LaTeX» estándar." #. i18n: ectx: property (text), widget (QLabel, m_lbName) #. +> trunk5 #: dialogs/newtoolwizard_toolname_page.ui:19 #, kde-format msgid "Type a short descriptive name for the &tool:" msgstr "Escriba aquí un nome descritivo curto para a &ferramenta:" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:70 #, kde-format msgid "PDF Wizard" msgstr "Asistente de PDF" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:106 dialogs/pdf-wizard/pdfdialog.cpp:108 #, kde-format msgid "*.pdf|PDF Files" msgstr "*.pdf|Ficheiros PDF" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:116 dialogs/pdf-wizard/pdfdialog.cpp:728 #: dialogs/pdf-wizard/pdfdialog.cpp:853 #, kde-format msgid "Re&arrange" msgstr "Reestrutur&ar" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:129 #, kde-format msgid "1 Page + Empty Page --> 2up" msgstr "1 Páxina + Páxina baleira --> 2" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:130 #, kde-format msgid "1 Page + Duplicate --> 2up" msgstr "1 Páxina + Duplicado --> 2" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:131 #, kde-format msgid "2 Pages --> 2up" msgstr "2 Páxinas --> 2" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:132 #, kde-format msgid "2 Pages (landscape) --> 2up" msgstr "2 Páxinas (horizontal) --> 2" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:133 #, kde-format msgid "4 Pages --> 4up" msgstr "4 Páxinas --> 4" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:134 #, kde-format msgid "4 Pages (landscape) --> 4up" msgstr "4 Páxinas (horizontal) --> 4" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:135 dialogs/postscriptdialog.cpp:126 #, kde-format msgid "Select Even Pages" msgstr "Escoller as páxinas pares" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:136 dialogs/postscriptdialog.cpp:127 #, kde-format msgid "Select Odd Pages" msgstr "Escoller as páxinas impares" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:137 dialogs/postscriptdialog.cpp:128 #, kde-format msgid "Select Even Pages (reverse order)" msgstr "Escoller as páxinas pares (orde inversa)" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:138 dialogs/postscriptdialog.cpp:129 #, kde-format msgid "Select Odd Pages (reverse order)" msgstr "Escoller as páxinas impares (orde inversa)" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:139 dialogs/postscriptdialog.cpp:130 #, kde-format msgid "Reverse All Pages" msgstr "Inverter todas as páxinas" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:140 #, kde-format msgid "Decrypt" msgstr "Descifrar" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:141 #, kde-format msgid "Select Pages" msgstr "Escoller as páxinas" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:142 #, kde-format msgid "Delete Pages" msgstr "Eliminar as páxinas" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:143 #, kde-format msgid "Apply a background watermark" msgstr "Aplicar unha marca de auga ao fondo" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:144 #, kde-format msgid "Apply a background color" msgstr "Aplicar unha cor de fondo" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:145 #, kde-format msgid "Apply a foreground stamp" msgstr "Aplicar un selo no primeiro plano" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:146 #, kde-format msgid "pdftk: Choose Parameter" msgstr "pdftk: Escolla o parámetro" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:147 #, kde-format msgid "pdfpages: Choose Parameter" msgstr "pdfpages: Escolla o parámetro" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:405 #, kde-format msgctxt "%1 is the number of pages" msgid "%1 (encrypted)" msgstr "%1 (cifradas)" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:412 #, kde-format msgid "Error: unknown number of pages" msgstr "Erro: descoñécese o número de páxinas" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:425 #, kde-format msgid "PDFTK-Password" msgstr "PDFTK-Contrasinal" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:426 #, kde-format msgid "" "This PDF file is encrypted and 'pdftk' cannot open it.\n" "Please enter the password for this PDF file\n" " or leave it blank to try another method: " msgstr "" "Este ficheiro de PDF está cifrado e «pdftk» non o pode abrir.\n" "Insira o contrasinal deste ficheiro de PDF\n" "ou déixeo en branco para intentar con outro método: " #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:573 #, kde-format msgid "A password is necessary to set or change the current settings." -msgstr "Fai falta un contrasinal para configurar ou cambiar as opcións actuais." +msgstr "" +"Fai falta un contrasinal para configurar ou cambiar as opcións actuais." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:577 #, kde-format msgid "The permissions of this document can be changed with pdftk." msgstr "Pódense cambiar os permiso deste documento con pdftk." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:578 #, kde-format msgid "pdftk is not available, so no permission can be changed." -msgstr "pdftk non está dispoñíbel, polo que non se poden cambiar os permisos." +msgstr "" +"pdftk non está dispoñíbel, polo que non se poden cambiar os permisos." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:582 #, kde-format msgid "pdftk is not available, so no property can be changed." -msgstr "pdftk non está dispoñíbel, polo que non se pode cambiar a propiedade." +msgstr "" +"pdftk non está dispoñíbel, polo que non se pode cambiar a propiedade." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:585 #, kde-format msgid "The properties of this document can be changed with pdftk." msgstr "Pódense cambiar as propiedades deste documento con pdftk." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:593 #, kde-format msgid "This input file is encrypted, so only pdftk works." -msgstr "Este ficheiro de entrada está cifrado, polo que só funciona pdftk." +msgstr "" +"Este ficheiro de entrada está cifrado, polo que só funciona pdftk." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:594 #, kde-format msgid "A password is necessary to rearrange pages." msgstr "Fai falta un contrasinal para reestruturar as páxinas." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:595 #, kde-format msgid "This input file is encrypted, but pdftk is not installed." -msgstr "Este ficheiro de entrada está cifrado, pero pdftk non está instalado." +msgstr "" +"Este ficheiro de entrada está cifrado, pero pdftk non está instalado." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:599 #, kde-format -msgid "This wizard will use pdftk and the LaTeX package pdfpages." -msgstr "Este asistente vai empregar pdftk e o paquete pdfpages de LaTeX." +msgid "" +"This wizard will use pdftk and the LaTeX package pdfpages." +msgstr "" +"Este asistente vai empregar pdftk e o paquete pdfpages de LaTeX." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:600 #, kde-format -msgid "This wizard will only use pdftk (pdfpages.sty is not installed)." -msgstr "Ese asistente só vai empregar pdftk (pdfpages.sty non está instalado)." +msgid "" +"This wizard will only use pdftk (pdfpages.sty is not installed)." +msgstr "" +"Ese asistente só vai empregar pdftk (pdfpages.sty non está" +" instalado)." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:603 #, kde-format -msgid "This wizard will only use the LaTeX package pdfpages (pdftk was not found)." -msgstr "Este asistente só vai empregar o paquete de LaTeX pdfpages (non foi posíbel atopar pdftk)." +msgid "" +"This wizard will only use the LaTeX package pdfpages (pdftk was" +" not found)." +msgstr "" +"Este asistente só vai empregar o paquete de LaTeX pdfpages (non foi" +" posíbel atopar pdftk)." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:604 #, kde-format msgid "This wizard can't work, because no tool was found (see help section)." -msgstr "Este asistente non pode funcionar porque non se foi posíbel atopar ningunha ferramenta (vexa a sección de axuda)." +msgstr "" +"Este asistente non pode funcionar porque non se foi posíbel atopar ningunha" +" ferramenta (vexa a sección de axuda)." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:609 #, kde-format -msgid "(Compiled without libpoppler pdf library. Not all tasks are available.)" -msgstr "(Compilado sen a biblioteca libpoppler para pdf. Non todas as tarefas están dispoñíbeis.)" +msgid "" +"(Compiled without libpoppler pdf library. Not all tasks are available.)" +msgstr "" +"(Compilado sen a biblioteca libpoppler para pdf. Non todas as tarefas" +" están dispoñíbeis.)" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:728 #, kde-format msgid "&Update" msgstr "Act&ualizar" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:791 dialogs/pdf-wizard/pdfdialog_base.ui:55 #, kde-format msgid "Pages:" msgstr "Páxinas:" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:792 #, kde-format msgid "Comma separated page list: 1,4-7,9" msgstr "Lista de páxinas separadas por comas: 1,4-7,9" #. i18n: ectx: property (text), widget (QLabel, m_lbParameter) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:797 dialogs/pdf-wizard/pdfdialog.cpp:802 #: dialogs/pdf-wizard/pdfdialog_base.ui:277 dialogs/postscriptdialog.cpp:499 #: dialogs/postscriptdialog_base.ui:153 #: dialogs/tabular/newtabulardialog.cpp:133 #: dialogs/usermenu/usermenudialog_base.ui:607 #, kde-format msgid "Parameter:" msgstr "Parámetro:" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:798 #, kde-format msgid "All options for 'pdftk'" msgstr "Todas as opcións de «pdftk»" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:803 #, kde-format msgid "All options for 'pdfpages'" msgstr "Todas as opcións de «pdfpages»" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:825 #, kde-format -msgid "Applies a PDF watermark to the background of a single input PDF. Pdftk uses only the first page from the background PDF and applies it to every page of the input PDF. This page is scaled and rotated as needed to fit the input page." -msgstr "Aplica unha marca de auga de PDF ao fondo dun único PDF de entrada. Pdftk emprega só a primeira páxina do PDF de fondo e aplícaa a todas as páxinas do PDF de entrada. Esta páxina cámbiase de escala e rótase como se precise para cadrar coa páxina de entrada." +msgid "" +"Applies a PDF watermark to the background of a single input PDF. Pdftk uses" +" only the first page from the background PDF and applies it to every page of" +" the input PDF. This page is scaled and rotated as needed to fit the input" +" page." +msgstr "" +"Aplica unha marca de auga de PDF ao fondo dun único PDF de entrada. Pdftk" +" emprega só a primeira páxina do PDF de fondo e aplícaa a todas as páxinas do" +" PDF de entrada. Esta páxina cámbiase de escala e rótase como se precise para" +" cadrar coa páxina de entrada." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:830 #, kde-format -msgid "Applies a foreground stamp on top of the input PDF document's pages. Pdftk uses only the first page from the stamp PDF and applies it to every page of the input PDF. This page is scaled and rotated as needed to fit the input page. This works best if the stamp PDF page has a transparent background." -msgstr "Aplica unha marca de primeiro plano por enriba das páxinas do documento en PDF de entrada. Pdftk só emprega a primeira páxina do PDF coa marca e aplícaa a todas as páxinas do PDF de saída. Esta páxina cámbiase de escala e rótase como sexa preciso para cadrar coa páxina de entrada. Isto funciona mellor se a páxina coa marca de PDF tiver un fondo transparente." +msgid "" +"Applies a foreground stamp on top of the input PDF document's pages. Pdftk" +" uses only the first page from the stamp PDF and applies it to every page of" +" the input PDF. This page is scaled and rotated as needed to fit the input" +" page. This works best if the stamp PDF page has a transparent background." +msgstr "" +"Aplica unha marca de primeiro plano por enriba das páxinas do documento en" +" PDF de entrada. Pdftk só emprega a primeira páxina do PDF coa marca e" +" aplícaa a todas as páxinas do PDF de saída. Esta páxina cámbiase de escala e" +" rótase como sexa preciso para cadrar coa páxina de entrada. Isto funciona" +" mellor se a páxina coa marca de PDF tiver un fondo transparente." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:850 #, kde-format msgid "&Apply" msgstr "&Aplicar" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:868 #, kde-format msgid "" "Failed to create a temporary directory.\n" "\n" "This wizard cannot be used." msgstr "" "Non se puido crear un directorio temporal.\n" "\n" "Este asistente non pode usarse." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:896 #, kde-format msgid "" "

PDF-Wizard
" "
" "This wizard uses 'pdftk' and the LaTeX package 'pdfpages' to" "
    " "
  • rearrange pages of an existing PDF document
    • " "
  • read and update documentinfo of a PDF document (only pdftk)
    • " -"
  • read, set or change some permissions of a PDF document (only pdftk). A password is necessary to set or change this document settings. Additionally PDF encryption is done to lock the file's content behind this password.
    • " +"
  • read, set or change some permissions of a PDF document (only pdftk). A" +" password is necessary to set or change this document settings. Additionally" +" PDF encryption is done to lock the file's content behind this password.
    • " "
" -"

The package 'pdfpages' will only work with non-encrypted documents. 'pdftk' can handle both kind of documents, but a password is needed for encrypted files. If one of 'pdftk' or 'pdfpages' is not available, the possible rearrangements are reduced.

" -"

Warning: Encryption and a password does not provide any real PDF security. The content is encrypted, but the key is known. You should see it more as a polite but firm request to respect the author's wishes.

" +"

The package 'pdfpages' will only work with non-encrypted documents." +" 'pdftk' can handle both kind of documents, but a password is needed for" +" encrypted files. If one of 'pdftk' or 'pdfpages' is not available, the" +" possible rearrangements are reduced.

" +"

Warning: Encryption and a password does not provide any real PDF" +" security. The content is encrypted, but the key is known. You should see it" +" more as a polite but firm request to respect the author's wishes.

" msgstr "" "
Asistente para PDF
" "
" "Este asistente emprega «pdftk» e o paquete «pdfpages» de LaTeX para" "
    " "
  • arrumbar as páxinas dun documento en PDF existente
    • " -"
  • ler e actualizar a información do documento dun documento en PDF (só pdftk)
    • " -"
  • ler, configurar ou cambiar algúns permisos dun documento en PDF (só pdftk). Fai falta un contrasinal para configurar ou cambiar as opcións do documento. Alén disto, faise o cifrado de PDF para bloquear o contido do ficheiro detrás deste contrasinal.
    • " +"
  • ler e actualizar a información do documento dun documento en PDF (só" +" pdftk)
    • " +"
  • ler, configurar ou cambiar algúns permisos dun documento en PDF (só" +" pdftk). Fai falta un contrasinal para configurar ou cambiar as opcións do" +" documento. Alén disto, faise o cifrado de PDF para bloquear o contido do" +" ficheiro detrás deste contrasinal.
    • " "
" -"

O paquete «pdfpages» só funciona con documentos sen cifrar. «pdftk» pode manexar ambos os dous tipos de documentos, pero precísase un contrasinal para os ficheiros cifrados. Se faltan «pdftk» ou «pdfpages», as reestruturacións posíbeis vense reducidas.

" -"

Aviso: O cifrado e un contrasinal non fornecer seguranza real ao PDF. O contido está cifrado, pero a chave é coñecida. Deberíase ver isto máis como unha solicitude amábel pero firme de respectar os desexos do autor.

" +"

O paquete «pdfpages» só funciona con documentos sen cifrar. «pdftk» pode" +" manexar ambos os dous tipos de documentos, pero precísase un contrasinal" +" para os ficheiros cifrados. Se faltan «pdftk» ou «pdfpages», as" +" reestruturacións posíbeis vense reducidas.

" +"

Aviso: O cifrado e un contrasinal non fornecer seguranza real ao" +" PDF. O contido está cifrado, pero a chave é coñecida. Deberíase ver isto" +" máis como unha solicitude amábel pero firme de respectar os desexos do" +" autor.

" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:913 #, kde-format -msgid "

Information: This version of Kile was compiled without libpoppler library. Setting, changing and removing of properties and permissions is not possible.

" -msgstr "

InformaciónEsta versión de Kile compilouse sen a biblioteca libpoppler. Non é posíbel configurar, cambiar e retirar as propiedades nin os permisos.

" +msgid "" +"

Information: This version of Kile was compiled without libpoppler" +" library. Setting, changing and removing of properties and permissions is not" +" possible.

" +msgstr "" +"

InformaciónEsta versión de Kile compilouse sen a biblioteca" +" libpoppler. Non é posíbel configurar, cambiar e retirar as propiedades nin" +" os permisos.

" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:917 dialogs/pdf-wizard/pdfdialog.cpp:1705 #: dialogs/pdf-wizard/pdfdialog.cpp:1773 kile.cpp:976 #, kde-format msgid "PDF Tools" msgstr "Ferramentas de PDF" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:932 #, kde-format msgid "LaTeX with 'pdfpages' package" msgstr "LaTeX co paquete «pdfpages»" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:932 #, kde-format msgid "pdftk" msgstr "pdftk" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:933 #, kde-format msgid "Rearranging PDF file: %1" msgstr "Reestruturando o ficheiro PDF: %1" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:941 dialogs/pdf-wizard/pdfdialog.cpp:1053 #: dialogs/postscriptdialog.cpp:214 #, kde-format msgid "***** tool: " msgstr "***** utilidade: " #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:942 dialogs/pdf-wizard/pdfdialog.cpp:1054 #: dialogs/postscriptdialog.cpp:215 #, kde-format msgid "***** input file: " msgstr "***** ficheiro de entrada: " #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:943 dialogs/postscriptdialog.cpp:216 #, kde-format msgid "***** output file: " msgstr "***** ficheiro de saída: " #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:944 dialogs/pdf-wizard/pdfdialog.cpp:1055 #, kde-format msgid "***** param: " msgstr "***** parámetros: " #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:945 #, kde-format msgid "***** command: " msgstr "***** orde: " #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:946 dialogs/postscriptdialog.cpp:217 #, kde-format msgid "***** viewer: " msgstr "***** visor: " #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1108 #, kde-format msgid "An error occurred while executing the task." msgstr "Produciuse un erro ao executar a tarefa." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1164 #, kde-format msgid "Finished with an error (wrong password)" msgstr "Rematou cun erro (o contrasinal é erróneo)" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1167 #, kde-format msgid "Finished with an error" msgstr "Rematou cun erro" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1181 #, kde-format msgid "Could not create the ViewPDF tool" msgstr "Non se puido crear a ferramenta VerPDF" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1181 #, kde-format msgid "ViewPDF" msgstr "VerPDF" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1621 #, kde-format msgid "The utility needs some parameters in this mode." msgstr "A utilidade precisa algúns parámetros neste modo." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1639 #, kde-format msgid "Illegal page list 'from-to': %1 is bigger than %2." msgstr "Lista de páxinas inaceptábel «desde-ata»: %1 é maior que %2." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1643 dialogs/pdf-wizard/pdfdialog.cpp:1650 #, kde-format msgid "Illegal pagenumber: %1." msgstr "Número de páxinas inaceptábel: %1." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1663 #, kde-format msgid "You need to define a PDF file as foreground stamp." msgstr "Hai que definir un ficheiro en PDF como selo do primeiro plano." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1664 #, kde-format msgid "You need to define a PDF file as background watermark." msgstr "Hai que definir un ficheiro en PDF como marca do fondo." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1671 #, kde-format -msgid "Unknown file format: only '.pdf' is accepted as image file in this mode." -msgstr "Formato de ficheiro descoñecido: neste modo só se acepta «.pdf» como ficheiro de saída." +msgid "" +"Unknown file format: only '.pdf' is accepted as image file in this mode." +msgstr "" +"Formato de ficheiro descoñecido: neste modo só se acepta «.pdf» como ficheiro" +" de saída." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1676 #, kde-format msgid "The given file doesn't exist." msgstr "Este ficheiro non existe." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1689 #, kde-format msgid "You need to define an output file." msgstr "Debe definir un ficheiro de saída." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1696 #, kde-format msgid "Unknown file format: only '.pdf' is accepted as output file." -msgstr "Formato de ficheiro descoñecido: só se acepta «.pdf» como ficheiro de saída." +msgstr "" +"Formato de ficheiro descoñecido: só se acepta «.pdf» como ficheiro de saída." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1702 dialogs/postscriptdialog.cpp:475 #, kde-format -msgid "A file named \"%1\" already exists. Are you sure you want to overwrite it?" +msgid "" +"A file named \"%1\" already exists. Are you sure you want to overwrite it?" msgstr "Xa existe un ficheiro co nome «%1». Seguro que quere sobrescribilo?" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1735 dialogs/postscriptdialog.cpp:433 #, kde-format msgid "No input file is given." msgstr "Non se indicou ningún ficheiro de entrada." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1742 #, kde-format msgid "Unknown file format: only '.pdf' are accepted for input files." -msgstr "Formato de ficheiro descoñecido: só se aceptan os «.pdf» como ficheiros de entrada." +msgstr "" +"Formato de ficheiro descoñecido: só se aceptan os «.pdf» como ficheiros de" +" entrada." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1747 dialogs/postscriptdialog.cpp:445 #, kde-format msgid "This input file does not exist." msgstr "Este ficheiro de entrada non existe." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1759 #, kde-format msgid "No password is given." msgstr "Non se indicou ningún contrasinal." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1764 #, kde-format msgid "The password should be at least 6 characters long." msgstr "O contrasinal debe ter un mínimo de seis caracteres." #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1773 dialogs/postscriptdialog.cpp:513 #: dialogs/texdocumentationdialog.cpp:550 #, kde-format msgid "
" msgstr "
" #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog.cpp:1773 dialogs/postscriptdialog.cpp:513 #: dialogs/texdocumentationdialog.cpp:550 #, kde-format msgid "
" msgstr "
" #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (text), widget (QLabel, label_7) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:29 dialogs/postscriptdialog_base.ui:54 #, kde-format msgid "Input file:" msgstr "Ficheiro de entrada:" #. i18n: ectx: property (text), widget (QLabel, m_lbPages) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:62 #, kde-format msgid "pages" msgstr "páxinas" #. i18n: ectx: property (text), widget (QLabel, m_lbPassword) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:69 #, kde-format msgid "Password:" msgstr "Contrasinal:" #. i18n: ectx: property (text), widget (QLabel, m_lbParameterIcon) #. i18n: ectx: property (text), widget (QLabel, m_lbIconChosen) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:135 #: dialogs/usermenu/usermenudialog_base.ui:492 #, kde-format msgid "Icon" msgstr "Icona" #. i18n: ectx: property (text), widget (QLabel, m_lbParameterInfo) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:158 #, kde-format msgid "This wizard will use 'pdftk' and LaTeX package 'pdfpages'." msgstr "Este asistente vai empregar «pdftk» e o paquete «pdfpages» de LaTeX." #. i18n: ectx: attribute (title), widget (QWidget, m_tbRearrangements) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:194 #, kde-format msgid "Rearrangements" msgstr "Reestruturacións" #. i18n: ectx: property (text), widget (QLabel, label_3) #. i18n: ectx: property (text), widget (QLabel, m_lbOutfile) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:209 dialogs/postscriptdialog_base.ui:61 #, kde-format msgid "Output file:" msgstr "Ficheiro de saída:" #. i18n: ectx: property (whatsThis), widget (KUrlRequester, m_edOutfile) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:216 #, kde-format -msgid "The name of the output file. This entry may also be empty, if you want to overwrite the original file." -msgstr "O nome do ficheiro de saída. Esta estrada tamén pode estar baleira se quere substituír o ficheiro orixinal." +msgid "" +"The name of the output file. This entry may also be empty, if you want to" +" overwrite the original file." +msgstr "" +"O nome do ficheiro de saída. Esta estrada tamén pode estar baleira se quere" +" substituír o ficheiro orixinal." #. i18n: ectx: property (filter), widget (KUrlRequester, m_edInfile) #. i18n: ectx: property (filter), widget (KUrlRequester, m_edOutfile) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:219 #: dialogs/postscriptdialog_base.ui:71 dialogs/postscriptdialog_base.ui:139 #, kde-format msgid "*.ps|PS Files\\n*.ps.gz|Zipped PS Files" msgstr "*.ps|Ficheiros PS\\n*.ps.gz|Ficheiros PS comprimidos" #. i18n: ectx: property (text), widget (QLabel, label_4) #. i18n: ectx: property (text), widget (QLabel, m_lbTask) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:226 dialogs/postscriptdialog_base.ui:91 #, kde-format msgid "Task:" msgstr "Tarefa:" #. i18n: ectx: property (text), widget (QLabel, label_6) #. i18n: ectx: property (text), widget (QLabel, m_lbView) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:233 #: dialogs/postscriptdialog_base.ui:146 #, kde-format msgid "Viewer:" msgstr "Visor:" #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbView) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:240 dialogs/postscriptdialog_base.ui:78 #, kde-format -msgid "View the result of the conversion process. okular is always taken as an external viewer." -msgstr "Visualiza o resultado do proceso de conversión. Sempre se considera Okular como visor externo." +msgid "" +"View the result of the conversion process. okular is always taken as an" +" external viewer." +msgstr "" +"Visualiza o resultado do proceso de conversión. Sempre se considera Okular" +" como visor externo." #. i18n: ectx: property (text), widget (QCheckBox, m_cbView) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:243 #, kde-format msgid "Show the resulting PDF file" msgstr "Mostrar o ficheiro PDF resultante" #. i18n: ectx: property (text), widget (QCheckBox, m_cbOverwrite) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:256 #, kde-format msgid "Overwrite the original file" msgstr "Substituír o ficheiro orixinal" #. i18n: ectx: property (whatsThis), widget (QLineEdit, m_edParameter) #. i18n: ectx: property (whatsThis), widget (KLineEdit, m_edParameter) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:270 #: dialogs/postscriptdialog_base.ui:116 #, kde-format -msgid "'Select pages' and 'Free Parameter' need some specific parameter, which you can enter here" -msgstr "«Escoller as páxinas» e «Parámetro libre» precisan dun parámetro máis específico, que pode inserir aquí" +msgid "" +"'Select pages' and 'Free Parameter' need some specific parameter, which you" +" can enter here" +msgstr "" +"«Escoller as páxinas» e «Parámetro libre» precisan dun parámetro máis" +" específico, que pode inserir aquí" #. i18n: ectx: property (text), widget (QLabel, m_lbStamp) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:284 #, kde-format msgid "PDF file:" msgstr "Ficheiro PDF:" #. i18n: ectx: property (text), widget (QLabel, m_lbBackgroundColor) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:326 #, kde-format msgid "Background:" msgstr "Fondo:" #. i18n: ectx: attribute (title), widget (QWidget, m_tbProperties) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:373 dialogs/projectdialogs.cpp:430 #: widgets/previewconfigwidget.cpp:118 #, kde-format msgid "Properties" msgstr "Propiedades" #. i18n: ectx: property (title), widget (QGroupBox, m_gbProperties) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:385 #, kde-format msgid "Properties of this PDF document" msgstr "Propiedades deste documento PDF" #. i18n: ectx: property (text), widget (QLabel, label_15) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:409 #, kde-format msgid "Title:" msgstr "Título:" #. i18n: ectx: property (text), widget (QLabel, label_16) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:419 #, kde-format msgid "Creator:" msgstr "Creador:" #. i18n: ectx: property (text), widget (QLabel, label_17) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:429 #, kde-format msgid "Subject:" msgstr "Asunto:" #. i18n: ectx: property (text), widget (QLabel, label_18) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:439 #, kde-format msgid "Keywords:" msgstr "Palabras clave:" #. i18n: ectx: property (text), widget (QLabel, label_19) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:449 #, kde-format msgid "Author:" msgstr "Autor:" #. i18n: ectx: property (text), widget (QLabel, label_21) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:459 #, kde-format msgid "Producer:" msgstr "Produtor:" #. i18n: ectx: property (text), widget (QLabel, label_5) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:494 #, kde-format msgid "Format:" msgstr "Formato:" #. i18n: ectx: property (text), widget (QLabel, m_lbFormat) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:504 #, kde-format msgid "1.4" msgstr "1.4" #. i18n: ectx: property (text), widget (QLabel, label_3) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:511 #, kde-format msgid "Encryption:" msgstr "Cifrado:" #. i18n: ectx: property (text), widget (QLabel, label_23) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:528 #, kde-format msgid "Creation date:" msgstr "Data de creación:" #. i18n: ectx: property (text), widget (QLabel, m_lbCreationDate) #. i18n: ectx: property (text), widget (QLabel, m_lbModDate) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:538 #: dialogs/pdf-wizard/pdfdialog_base.ui:555 #, kde-format msgid "date" msgstr "data" #. i18n: ectx: property (text), widget (QLabel, label_22) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:545 #, kde-format msgid "Modification date:" msgstr "Data de modificación:" #. i18n: ectx: attribute (title), widget (QWidget, m_tbPermissions) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:568 #, kde-format msgid "Permissions" msgstr "Permisos" #. i18n: ectx: property (title), widget (QGroupBox, m_gbPermissions) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:580 #, kde-format msgid "Permissions (under 128-bit-security)" msgstr "Permisos (baixo seguranza de 128 bits)" #. i18n: ectx: property (text), widget (QLabel, label_2) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:612 #, kde-format msgid "Printing:" msgstr "Impresión:" #. i18n: ectx: property (text), widget (QLabel, label_6) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:622 #, kde-format msgid "Copy text or graphics:" msgstr "Copiar o texto ou os gráficos:" #. i18n: ectx: property (text), widget (QLabel, label_4) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:632 #, kde-format msgid "Modify contents:" msgstr "Modificar o contido:" #. i18n: ectx: property (text), widget (QLabel, label_9) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:642 #, kde-format msgid "Fill form fields with data:" msgstr "Encher os campos de formulario con datos:" #. i18n: ectx: property (text), widget (QCheckBox, m_cbPrinting) #. i18n: ectx: property (text), widget (QCheckBox, m_cbModify) #. i18n: ectx: property (text), widget (QCheckBox, m_cbCopy) #. i18n: ectx: property (text), widget (QCheckBox, m_cbFormFeeds) #. i18n: ectx: property (text), widget (QCheckBox, m_cbAnnotations) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:658 #: dialogs/pdf-wizard/pdfdialog_base.ui:671 #: dialogs/pdf-wizard/pdfdialog_base.ui:684 #: dialogs/pdf-wizard/pdfdialog_base.ui:697 #: dialogs/pdf-wizard/pdfdialog_base.ui:723 #, kde-format msgid "allowed" msgstr "permitido" #. i18n: ectx: property (text), widget (QLabel, label_8) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:704 #, kde-format msgid "Change or add annotations or fill form fields:" msgstr "Cambiar ou engadir anotacións ou encher os campos de formulario:" #. i18n: ectx: property (text), widget (QLabel, m_lbPrinting) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:782 #, kde-format msgid "Allow only Printing" msgstr "Só permitir imprimir" #. i18n: ectx: property (text), widget (QLabel, m_lbAll) #. +> trunk5 #: dialogs/pdf-wizard/pdfdialog_base.ui:789 #, kde-format msgid "Allow all features" msgstr "Permitir todas as funcionalidades" #. +> trunk5 #: dialogs/postscriptdialog.cpp:61 #, kde-format msgid "Rearrange Postscript File" msgstr "Reestruturar o ficheiro PostScript" #. +> trunk5 #: dialogs/postscriptdialog.cpp:98 #, kde-format msgid "Neither 'pstops' nor 'psselect' found." msgstr "Non se atoparon nin «pstops» nin «psselect»." #. +> trunk5 #: dialogs/postscriptdialog.cpp:101 #, kde-format msgid "'pstops' not found." msgstr "Non se atopou «pstops»." #. +> trunk5 #: dialogs/postscriptdialog.cpp:104 #, kde-format msgid "'psselect' not found." msgstr "Non se atopou «psselect»." #. +> trunk5 #: dialogs/postscriptdialog.cpp:115 #, kde-format msgid "1 DIN A5 Page + Empty Page --> DIN A4" msgstr "1 Páxina DIN A5 + Páxina baleira --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:116 #, kde-format msgid "1 DIN A5 Page + Duplicate --> DIN A4" msgstr "1 Páxina DIN A5 + Duplicado --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:117 #, kde-format msgid "2 DIN A5 Pages --> DIN A4" msgstr "2 Páxinas DIN A5 --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:118 #, kde-format msgid "2 DIN A5L Pages --> DIN A4" msgstr "2 Páxinas DIN A5L --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:119 #, kde-format msgid "4 DIN A5 Pages --> DIN A4" msgstr "4 Páxinas DIN A5 --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:120 #, kde-format msgid "1 DIN A4 Page + Empty Page --> DIN A4" msgstr "1 Páxina DIN A4 + Páxina baleira --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:121 #, kde-format msgid "1 DIN A4 Page + Duplicate --> DIN A4" msgstr "1 Páxina DIN A4 + Duplicado --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:122 #, kde-format msgid "2 DIN A4 Pages --> DIN A4" msgstr "2 Páxinas DIN A4 --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:123 #, kde-format msgid "2 DIN A4L Pages --> DIN A4" msgstr "2 Páxinas DIN A4L --> DIN A4" #. +> trunk5 #: dialogs/postscriptdialog.cpp:131 #, kde-format msgid "Copy All Pages (sorted)" msgstr "Copiar todas as páxinas (ordenado)" #. +> trunk5 #: dialogs/postscriptdialog.cpp:134 #, kde-format msgid "Copy All Pages (unsorted)" msgstr "Copiar todas as páxinas (sen ordenar)" #. +> trunk5 #: dialogs/postscriptdialog.cpp:135 #, kde-format msgid "pstops: Choose Parameter" msgstr "pstops: Escolla o parámetro" #. +> trunk5 #: dialogs/postscriptdialog.cpp:138 #, kde-format msgid "psselect: Choose Parameter" msgstr "pselect: Escolla o parámetro" #. +> trunk5 #: dialogs/postscriptdialog.cpp:154 #, kde-format msgid "Done" msgstr "Feito" #. +> trunk5 #: dialogs/postscriptdialog.cpp:155 #, kde-format msgid "Execute" msgstr "Executar" #. +> trunk5 #: dialogs/postscriptdialog.cpp:197 dialogs/texdocumentationdialog.cpp:291 #: dialogs/texdocumentationdialog.cpp:325 quickpreview.cpp:339 #, kde-format msgid "Could not create a temporary file." msgstr "Non se puido crear un ficheiro temporal." #. +> trunk5 #: dialogs/postscriptdialog.cpp:206 #, kde-format msgid "rearrange ps file: %1" msgstr "reestruturar o ficheiro ps: %1" #. +> trunk5 #: dialogs/postscriptdialog.cpp:253 #, kde-format msgid "An error occurred while rearranging the file." msgstr "Produciuse un erro ao reestruturar o ficheiro." #. +> trunk5 #: dialogs/postscriptdialog.cpp:440 #, kde-format -msgid "Unknown file format: only '.ps' and '.ps.gz' are accepted for input files." -msgstr "Formato de ficheiro descoñecido: só «ps» e «ps.gz» son aceptados como ficheiros de entrada." +msgid "" +"Unknown file format: only '.ps' and '.ps.gz' are accepted for input files." +msgstr "" +"Formato de ficheiro descoñecido: só «ps» e «ps.gz» son aceptados como" +" ficheiros de entrada." #. +> trunk5 #: dialogs/postscriptdialog.cpp:453 #, kde-format msgid "psselect needs some parameters in this mode." msgstr "pselect precisa algúns parámetros neste modo." #. +> trunk5 #: dialogs/postscriptdialog.cpp:456 #, kde-format msgid "pstops needs some parameters in this mode." msgstr "pstops precisa algúns parámetros neste modo." #. +> trunk5 #: dialogs/postscriptdialog.cpp:463 #, kde-format msgid "You need to define an output file or select the viewer." msgstr "Hai que definir un ficheiro de saída ou escoller o visor." #. +> trunk5 #: dialogs/postscriptdialog.cpp:470 #, kde-format msgid "Unknown file format: only '.ps' is accepted as output file." -msgstr "Formato de ficheiro descoñecido: só se acepta «.ps» como ficheiro de saída." +msgstr "" +"Formato de ficheiro descoñecido: só se acepta «.ps» como ficheiro de saída." #. +> trunk5 #: dialogs/postscriptdialog.cpp:492 #, kde-format msgid "Copies:" msgstr "Copias:" #. +> trunk5 #: dialogs/postscriptdialog.cpp:513 kile.cpp:975 #, kde-format msgid "Postscript Tools" msgstr "Ferramentas Postcript" #. i18n: ectx: property (whatsThis), widget (KComboBox, m_cbTask) #. +> trunk5 #: dialogs/postscriptdialog_base.ui:35 #, kde-format -msgid "Choose one of the 18 operations to convert a postscript file. The last four operations need specific parameters." -msgstr "Escolla unha das 18 operacións para converter un ficheiro postscript. As últimas catro operacións precisan de parámetros específicos." +msgid "" +"Choose one of the 18 operations to convert a postscript file. The last four" +" operations need specific parameters." +msgstr "" +"Escolla unha das 18 operacións para converter un ficheiro postscript. As" +" últimas catro operacións precisan de parámetros específicos." #. i18n: ectx: property (text), widget (QLabel, m_lbInfo) #. +> trunk5 #: dialogs/postscriptdialog_base.ui:44 #, kde-format msgid "" "Conversion of ps files is made by 'pstops' and 'psselect'.\n" "Be sure to call 'dvips' with option '-t a4' and\n" "hyperref package (if needed) with option 'a4paper'." msgstr "" "Os ficheiros ps son convertidos por «pstops» e «pselect».\n" "Asegúrese de chamar por «dvips» coa opción «-t a4» e,\n" "se o precisar, o paquete hyperref coa opción «a4paper»." #. i18n: ectx: property (whatsThis), widget (KUrlRequester, m_edInfile) #. +> trunk5 #: dialogs/postscriptdialog_base.ui:68 #, kde-format msgid "Input file, which should be converted." msgstr "O ficheiro de entrada, o que debe converterse." #. i18n: ectx: property (text), widget (QCheckBox, m_cbView) #. +> trunk5 #: dialogs/postscriptdialog_base.ui:81 #, kde-format msgid "Show ps file with 'okular'" msgstr "Mostrar o ficheiro ps con «okular»" #. i18n: ectx: property (whatsThis), widget (QSpinBox, m_spCopies) #. +> trunk5 #: dialogs/postscriptdialog_base.ui:123 #, kde-format msgid "When you want to copy pages, you must enter the number of copies" msgstr "Cando queira copiar páxinas, debe inserir o número de copias" #. i18n: ectx: property (whatsThis), widget (KUrlRequester, m_edOutfile) #. +> trunk5 #: dialogs/postscriptdialog_base.ui:136 #, kde-format -msgid "The name of the output file. This entry may also be empty, if you only want to view the result without saving it. In this case the viewer checkbox must be checked." -msgstr "O nome do ficheiro de saída. Se só quere ver o resultado sen gardalo déixeo baleiro, neste caso debe marcar a opción do visor." +msgid "" +"The name of the output file. This entry may also be empty, if you only want" +" to view the result without saving it. In this case the viewer checkbox must" +" be checked." +msgstr "" +"O nome do ficheiro de saída. Se só quere ver o resultado sen gardalo déixeo" +" baleiro, neste caso debe marcar a opción do visor." #. +> trunk5 #: dialogs/projectdialogs.cpp:59 #, kde-format msgid "Extensions" msgstr "Extensións" #. +> trunk5 #: dialogs/projectdialogs.cpp:65 #, kde-format msgid "Insert a short descriptive name of your project here." msgstr "Insira aquí un nome descritivo curto do proxecto." #. +> trunk5 #: dialogs/projectdialogs.cpp:66 #, kde-format -msgid "Insert a list (separated by spaces) of file extensions which should be treated also as files of the corresponding type in this project." -msgstr "Insira unha lista (separada por espazos) de extensións de ficheiro que deben tratarse tamén como ficheiros do tipo correspondente neste proxecto." +msgid "" +"Insert a list (separated by spaces) of file extensions which should be" +" treated also as files of the corresponding type in this project." +msgstr "" +"Insira unha lista (separada por espazos) de extensións de ficheiro que deben" +" tratarse tamén como ficheiros do tipo correspondente neste proxecto." #. +> trunk5 #: dialogs/projectdialogs.cpp:70 #, kde-format msgid "Project &title:" msgstr "&Título do proxecto:" #. +> trunk5 #: dialogs/projectdialogs.cpp:83 #, kde-format msgid "Project &folder:" msgstr "Carta&fol do proxecto:" #. +> trunk5 #: dialogs/projectdialogs.cpp:85 #, kde-format msgid "Insert the path to your project here." msgstr "Insira aquí a ruta ao proxecto." #. +> trunk5 #: dialogs/projectdialogs.cpp:97 #, kde-format msgid "(use global settings)" msgstr "(empregar as opcións globais)" #. +> trunk5 #: dialogs/projectdialogs.cpp:98 #, kde-format msgid "Default graphic extension to open when none specified by file name." -msgstr "Extensión gráfica predeterminada que abrir cando o nome do ficheiro non indique ningunha." +msgstr "" +"Extensión gráfica predeterminada que abrir cando o nome do ficheiro non" +" indique ningunha." #. +> trunk5 #: dialogs/projectdialogs.cpp:109 #, kde-format msgid "Source Files" msgstr "Ficheiros de fonte" #. +> trunk5 #: dialogs/projectdialogs.cpp:110 #, kde-format msgid "Package Files" msgstr "Ficheiros de paquete" #. +> trunk5 #: dialogs/projectdialogs.cpp:111 kileextensions.cpp:82 #, kde-format msgid "Image Files" msgstr "Ficheiros de imaxe" #. +> trunk5 #: dialogs/projectdialogs.cpp:112 #, kde-format msgid "Bibliography Files" msgstr "Ficheiros de bibliografía" #. +> trunk5 #: dialogs/projectdialogs.cpp:119 #, kde-format msgid "Default Graphics Extension:" msgstr "Extensión gráfica predeterminada:" #. +> trunk5 #: dialogs/projectdialogs.cpp:121 #, kde-format msgid "Predefined:" msgstr "Predefinido:" #. +> trunk5 #: dialogs/projectdialogs.cpp:157 #, kde-format msgid "" "Error in extension '%1':\n" "All user-defined extensions should look like '.xyz'" msgstr "" "Erro na extensión «%1»:\n" "Todas as extensión definidas polo usuario deben ser á maneira «.xyz»" #. +> trunk5 #: dialogs/projectdialogs.cpp:157 #, kde-format msgid "Invalid extension" msgstr "A extensión é incorrecta" #. +> trunk5 #: dialogs/projectdialogs.cpp:224 #, kde-format msgid "Create New Project" msgstr "Crear un proxecto novo" #. +> trunk5 #: dialogs/projectdialogs.cpp:238 #, kde-format msgid "Create a new file and add it to this project" msgstr "Crear un ficheiro novo e engadilo a este proxecto" #. +> trunk5 #: dialogs/projectdialogs.cpp:240 #, kde-format msgid "File&name (relative to where the project file is):" msgstr "&Nome do ficheiro (relativo a onde está o ficheiro do proxecto):" #. +> trunk5 #: dialogs/projectdialogs.cpp:247 #, kde-format -msgid "If you want Kile to create a new file and add it to the project, then check this option and select a template from the list that will appear below." -msgstr "Se quere que Kile cree un ficheiro novo e o engada ao proxecto, marque esta opción e escolla un modelo na lista que aparece embaixo." +msgid "" +"If you want Kile to create a new file and add it to the project, then check" +" this option and select a template from the list that will appear below." +msgstr "" +"Se quere que Kile cree un ficheiro novo e o engada ao proxecto, marque esta" +" opción e escolla un modelo na lista que aparece embaixo." #. +> trunk5 #: dialogs/projectdialogs.cpp:337 #, kde-format msgid "" -"You have not entered a project name. If you decide to proceed, the project name will be set to \"Untitled\".\n" +"You have not entered a project name. If you decide to proceed, the project" +" name will be set to \"Untitled\".\n" "Do you want to create the project nevertheless?" msgstr "" -"Non escribiu un nome de proxecto. Se decide continuar, o nome definirase como «Sen título».\n" +"Non escribiu un nome de proxecto. Se decide continuar, o nome definirase como" +" «Sen título».\n" "Quere crear o proxecto aínda así?" #. +> trunk5 #: dialogs/projectdialogs.cpp:338 #, kde-format msgid "No Project Name Given" msgstr "Non se indicou o nome do ficheiro" #. +> trunk5 #: dialogs/projectdialogs.cpp:339 kileviewmanager.cpp:1037 #, kde-format msgid "Untitled" msgstr "Sen título" #. +> trunk5 #: dialogs/projectdialogs.cpp:350 #, kde-format msgid "Please enter the folder where the project file should be saved to." msgstr "Insira o cartafol no que desexa gardar o ficheiro do proxecto." #. +> trunk5 #: dialogs/projectdialogs.cpp:350 #, kde-format msgid "Empty Location" msgstr "Lugar baleiro" #. +> trunk5 #: dialogs/projectdialogs.cpp:355 #, kde-format msgid "Please enter an absolute path to the project folder." msgstr "Insira o a ruta absoluta ao cartafol do proxecto." #. +> trunk5 #: dialogs/projectdialogs.cpp:355 #, kde-format msgid "Invalid Location" msgstr "Lugar incorrecto" #. +> trunk5 #: dialogs/projectdialogs.cpp:360 #, kde-format -msgid "Please enter a filename for the file that should be added to this project." -msgstr "Insira un nome de ficheiro para o ficheiro que desexa engadir a este proxecto." +msgid "" +"Please enter a filename for the file that should be added to this project." +msgstr "" +"Insira un nome de ficheiro para o ficheiro que desexa engadir a este proxecto." #. +> trunk5 #: dialogs/projectdialogs.cpp:360 #, kde-format msgid "No File Name Given" msgstr "Non se indicou o nome do ficheiro" #. +> trunk5 #: dialogs/projectdialogs.cpp:373 #, kde-format msgid "The project file exists already. Please choose another name." msgstr "O ficheiro de proxecto xa existe. Escolla outro nome." #. +> trunk5 #: dialogs/projectdialogs.cpp:373 dialogs/projectdialogs.cpp:379 #, kde-format msgid "Project File Already Exists" msgstr "O ficheiro do proxecto xa existe" #. +> trunk5 #: dialogs/projectdialogs.cpp:379 #, kde-format -msgid "The GUI settings file exists already. Please choose another project name." -msgstr "O ficheiro de configuración da interface gráfica xa existe. Escolla outro nome de proxecto." +msgid "" +"The GUI settings file exists already. Please choose another project name." +msgstr "" +"O ficheiro de configuración da interface gráfica xa existe. Escolla outro" +" nome de proxecto." #. +> trunk5 #: dialogs/projectdialogs.cpp:394 #, kde-format msgid "The file \"%1\" already exists, overwrite it?" msgstr "O ficheiro «%1» xa existe, desexa substituílo?" #. +> trunk5 #: dialogs/projectdialogs.cpp:394 documentinfo.cpp:134 #, kde-format msgid "File Already Exists" msgstr "O ficheiro xa existe" #. i18n: ectx: property (title), widget (QGroupBox, groupBox5) #. +> trunk5 #: dialogs/projectdialogs.cpp:420 widgets/generalconfigwidget.ui:32 #, kde-format msgid "Project Options" msgstr "Opcións do proxecto" #. +> trunk5 #: dialogs/projectdialogs.cpp:421 #, kde-format msgid "(use global setting)" msgstr "(empregar a configuración global)" #. +> trunk5 #: dialogs/projectdialogs.cpp:436 #, kde-format msgid "Select the default master document. Leave empty for auto detection." -msgstr "Escolla o documento mestre predeterminado. Déixeo baleiro para detectalo automaticamente." +msgstr "" +"Escolla o documento mestre predeterminado. Déixeo baleiro para detectalo" +" automaticamente." #. +> trunk5 #: dialogs/projectdialogs.cpp:441 #, kde-format msgid "&Master document:" msgstr "Documento &mestre:" #. +> trunk5 #: dialogs/projectdialogs.cpp:447 #, kde-format msgid "(auto-detect)" msgstr "(detección automática)" #. +> trunk5 #: dialogs/projectdialogs.cpp:464 #, kde-format msgid "&QuickBuild configuration:" msgstr "Configuración de &QuickBuild:" #. +> trunk5 #: dialogs/projectdialogs.cpp:483 #, kde-format msgid "&MakeIndex options" msgstr "Opcións de &MakeIndex" #. +> trunk5 #: dialogs/projectdialogs.cpp:597 #, kde-format msgid "" "

Could not create the project folder \"\n" "%1\"

" "." "

Please check whether you have write permissions.

" msgstr "" "

Non se puido crear o cartafol de proxecto «\n" "%1».

" "

Comprobe se ten permisos de escritura.

" #. +> trunk5 #: dialogs/projectdialogs.cpp:604 #, kde-format msgid "" "

The project folder \"(%1)\" is not writable.

" "

Please check the permissions of the project folder.

" msgstr "" "

O cartafol do proxecto («%1») non permite escritura.

" " " "

Revise os permisos do cartafol.

" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:106 #, kde-format msgid "Cla&ss Options" msgstr "Opcións da &clase" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:107 #, kde-format msgid "&Packages" msgstr "&Paquetes" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:108 #, kde-format msgid "&Document Properties" msgstr "&Propiedades do documento" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:146 #, kde-format msgid "Doc&ument class:" msgstr "Clase de &documento:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:153 dialogs/quickdocumentdialog.cpp:175 #: dialogs/quickdocumentdialog.cpp:198 #, kde-format msgid "Add an entry to this combo box" msgstr "Engadir unha entrada a esta lista de selección" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:159 dialogs/quickdocumentdialog.cpp:181 #: dialogs/quickdocumentdialog.cpp:204 #, kde-format msgid "Remove current entry from this combo box" msgstr "Retirar esta entrada desta lista" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:168 #, kde-format msgid "&Typeface size:" msgstr "Tamaño do &tipo de letra:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:191 dialogs/quickdocumentdialog.cpp:595 #, kde-format msgid "Paper si&ze:" msgstr "Tamaño do &papel:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:214 #, kde-format msgid "E&ncoding:" msgstr "&Codificación:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:222 dialogs/quickdocumentdialog.cpp:278 #: kilestdactions.cpp:56 #, kde-format msgid "Description" msgstr "Descrición" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:231 #, kde-format msgid "Cl&ass options:" msgstr "Opcións da &clase:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:246 #, kde-format msgid "Add a new class option" msgstr "Engadir unha opción de clase nova" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:250 dialogs/quickdocumentdialog.cpp:308 #, kde-format msgid "Ed&it..." msgstr "&Editar…" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:252 #, kde-format msgid "Edit the current class option" msgstr "Editar a opción actual da clase" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:258 #, kde-format msgid "Remove the current class option" msgstr "Retirar a actual opción de clase" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:273 #, kde-format msgid "LaTe&X packages:" msgstr "Paquetes de LaTe&X:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:278 #, kde-format msgid "Package" msgstr "Paquete" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:278 #, kde-format msgid "Value" msgstr "Valor" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:298 #, kde-format msgid "&Add Package..." msgstr "Eng&adir un paquete…" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:300 #, kde-format msgid "Add a new package" msgstr "Engadir un paquete novo" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:303 #, kde-format msgid "Add Op&tion..." msgstr "Engadir unha &opción…" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:305 #, kde-format msgid "Add a new package option" msgstr "Engadir unha nova opción do paquete" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:310 #, kde-format msgid "Edit the current package option" msgstr "Editar a opción actual do paquete" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:315 #, kde-format msgid "Remove the current package option" msgstr "Retirar a opción actual do paquete" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:318 #, kde-format msgid "&Reset to Defaults" msgstr "&Repor as predefinicións" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:320 #, kde-format msgid "Reset to the default list of packages" msgstr "Reiniciar coa lista predeterminada de paquetes" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:344 #, kde-format msgid "&Author:" msgstr "&Autor:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:350 #, kde-format msgid "&Title:" msgstr "&Título:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:356 #, kde-format msgid "Dat&e:" msgstr "&Data:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:593 #, kde-format msgid "&Theme:" msgstr "&Tema:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:647 #, kde-format msgid "Sets the document's orientation to landscape" msgstr "Estabelece a orientación do documento como apaisado" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:648 #, kde-format msgid "Margins are set for single side output" msgstr "As marxes están axustadas para imprimir nunha soa cara" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:649 #, kde-format msgid "Left and right pages differ in page margins" msgstr "As páxinas esquerda e dereita teñen marxes distintas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:650 #, kde-format msgid "Marks \"overfull hboxes\" on the output with black boxes" msgstr "Marca as «caixas horizontais desbordantes» na saída con caixas negras" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:651 #, kde-format msgid "No special marks for \"overfull hboxes\" on the output" -msgstr "Sen marcas especiais para as «caixas horizontais desbordantes» na saída" +msgstr "" +"Sen marcas especiais para as «caixas horizontais desbordantes» na saída" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:652 #, kde-format msgid "Puts formula numbers on the left side" msgstr "Pon os números das fórmulas no lado esquerdo" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:653 #, kde-format msgid "Aligns formulas on the left side" msgstr "Aliña as fórmulas no lado esquerdo" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:659 #, kde-format msgid "Puts title and abstract on an extra page" msgstr "Pon o título e o resumo nunha páxina adicional" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:660 #, kde-format msgid "Puts title and abstract on the same page as the text" msgstr "Pon o título e o resumo na mesma páxina co texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:661 #, kde-format msgid "Puts the text in one column" msgstr "Pon o texto nunha columna" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:662 #, kde-format msgid "Puts the text in two columns" msgstr "Pon o texto en dúas columnas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:663 #, kde-format msgid "Formats the bibliography in open style" msgstr "Formata a bibliografía con estilo aberto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:669 #, kde-format msgid "Chapters may start on top of every page" msgstr "Os capítulos deben comezar na parte superior de cada páxina" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:670 #, kde-format msgid "Chapters may only start on top of right pages" msgstr "Os capítulos só poden comezar na parte superior das páxinas dereitas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:676 #, kde-format msgid "Cause the header to be counted as text" msgstr "Contar a cabeceira como texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:677 #, kde-format msgid "Cause the header to be counted as border" msgstr "Contar a cabeceira como bordo" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:678 #, kde-format msgid "Cause the footer to be counted as text" msgstr "Contar o rodapé como texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:679 #, kde-format msgid "Cause the footer to be counted as border" msgstr "Contar o rodapé como bordo" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:680 #, kde-format msgid "Cause the margin-note to be counted to the text body" msgstr "Contar as nota na marxe como corpo do texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:681 #, kde-format msgid "The normal margin is used for the margin-note area" msgstr "A marxe normal emprégase para a área da nota na marxe" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:682 #, kde-format msgid "Writes the paper size as a special into the DVI-file" msgstr "Escribe o tamaño do papel como un especial no ficheiro DVI" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:683 #, kde-format msgid "Writes the paper size into the pdftex page register" msgstr "Escribe o tamaño do papel no rexistro da páxina pdftex" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:684 #, kde-format msgid "Uses the correct mechanism with PDF- or DVI-file" msgstr "Emprega o mecanismo correcto co ficheiro PDF ou DVI" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:685 #, kde-format msgid "Enables the default for an empty left page" msgstr "Activa o predeterminado para unha páxina esquerda baleira" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:686 #, kde-format msgid "An empty left page will set with the plain-pagestyle" msgstr "Unha páxina esquerda baleira escollerase con estilo de páxina plano" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:687 #, kde-format msgid "An empty left page will set with the empty-pagestyle" msgstr "Unha páxina esquerda baleira escollerase con estilo de páxina baleiro" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:688 #, kde-format msgid "Use a line to separate the header from the text body" msgstr "Usar unha liña para separar a cabeceira do corpo do texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:689 #, kde-format msgid "Use no line to separate the header from the text body" msgstr "Non usar liña ningunha para separar a cabeceira do corpo do texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:690 #, kde-format msgid "Use a line to separate the footer from the text body" msgstr "Usar unha liña para separar o rodapé do corpo do texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:691 #, kde-format msgid "Use no line to separate the footer from the text body" msgstr "Non usar liña ningunha para separar o rodapé do corpo do texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:692 #, kde-format msgid "Normal paragraph spacing of one line" msgstr "Separación normal de parágrafo dunha liña" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:693 #, kde-format msgid "Normal spacing, at least 1/3 of the last line is free" msgstr "Separación normal, polo menos 1/3 da última liña está ceiba" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:694 #, kde-format msgid "Normal spacing, at least 1/4 of the last line is free" msgstr "Separación normal, polo menos 1/4 da última liña está ceiba" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:695 #, kde-format msgid "Normal spacing, no special provision for the last line" msgstr "Separación normal, sen provisión especial para a última liña" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:696 #, kde-format msgid "Paragraph spacing of half a line" msgstr "Separación entre parágrafos de media liña" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:697 #, kde-format msgid "Spacing 1/2 line, at least 1/3 of the last line is free" msgstr "Separando 1/2 liña, polo menos 1/3 da última liña está ceiba" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:698 #, kde-format msgid "Spacing 1/2 line, at least 1/4 of the last line is free" msgstr "Separando 1/2, a lo menos 1/4 da última liña está ceiba" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:699 #, kde-format msgid "Spacing 1/2 line, no special provision for the last line" msgstr "Separación 1/2 liña, non hai provisión para a última liña" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:700 #, kde-format msgid "No spacing between paragraphs, indent the first line by 1 em" msgstr "Non hai separación entre parágrafos, tabular a primeira liña en 1 em" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:701 #, kde-format msgid "One-line captions are centered, multi-line left-justified" -msgstr "Os títulos dunha liña son centrados, os de varias liñas xustificados á esquerda" +msgstr "" +"Os títulos dunha liña son centrados, os de varias liñas xustificados á" +" esquerda" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:702 #, kde-format msgid "No special handling of one-line captions" msgstr "Non hai xestión especial para os títulos dunha só liña" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:703 #, kde-format msgid "Normal great title font sizes" msgstr "Tamaños de tipo de letra grandes (normais) para os títulos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:704 #, kde-format msgid "Small font sizes for titles" msgstr "Tamaños de tipo de letra pequenos para os títulos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:705 #, kde-format msgid "Even smaller font sizes for titles" msgstr "Tamaños de tipo de letra ananos para os títulos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:706 #, kde-format msgid "Include lists of figures and tables in the TOC" msgstr "Incluír listas de figuras e táboas no índice" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:707 #, kde-format msgid "Include the bibliography in the TOC" msgstr "Incluír a bibliografía no índice" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:708 #, kde-format msgid "Include the index in the TOC" msgstr "Incluír o índice de materias no índice" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:709 #, kde-format msgid "Number the lists of figures and tables in the TOC" msgstr "Numerar as listas e figuras e táboas no índice" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:710 #, kde-format msgid "Number the bibliography in the TOC" msgstr "Numerar a bibliografía no índice" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:711 #, kde-format msgid "All numbers and titles are set in a left-justified column" -msgstr "Todos os números e títulos son dispostos nunha columna xustificada á esquerda" +msgstr "" +"Todos os números e títulos son dispostos nunha columna xustificada á esquerda" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:712 #, kde-format msgid "Different sectional units have different indentations" msgstr "As unidades de seccións distintas teñen sangrados distintos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:713 #, kde-format msgid "All numbers and captions are set in a left-justified column" -msgstr "Todos os números e títulos son dispostos nunha columna xustificada á esquerda" +msgstr "" +"Todos os números e títulos son dispostos nunha columna xustificada á esquerda" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:714 #, kde-format msgid "All Numbers uses a fixed space" msgstr "Todos os números empregan fontes de anchura fixa" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:715 #, kde-format msgid "Numbering of sectional units have a point at the end" msgstr "A numeración das unidades de seccións teñen un punto no fin" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:716 #, kde-format msgid "Numbering of sectional units have no point at the end" msgstr "A numeración das unidades de seccións non teñen un punto no fin" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:717 #, kde-format msgid "Caption command acts like \\captionabove" msgstr "A orde título actúa como \\captionabove" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:718 #, kde-format msgid "Caption command acts like \\captionbelow" msgstr "A orde título actúa como \\captionbelow" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:719 #, kde-format msgid "Captions of the longtable package should not be redefined" msgstr "Os títulos do paquete «longtable» non deberan redefinirse." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:725 #, kde-format msgid "Use a separate line for the chapter number" msgstr "Empregar unha liña á parte para o número de título" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:726 #, kde-format msgid "Use the same line for the chapter number and title" msgstr "Empregar a mesma liña para o número do título e o título" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:727 #, kde-format msgid "Use a separate line for the appendix name" msgstr "Empregar unha liña á parte para o nome dos apéndices" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:728 #, kde-format msgid "No separate line for the appendix name" msgstr "Non hai liña á parte para o nome do apéndice" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:734 #, kde-format msgid "Include the abstract's title" msgstr "Incluír o título do resumo" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:735 #, kde-format msgid "Exclude the abstract's title" msgstr "Excluír o título do resumo" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:741 #, kde-format msgid "The file is compiled in draft mode" msgstr "O ficheiro está compilado no modo borrador" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:742 #, kde-format msgid "The file is compiled in final mode" msgstr "O ficheiro está compilado no modo final" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:743 #, kde-format msgid "Slides will use many colors" msgstr "As diapositivas empregarán moitas cores" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:744 #, kde-format msgid "Slides will use a restricted set of colors" msgstr "As diapositivas empregarán un conxunto restrinxido de cores" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:745 #, kde-format msgid "Display the number of the current slide and the total number" msgstr "Ver o número da diapositiva e o número total" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:746 #, kde-format msgid "Display only the number of the current slide" msgstr "Ver só o número da diapositiva" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:747 #, kde-format msgid "The background of the slide is always white" msgstr "O fondo da diapositiva é sempre branco" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:748 #, kde-format msgid "The color of the background depends on the current style" msgstr "A cor do fondo depende do estilo actual" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:749 #, kde-format msgid "The LaTeX file is compiled to produce a PostScript file" msgstr "O ficheiro LaTeX é compilado para producir un ficheiro PostScript" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:750 #, kde-format msgid "The LaTeX file is compiled to produce a PDF file" msgstr "O ficheiro LaTeX é compilado para producir un ficheiro PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:751 #, kde-format msgid "Some macros interpret their argument in ps mode" msgstr "Algunhas macros interpretan os seus argumentos no modo ps" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:752 #, kde-format msgid "Some macros do not interpret their argument in ps mode" msgstr "Algunhas macros non interpretan os seus argumentos no modo ps" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:753 #, kde-format msgid "The PS file is to be translated into a PDF file using Adobe Distiller" -msgstr "O ficheiro PS traducirase nun ficheiro PDF empregando o Adobe Distiller" +msgstr "" +"O ficheiro PS traducirase nun ficheiro PDF empregando o Adobe Distiller" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:754 #, kde-format msgid "The LaTeX file is to be processed with YandY LaTeX" msgstr "O ficheiro LaTeX ha procesarse con YandY LaTeX" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:755 #, kde-format msgid "The PS file is to be translated into a PDF file using ps2pdf" msgstr "O ficheiro PS ha converterse nun ficheiro PDF empregando ps2pdf." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:756 #, kde-format msgid "The LaTeX file is to be processed with MicroPress VTeX" msgstr "O ficheiro LaTeX ha procesarse con MicroPres VTeX" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:757 #, kde-format msgid "Do not add any caption at the bottom of the slides" msgstr "Non engadir ningún título na parte inferior das diapositivas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:763 #, kde-format msgid "Place text of slides at the (vertical) top of the slides" -msgstr "Colocar o texto das diapositivas na parte de enriba (vertical) das diapositivas" +msgstr "" +"Colocar o texto das diapositivas na parte de enriba (vertical) das" +" diapositivas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:764 #, kde-format msgid "Place text of slides at the (vertical) center of the slides" msgstr "Colocar o texto das diapositivas no centro (vertical) das diapositivas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:765 #, kde-format msgid "Headlines, footlines, and sidebars are replaced by gray rectangles" msgstr "Título, rodapé e barras laterais substitúense por rectángulos grises" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:766 #, kde-format msgid "Make all navigation bars as small as possible" msgstr "Facer todas as barras de navegación tan pequenas como sexa posíbel" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:767 #, kde-format msgid "Suppresses generation of some entries in the pdf information" msgstr "Suprimir a xeración dalgunhas entradas na información do pdf" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:768 #, kde-format msgid "Switches off the definition of default blocks like theorem" msgstr "Desactiva a definición dos bloques predeterminados como teoremas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:769 #, kde-format msgid "Does not load amsthm and amsmath" msgstr "Non carga amsthm nin amsmath" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:770 #, kde-format msgid "Needed when using the CJK package for Asian fonts" msgstr "Precísase cando se usa o paquete CJK para tipos de letra asiáticos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:771 #, kde-format msgid "Use a sans-serif font during the presentation" msgstr "Usar un tipo de letra sans-serif durante a presentación" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:772 #, kde-format msgid "Use a serif font during the presentation" msgstr "Usar un tipo de letra serif durante a presentación" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:773 #, kde-format msgid "Override the math font to be a sans-serif font" msgstr "Substituír o tipo de letra matemático por un tipo de letra sans-serif" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:774 #, kde-format msgid "Override the math font to be a serif font" msgstr "Substituír o tipo de letra matemático por un tipo de letra serif" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:775 #, kde-format msgid "Deactivate internal font replacements for math text" -msgstr "Desactivar as substitucións de tipos de letra internos nos textos matemáticos" +msgstr "" +"Desactivar as substitucións de tipos de letra internos nos textos matemáticos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:776 #, kde-format msgid "Create a PDF handout" msgstr "Crear un PDF de distribución" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:777 #, kde-format msgid "For PDF transparency" msgstr "Para diapositivas de PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:778 #, kde-format msgid "All structure elements are typeset in blue" msgstr "Todos os elementos da estrutura son mostrados en azul" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:779 #, kde-format msgid "All structure elements are typeset in red" msgstr "Todos os elementos da estrutura son mostrados en vermello" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:780 #, kde-format msgid "All structure elements are typeset in black and white" msgstr "Todos os elementos da estrutura son mostrados en branco e negro" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:781 #, kde-format msgid "All structure elements are typeset in brown" msgstr "Todos os elementos da estrutura son mostrados en marrón" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:782 #, kde-format msgid " Notes are not shown" msgstr " As notas non son mostradas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:783 #, kde-format msgid " Include notes in the output file" msgstr " Incluír as notas no ficheiro de saída" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:784 #, kde-format msgid " Include only notes and suppress frames" msgstr " Incluír só as notas e suprimir os marcos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:981 #, kde-format msgid "%1 '%2' already exists." msgstr "%1 «%2» xa existe." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1033 #, kde-format msgid "Special math environments and commands (AMS)" msgstr "Ambientes e ordes matemáticos especiais (AMS)" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1034 #, kde-format msgid "Collection of fonts and symbols for math mode (AMS)" msgstr "Colección de tipos de letra e símbolos para o modo matemático (AMS)" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1035 #, kde-format msgid "Defines symbol names for all math symbols in MSAM and MSBM (AMS)" msgstr "Define os nomes de símbolo para todos os símbolos en MSAM e MSBM (AMS)" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1036 #, kde-format msgid "Improved theorem setup (AMS)" msgstr "Configuración mellorada de teorema (AMS)" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1037 #, kde-format msgid "Extends caption capabilities for figures and tables" msgstr "Mellora as posibilidades dos títulos para figuras e táboas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1039 #, kde-format msgid "Hypertext marks in LaTeX" msgstr "Marcas de hipertexto en LaTeX" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1041 #, kde-format msgid "Use dvips as hyperref driver" msgstr "Usar dvips como controlador de hyperref" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1043 #, kde-format msgid "Use pdftex as hyperref driver" msgstr "Usar pdftex como controlador de hyperref" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1044 #, kde-format msgid "Make bookmarks" msgstr "Facer marcadores" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1045 #, kde-format msgid "Put section numbers in bookmarks" msgstr "Pór os números de sección nos marcadores" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1046 #, kde-format msgid "Open up bookmark tree" msgstr "Abrir a árbore de marcadores" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1047 #, kde-format msgid "Text for PDF Author field" msgstr "Texto do campo Autor do PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1048 #, kde-format msgid "Text for PDF Creator field" msgstr "Texto do campo Creador do PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1048 #, kde-format msgid "LaTeX with hyperref package" msgstr "LaTeX co paquete hyperref" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1049 #, kde-format msgid "Resize document window to fit document size" msgstr "Axustar o tamaño da xanela co documento ao tamaño deste" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1050 #, kde-format msgid "Text for PDF Keywords field" msgstr "Texto do campo Palabras clave do PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1051 #, kde-format msgid "Text for PDF Producer field" msgstr "Texto do campo Produtor do PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1052 #, kde-format msgid "Starting view of PDF document" msgstr "Estase a iniciar a vista do documento PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1053 #, kde-format msgid "Text for PDF Subject field" msgstr "Texto do campo Asunto do PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1054 #, kde-format msgid "Text for PDF Title field" msgstr "Texto do campo Título do PDF" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1056 #, kde-format msgid "Use Palatino font as roman font (both text and math mode)" -msgstr "Usar o tipo de letra Palatino como tipo de letra roman (tanto en texto como modo matemático)" +msgstr "" +"Usar o tipo de letra Palatino como tipo de letra roman (tanto en texto como" +" modo matemático)" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1057 #, kde-format msgid "Use Times font as roman font (both text and math mode)" -msgstr "Usar o tipo de letra Times como tipo de letra roman (tanto no texto como modo matemático)" +msgstr "" +"Usar o tipo de letra Times como tipo de letra roman (tanto no texto como modo" +" matemático)" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1058 #, kde-format msgid "Enable index generation" msgstr "Activar a xeración de índices de materias" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1059 #, kde-format msgid "Enables multicolumn environments" msgstr "Activar os ambientes multi-columna" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1060 #, kde-format msgid "Load all pstricks packages" msgstr "Cargar todos os paquetes pstricks" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1061 #, kde-format msgid "Rotates text" msgstr "Rota o texto" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1062 #, kde-format msgid "Enables subfigures inside figures" msgstr "Activa as subfiguras dentro das figuras" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1063 #, kde-format msgid "Typesetting capital Greek letters" msgstr "Estanse a empregar letras gregas en maiúsculas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1064 #, kde-format msgid "Extending LaTeX's color facilities" msgstr "Estasnse a aumentar os recursos de cor de LaTeX" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1066 #, kde-format msgid "Adds language specific support" msgstr "Engade compatibilidade específica do idioma" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1133 #, kde-format msgid "Use a font encoding scheme" msgstr "Usar un sistema de codificación de tipo de letra" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1163 #, kde-format msgid "Support for including graphics" msgstr "Funcionalidade para incluír gráficos" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1166 #, kde-format msgid "Specialize on graphic inclusion for dvips" msgstr "Especialización na inclusión de gráficos para dvips" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1167 #, kde-format msgid "Specialize on graphic inclusion for pdftex" msgstr "Especialización na inclusión de gráficos para pdftex" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1168 #, kde-format msgid "Show only frames of graphics" msgstr "Mostrar os marcos só das gráficas" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1364 dialogs/quickdocumentdialog.cpp:1373 #: dialogs/quickdocumentdialog.cpp:1558 dialogs/quickdocumentdialog.cpp:1574 #: dialogs/quickdocumentdialog.cpp:2019 #, kde-format msgid "" msgstr "" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1366 dialogs/quickdocumentdialog.cpp:1373 #, kde-format msgid "" msgstr "" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1659 kilestdactions.cpp:30 #, kde-format msgid "Document Class" msgstr "Clase de documento" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1661 #, kde-format msgid "Please enter the new document &class:" msgstr "Insira a &clase do novo documento:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1663 #, kde-format msgid "&Set all options from this standard class (optional):" msgstr "&Escoller todas as opcións desde esta clase estándar (opcional):" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1665 #, kde-format msgid "Use standard &fontsizes" msgstr "Usar &tamaños de tipo de letra estándar" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1666 #, kde-format msgid "Use standard &papersizes" msgstr "Usar tamaños de &papel estándar" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1716 #, kde-format msgid "Do you want to remove \"%1\" from the document class list?" msgstr "Quere retirar «%1» da lista de clases de documentos?" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1717 #, kde-format msgid "Remove Document Class" msgstr "Retirar unha clase de documento" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1767 #, kde-format msgid "Add Fontsize" msgstr "Engadir tamaño de tipo de letra" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1769 #, kde-format msgid "Please enter the &fontsizes (comma-separated list):" msgstr "&Insira os tamaños do tipo de letras (lista separada por comas):" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1787 #, kde-format msgid "Do you want to remove \"%1\" from the fontsize list?" msgstr "Quere retirar «%1» da lista de tamaños de letra?" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1787 #, kde-format msgid "Remove Fontsize" msgstr "Retirar un tamaño de letra" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1804 #, kde-format msgid "Add Papersize" msgstr "Engadir un tamaño de papel" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1806 #, kde-format msgid "Please enter the &papersizes (comma-separated list):" msgstr "Insira os tamaños do &papel (lista separada por comas):" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1824 #, kde-format msgid "Do you want to remove \"%1\" from the papersize list?" msgstr "Quere retirar «%1» da lista de tamaños do papel?" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1824 #, kde-format msgid "Remove Papersize" msgstr "Retirar o tamaño do papel" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1843 dialogs/quickdocumentdialog.cpp:1955 #, kde-format msgid "Add Option" msgstr "Engadir unha opción" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1845 dialogs/quickdocumentdialog.cpp:1880 #, kde-format msgid "Name of &option:" msgstr "Nome da &opción:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1847 dialogs/quickdocumentdialog.cpp:1882 #: dialogs/quickdocumentdialog.cpp:1933 dialogs/quickdocumentdialog.cpp:1964 #: dialogs/quickdocumentdialog.cpp:2029 dialogs/quickdocumentdialog.cpp:2036 #, kde-format msgid "&Description:" msgstr "&Descrición:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1849 dialogs/quickdocumentdialog.cpp:1966 #, kde-format msgid "&Select this option" msgstr "&Escoller esta opción" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1878 dialogs/quickdocumentdialog.cpp:2000 #, kde-format msgid "Edit Option" msgstr "Editar a opción" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1905 #, kde-format msgid "Do you want to delete this class option?" msgstr "Quere eliminar esta opción da clase?" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1929 #, kde-format msgid "Add Package" msgstr "Engadir un paquete" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1931 dialogs/quickdocumentdialog.cpp:2007 #, kde-format msgid "&Package:" msgstr "&Paquete:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1935 #, kde-format msgid "&Select this package" msgstr "&Escoller este paquete" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1957 #, kde-format msgid "&Option:" msgstr "&Opción:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1957 dialogs/quickdocumentdialog.cpp:2001 #: dialogs/quickdocumentdialog.cpp:2277 #, kde-format msgid "package:" msgstr "paquete:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1959 #, kde-format msgid "&Editable" msgstr "&Editábel" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1960 dialogs/quickdocumentdialog.cpp:2025 #, kde-format msgid "De&fault value:" msgstr "Valores &predeterminados:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:1962 dialogs/quickdocumentdialog.cpp:2027 #, kde-format msgid "&Value:" msgstr "&Valor:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2001 #, kde-format msgid "Op&tion:" msgstr "&Opción:" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2006 #, kde-format msgid "Edit Package" msgstr "Editar un paquete" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2070 #, kde-format msgid "Do you want to delete this package option?" msgstr "Quere eliminar esta opción do paquete?" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2074 #, kde-format msgid "Do you want to delete this package?" msgstr "Quere eliminar este paquete?" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2095 #, kde-format msgid "Do you want to reset this package list?" msgstr "Quere reiniciar esta lista de paquetes?" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2095 #, kde-format msgid "Reset Package List" msgstr "Reiniciar a lista de paquetes" #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2292 #, kde-format msgid "%1 '%2' is not allowed." msgstr "Non se permite %1 «%2»." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2316 #, kde-format msgid "This document class already exists." msgstr "Esta clase de documento xa existe." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2322 #, kde-format msgid "This name is not allowed for a document class." msgstr "Este non é un nome permitido para unha clase de documento." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2329 #, kde-format msgid "This document class option already exists." msgstr "Xa existe esta opción de clase de documento." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2335 #, kde-format msgid "This package already exists." msgstr "Este paquete xa existe." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2343 #, kde-format msgid "Could not identify the package name." msgstr "Non se puido identificar o nome do paquete." #. +> trunk5 #: dialogs/quickdocumentdialog.cpp:2347 #, kde-format msgid "This package option already exists." msgstr "Esta opción de paquete xa existe." #. +> trunk5 #: dialogs/scriptshortcutdialog.cpp:25 #, kde-format msgid "New Key Sequence" msgstr "Nova secuencia de teclas" #. +> trunk5 #: dialogs/scriptshortcutdialog.cpp:45 #, kde-format msgid "Use a key sequence written in the editor to execute a script." -msgstr "Empregar unha secuencia de teclas escrita no editor para a execución dos scripts." +msgstr "" +"Empregar unha secuencia de teclas escrita no editor para a execución dos" +" scripts." #. +> trunk5 #: dialogs/scriptshortcutdialog.cpp:46 #, kde-format msgid "Use a shortcut to execute a script." msgstr "Empregar un atallo para a execución dos scripts." #. i18n: ectx: property (text), widget (QLabel, label_2) #. +> trunk5 #: dialogs/scriptshortcutdialog_base.ui:35 #, kde-format msgid "Choose the type of the key sequence:" msgstr "Escolla o tipo de secuencia de teclas:" #. i18n: ectx: property (text), widget (QRadioButton, m_rbKeySequence) #. +> trunk5 #: dialogs/scriptshortcutdialog_base.ui:79 #, kde-format msgid "Editor key sequence" msgstr "Secuencia de teclas do editor" #. i18n: ectx: property (text), widget (QRadioButton, m_rbShortcut) #. +> trunk5 #: dialogs/scriptshortcutdialog_base.ui:106 #: dialogs/usermenu/usermenudialog.cpp:53 #, kde-format msgid "Shortcut" msgstr "Atallo" #. i18n: ectx: property (text), widget (QLabel, m_lbKeySequence) #. +> trunk5 #: dialogs/scriptshortcutdialog_base.ui:134 #, kde-format msgid "Please enter a key sequence for this script:" msgstr "Insira unha secuencia de teclas para este script:" #. i18n: ectx: property (text), widget (QLabel, m_lbShortcut) #. +> trunk5 #: dialogs/scriptshortcutdialog_base.ui:150 #, kde-format msgid "Please enter a shortcut for this script:" msgstr "Insira un atallo para este script:" #. +> trunk5 #: dialogs/statisticsdialog.cpp:50 #, kde-format msgid "Copy" msgstr "Copiar" #. +> trunk5 #: dialogs/statisticsdialog.cpp:53 #, kde-format msgid "Copy as LaTeX" msgstr "Copiar como LaTex" #. +> trunk5 #: dialogs/statisticsdialog.cpp:86 dialogs/statisticsdialog.cpp:92 #, kde-format msgid "Summary" msgstr "Resumo" #. +> trunk5 #: dialogs/statisticsdialog.cpp:88 #, kde-format msgid "For information about the accuracy see the Help." msgstr "Para obter información sobre a exactitude consulte a Axuda." #. +> trunk5 #: dialogs/statisticsdialog.cpp:95 dialogs/statisticsdialog.cpp:199 #, kde-format msgid "Statistics for %1" msgstr "Estatísticas de %1" #. +> trunk5 #: dialogs/statisticsdialog.cpp:100 #, kde-format msgid "Statistics for the Project %1" msgstr "Estatísticas do proxecto %1" #. +> trunk5 #: dialogs/statisticsdialog.cpp:141 #, kde-format msgid "To get statistics for all project files, you have to open them all." -msgstr "Para obter estatísticas de todos os ficheiros do proxecto, terá que abrilos todos." +msgstr "" +"Para obter estatísticas de todos os ficheiros do proxecto, terá que abrilos" +" todos." #. +> trunk5 #: dialogs/statisticsdialog.cpp:163 #, kde-format msgid "WARNING: These are the statistics for the selected text only." msgstr "ADVERTENCIA: Estas son as estatísticas só do texto escollido." #. +> trunk5 #: dialogs/statisticsdialog.cpp:191 #, kde-format msgid "Statistics for project %1, file %2" msgstr "Estatísticas do proxecto %1, ficheiro %2" #. +> trunk5 #: dialogs/statisticsdialog.cpp:195 #, kde-format msgid "Statistics for project %1" msgstr "Estatísticas do proxecto %1" #. +> trunk5 #: dialogs/statisticsdialog.cpp:202 #, kde-format msgid "Statistics for Untitled" msgstr "Estatísticas de Sen título" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: dialogs/tabbingdialog_base.ui:29 #, kde-format msgid "Number of &columns:" msgstr "Número de &columnas:" #. i18n: ectx: property (text), widget (QLabel, label_3) #. +> trunk5 #: dialogs/tabbingdialog_base.ui:63 #, kde-format msgid "&Spacing:" msgstr "&Espazado:" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:69 #, kde-format msgid "Tabular Environments" msgstr "Ambientes tabulares" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:82 #: dialogs/tabular/tabularheaderitem.cpp:37 kilestdactions.cpp:47 #, kde-format msgid "Align Left" msgstr "Aliñar á esquerda" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:83 #: dialogs/tabular/tabularheaderitem.cpp:38 #, kde-format msgid "Align Center" msgstr "Aliñar ao centro" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:84 #: dialogs/tabular/tabularheaderitem.cpp:39 kilestdactions.cpp:48 #, kde-format msgid "Align Right" msgstr "Aliñar á dereita" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:86 kilestdactions.cpp:209 #, kde-format msgid "Bold" msgstr "Letra grosa" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:87 kilestdactions.cpp:212 #, kde-format msgid "Italic" msgstr "Itálica" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:88 kilestdactions.cpp:138 #, kde-format msgid "Underline" msgstr "Subliñado" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:90 #, kde-format msgid "Join Cells" msgstr "Xuntar as celas" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:91 #, kde-format msgid "Split Cells" msgstr "Dividir as celas" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:93 #, kde-format msgid "Edit Frame" msgstr "Editar o marco" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:98 #, kde-format msgid "Background Color" msgstr "Cor de fondo" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:103 #, kde-format msgid "Text Color" msgstr "Cor do texto" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:110 #, kde-format msgid "Clear Text" msgstr "Limpar o texto" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:111 #, kde-format msgid "Clear Attributes" msgstr "Limpar os atributos" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:112 #, kde-format msgid "Clear All" msgstr "Limpar todo" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:114 #, kde-format msgid "Paste content from clipboard" msgstr "Pegar o contido do portapapeis" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:139 #, kde-format msgid "Number of rows:" msgstr "Número de filas:" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:154 #, kde-format msgid "Use starred version" msgstr "Usar a versión estrelada" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:155 #, kde-format msgid "Table width:" msgstr "Anchura da táboa:" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:162 #, kde-format msgid "Use booktabs package" msgstr "Usar o paquete booktabs" #. i18n: ectx: property (text), widget (QCheckBox, cb_setbullets) #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:163 #: widgets/codecompletionconfigwidget.ui:198 #, kde-format msgid "Insert bullets" msgstr "Inserir viñetas" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:173 #, kde-format -msgid "Input data. Enter text when a cell is selected. When return is pressed, the adjacent cell will become selected." -msgstr "Os datos de entrada. Insira o texto cando se escolla unha cela. Cando prema Intro, escollerase a cela adxacente." +msgid "" +"Input data. Enter text when a cell is selected. When return is pressed, the" +" adjacent cell will become selected." +msgstr "" +"Os datos de entrada. Insira o texto cando se escolla unha cela. Cando prema" +" Intro, escollerase a cela adxacente." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:175 #, kde-format msgid "Optional parameter for the chosen environment." msgstr "Parámetro opcional para o ambiente escollido." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:177 #, kde-format msgid "Choose the number of table columns." msgstr "Escoller o número de columnas da táboa." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:178 #, kde-format msgid "The tabular will be centered." msgstr "A táboa centrarase." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:179 #, kde-format msgid "Use line commands of the booktabs package." msgstr "Empregar ordes de liña do paquete booktabs." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:181 #, kde-format msgid "Set the width of the table." msgstr "Indicar a anchura da táboa." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:182 #, kde-format -msgid "Insert bullets in each cell. Alt+Ctrl+Right and Alt+Ctrl+Left will move very quickly from one cell to another." -msgstr "Inserir viñetas en cada cela. Con Alt+Ctrl+Dereita e Alt+Ctrl+Esquerda moverase moi rápido dunha cela a outra." +msgid "" +"Insert bullets in each cell. Alt+Ctrl+Right and Alt+Ctrl+Left will move very" +" quickly from one cell to another." +msgstr "" +"Inserir viñetas en cada cela. Con Alt+Ctrl+Dereita e Alt+Ctrl+Esquerda" +" moverase moi rápido dunha cela a outra." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:183 #, kde-format msgid "Set bold font series." msgstr "Pon o tipo de letra en letra grosa." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:184 #, kde-format msgid "Set italic font shape." msgstr "Pon o tipo de letra en itálicas." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:185 #, kde-format msgid "Set underlined font shape." msgstr "Pon o tipo de letra subliñado." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:186 #, kde-format msgid "The text will be aligned at the left border of the cell." msgstr "O texto aliñarase no bordo esquerdo da cela." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:187 #, kde-format msgid "The text will be centered." msgstr "O texto centrarase." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:188 #, kde-format msgid "The text will be aligned at the right border of the cell." msgstr "O texto aliñarase no bordo dereito da cela." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:189 #, kde-format msgid "Joins adjacent cells when they are in the same row." msgstr "Xunta celas adxacentes cando están na mesma fila." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:190 #, kde-format msgid "Splits joined cells." msgstr "Divide celas fusionadas." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:191 #, kde-format -msgid "Choose the border for the selected cells. When clicking on the button, the current border will be applied to the selected cells." -msgstr "Escolla o bordo das celas escollidas. Se preme o botón, o bordo escollido aplicarase ás celas escollidas." +msgid "" +"Choose the border for the selected cells. When clicking on the button, the" +" current border will be applied to the selected cells." +msgstr "" +"Escolla o bordo das celas escollidas. Se preme o botón, o bordo escollido" +" aplicarase ás celas escollidas." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:192 #, kde-format msgid "Choose a background color (needs color package)." msgstr "Escoller a cor de fondo (precisa o paquete «color»)." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:193 #, kde-format msgid "Choose a text color (needs color package)." msgstr "Escoller a cor do texto (precisa o paquete «color»)." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:194 #, kde-format -msgid "Clears the text of the selected cells but keeps attributes such as alignment and font shape." -msgstr "Limpa o texto das celas escollidas pero mantén os atributos tales como aliñamento e o aspecto do tipo de letra." +msgid "" +"Clears the text of the selected cells but keeps attributes such as alignment" +" and font shape." +msgstr "" +"Limpa o texto das celas escollidas pero mantén os atributos tales como" +" aliñamento e o aspecto do tipo de letra." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:195 #, kde-format -msgid "Resets the attributes of the selected cells to the default values but keeps the text." -msgstr "Repón os atributos das celas escollidas aos valores predeterminados pero mantén o texto." +msgid "" +"Resets the attributes of the selected cells to the default values but keeps" +" the text." +msgstr "" +"Repón os atributos das celas escollidas aos valores predeterminados pero" +" mantén o texto." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:196 #, kde-format msgid "Clears the text of the selected cells and resets the attributes." msgstr "Limpa o texto das celas escollidas e repón os atributos." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:197 #, kde-format msgid "Pastes a table stored in the clipboard into this wizard." msgstr "Pega unha táboa gardada no portapapeis neste asistente." #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:659 #: dialogs/tabular/newtabulardialog.cpp:680 #, kde-format -msgid "Setting the new size for the table will delete content. Are you sure to set the new size?" -msgstr "Se estabelece este novo tamaño para a táboa eliminará o contido. Está seguro de que quere pór o novo tamaño?" +msgid "" +"Setting the new size for the table will delete content. Are you sure to set" +" the new size?" +msgstr "" +"Se estabelece este novo tamaño para a táboa eliminará o contido. Está seguro" +" de que quere pór o novo tamaño?" #. +> trunk5 #: dialogs/tabular/newtabulardialog.cpp:659 #: dialogs/tabular/newtabulardialog.cpp:680 #, kde-format msgid "Resizing table" msgstr "Cambiando o tamaño da táboa" #. +> trunk5 #: dialogs/tabular/selectframeaction.cpp:296 #, kde-format msgid "Apply" msgstr "Aplicar" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:40 #, kde-format msgid "p{w} Alignment" msgstr "p{w} Aliñamento" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:41 #, kde-format msgid "b{w} Alignment" msgstr "b{w} Aliñamento" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:42 #, kde-format msgid "m{w} Alignment" msgstr "m{w} Aliñamento" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:43 #, kde-format msgid "X Alignment" msgstr "Aliñamento en X" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:45 #, kde-format msgid "Insert Before Declaration" msgstr "Inserir antes da declaración" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:46 #, kde-format msgid "Insert After Declaration" msgstr "Inserir despois da declaración" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:47 #, kde-format msgid "Suppress Space" msgstr "Suprimir o espazo" #. +> trunk5 #: dialogs/tabular/tabularheaderitem.cpp:48 #, kde-format msgid "Do not Suppress Space" msgstr "Non suprimir o espazo" #. +> trunk5 #: dialogs/tabular/tabulartable.cpp:220 #, kde-format msgid "There is no content to insert into the table as the clipboard is empty." -msgstr "Non hai contido que inserir na táboa porque o portapapeis está baleiro." +msgstr "" +"Non hai contido que inserir na táboa porque o portapapeis está baleiro." #. +> trunk5 #: dialogs/tabular/tabulartable.cpp:220 #, kde-format msgid "Empty Clipboard" msgstr "O portapapeis está baleiro" #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:58 kile.cpp:1025 #, kde-format msgid "Documentation Browser" msgstr "Navegador da documentación" #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:67 #: dialogs/texdocumentationdialog.cpp:500 kilestdactions.cpp:42 #, kde-format msgid "Table of Contents" msgstr "Índice" #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:84 #, kde-format -msgid "A list of available documents, which are listed in 'texdoctk.dat', that come with TexLive/teTeX. Double clicking with the mouse or pressing the space key will open a viewer to show this file." -msgstr "Unha lista dos documentos dispoñíbeis, que están listados en «texdoctk.dat», que vén con TexLive/teTeX. Cun duplo-clique co rato ou premendo a tecla de espazo abrirá un visor para mostrar este ficheiro." +msgid "" +"A list of available documents, which are listed in 'texdoctk.dat', that come" +" with TexLive/teTeX. Double clicking with the mouse or pressing the space key" +" will open a viewer to show this file." +msgstr "" +"Unha lista dos documentos dispoñíbeis, que están listados en «texdoctk.dat»," +" que vén con TexLive/teTeX. Cun duplo-clique co rato ou premendo a tecla de" +" espazo abrirá un visor para mostrar este ficheiro." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:85 #, kde-format -msgid "You can choose a keyword to show only document files that are related to this keyword." -msgstr "Pode escoller unha palabra clave para mostrar só ficheiros de documentación relacionados con ela." +msgid "" +"You can choose a keyword to show only document files that are related to this" +" keyword." +msgstr "" +"Pode escoller unha palabra clave para mostrar só ficheiros de documentación" +" relacionados con ela." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:86 #, kde-format msgid "Start the search for the chosen keyword." msgstr "Iniciar a busca para a palabra clave escollida." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:88 #, kde-format msgid "Reset list to all available documentation files." msgstr "Reiniciar a lista de todos os ficheiros de documentación dispoñíbeis." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:89 #, kde-format msgid "Cancel &Search" msgstr "Cancelar a &busca" #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:136 #, kde-format msgid "Could not read 'texdoctk.dat'." msgstr "Non se puido ler «texdoctk.dat»." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:313 #, kde-format msgid "Could not read the style file." msgstr "Non se puido ler o ficheiro de estilo." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:394 #, kde-format msgid "No KDE service found for this file." msgstr "Non se atopou un servizo de KDE para este ficheiro." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:428 #, kde-format msgid "Could not find '%1'" msgstr "Non se puido atopar «%1»" #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:463 #, kde-format msgid "No keyword given." msgstr "Non se indicou ningunha palabra clave." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:489 #, kde-format msgid "Search results for keyword '%1'" msgstr "Resultados da busca para a palabra clave «%1»" #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:492 #, kde-format msgid "No documents found for keyword '%1'." msgstr "Non se atoparon documentos para a palabra clave «%1»." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:550 #, kde-format msgid "" -"Could not determine the search paths of TexLive/teTeX or file 'texdoctk.dat'.
" +"Could not determine the search paths of TexLive/teTeX or file" +" 'texdoctk.dat'.
" " Hence, this dialog is unable to provide any useful information." msgstr "" -"Non se puideron determinar as rutas de busca de TexLive/teTex nin o ficheiro «texdoctk.dat».
" +"Non se puideron determinar as rutas de busca de TexLive/teTex nin o ficheiro" +" «texdoctk.dat».
" "Polo tanto este diálogo non pode fornecer información útil." #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:550 #, kde-format msgid "TexDoc Dialog" msgstr "Diálogo de TexDoc" #. +> trunk5 #: dialogs/texdocumentationdialog.cpp:562 #, kde-format msgid "" "Could not determine the search paths of TexLive or file 'texdoctk.dat'.
" " Hence, this dialog is unable to provide any useful information." msgstr "" -"Non se puideron determinar as rutas de busca de TexLive nin o ficheiro «texdoctk.dat».
" +"Non se puideron determinar as rutas de busca de TexLive nin o ficheiro" +" «texdoctk.dat».
" "Polo tanto este diálogo non pode fornecer información útil." #. +> trunk5 #: dialogs/userhelpdialog.cpp:51 #, kde-format msgid "Configure User Help" msgstr "Configurar a axuda ao usuario" #. i18n: ectx: property (title), widget (QGroupBox, m_gbUserHelp) #. +> trunk5 #: dialogs/userhelpdialog.cpp:57 dialogs/userhelpdialog.cpp:378 kile.cpp:1039 #: widgets/helpconfigwidget.ui:168 #, kde-format msgid "User Help" msgstr "Axuda para o usuario" #. +> trunk5 #: dialogs/userhelpdialog.cpp:63 #, kde-format msgid "&Menu item:" msgstr "Elemento do &menú:" #. i18n: ectx: property (text), widget (QPushButton, m_pshbRemove) #. +> trunk5 #: dialogs/userhelpdialog.cpp:76 widgets/quicktoolconfigwidget.ui:104 #, kde-format msgid "&Remove" msgstr "Retira&r" #. +> trunk5 #: dialogs/userhelpdialog.cpp:77 #, kde-format msgid "&Separator" msgstr "&Separador" #. +> trunk5 #: dialogs/userhelpdialog.cpp:78 #, kde-format msgid "Move &Up" msgstr "S&ubir" #. +> trunk5 #: dialogs/userhelpdialog.cpp:79 #, kde-format msgid "Move &Down" msgstr "&Baixar" #. i18n: ectx: property (text), widget (QLabel, m_lbXmlFile) #. i18n: ectx: property (text), widget (QLabel, m_lbFile) #. +> trunk5 #: dialogs/userhelpdialog.cpp:118 dialogs/usermenu/usermenudialog.cpp:182 #: dialogs/usermenu/usermenudialog_base.ui:329 #: dialogs/usermenu/usermenudialog_base.ui:459 #, kde-format msgid "File:" msgstr "Ficheiro:" #. +> trunk5 #: dialogs/userhelpdialog.cpp:369 #, kde-format msgid "Add User Helpfile" msgstr "Engadir un ficheiro de axuda para o usuario" #. +> trunk5 #: dialogs/userhelpdialog.cpp:384 #, kde-format msgid "&Menu entry:" msgstr "Entrada de &menú:" #. +> trunk5 #: dialogs/userhelpdialog.cpp:392 #, kde-format msgid "&Help file:" msgstr "Ficheiro de a&xuda:" #. +> trunk5 #: dialogs/userhelpdialog.cpp:403 #, kde-format msgid "Open file dialog" msgstr "Diálogo de abrir ficheiros" #. +> trunk5 #: dialogs/userhelpdialog.cpp:411 #, kde-format msgid "The menu entry for this help file." msgstr "O elemento do menú para este ficheiro de axuda." #. +> trunk5 #: dialogs/userhelpdialog.cpp:412 #, kde-format msgid "The name of the local help file or a valid WEB url." msgstr "O nome do ficheiro de axuda local ou un URL correcto da Web." #. +> trunk5 #: dialogs/userhelpdialog.cpp:413 #, kde-format msgid "Start a file dialog to choose a local help file." -msgstr "Iniciar un diálogo de ficheiros para escoller un ficheiro de axuda local." +msgstr "" +"Iniciar un diálogo de ficheiros para escoller un ficheiro de axuda local." #. +> trunk5 #: dialogs/userhelpdialog.cpp:432 #, kde-format -msgid "Websites (HTML) (*.html *.htm);;Documents (PDF, PS, DVI, EPUB) (*.ps *.pdf *.dvi *.epub);;All Files (*)" -msgstr "Sitios web (HTML) (*html *.htm);;Documentos (PDF, PS, DVI, EPUB) (*.ps *.pdf *.dvi *.epub);;Todos os ficheiros (*)" +msgid "" +"Websites (HTML) (*.html *.htm);;Documents (PDF, PS, DVI, EPUB) (*.ps *.pdf" +" *.dvi *.epub);;All Files (*)" +msgstr "" +"Sitios web (HTML) (*html *.htm);;Documentos (PDF, PS, DVI, EPUB) (*.ps *.pdf" +" *.dvi *.epub);;Todos os ficheiros (*)" #. +> trunk5 #: dialogs/userhelpdialog.cpp:434 kileactions.cpp:379 kiledocmanager.cpp:2140 #, kde-format msgid "Select File" msgstr "Escoller un ficheiro" #. +> trunk5 #: dialogs/userhelpdialog.cpp:441 dialogs/usermenu/usermenudialog.cpp:295 #: dialogs/usermenu/usermenutree.cpp:246 usermenu/usermenu.cpp:338 #: widgets/usermenuconfigwidget.cpp:74 #, kde-format msgid "File '%1' does not exist." msgstr "O ficheiro «%1» non existe." #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:42 usermenu/usermenu.cpp:108 #, kde-format msgid "Edit User Menu" msgstr "Editar o menú do usuario" #. i18n: ectx: property (title), widget (QGroupBox, m_gbMenuEntry) #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:53 #: dialogs/usermenu/usermenudialog_base.ui:412 #, kde-format msgid "Menu Entry" msgstr "Entrada de menú" #. i18n: ectx: property (text), widget (QLabel, m_lbMenuentryType) #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:56 #: dialogs/usermenu/usermenudialog_base.ui:539 kileinfo.cpp:353 #, kde-format msgid "Text" msgstr "Texto" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:56 #, kde-format msgid "Insert file contents" msgstr "Inserir o contido do ficheiro" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:56 #, kde-format msgid "Execute program" msgstr "Executar o programa" #. i18n: ectx: property (text), widget (QPushButton, m_pbInsertSeparator) #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:56 #: dialogs/usermenu/usermenudialog_base.ui:103 #, kde-format msgid "Separator" msgstr "Separador" #. i18n: ectx: property (text), widget (QPushButton, m_pbInsertSubmenu) #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:56 #: dialogs/usermenu/usermenudialog_base.ui:143 #, kde-format msgid "Submenu" msgstr "Submenú" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:59 #, kde-format msgid "" -"Text, which will be inserted, if the action is executed. Some placeholders are available: " +"Text, which will be inserted, if the action is executed. Some placeholders" +" are available: " "
    " "
  • %M - selected (marked) text
    • " "
  • %C - cursor position
    • " "
  • %B - bullet
    • " "
  • %E - indentation in environments
    • " "
  • %R - select label from list
    • " "
  • %T - select citation key from list
    • " "
" msgstr "" -"Texto a inserir se se executa a acción. Disponse de varias marcas de posición: " +"Texto a inserir se se executa a acción. Disponse de varias marcas de" +" posición: " "
    " "
  • %M - texto escollido (marcado)
    • " "
  • %C - posición do cursor
    • " "
  • %B - viñeta
    • " "
  • %E - sangría nos ambientes
    • " "
  • %R - escoller etiqueta de lista
    • " "
  • %T - escoller chave de cita de lista
    • " "
" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:60 #, kde-format msgid "" "Available placeholders:\n" "%M: Selected (marked) text\n" "%C: Cursor position\n" "%B: Bullet\n" "%E: Indentation in environments\n" "%R: Select label from list\n" "%T: Select citation key from list\n" "%S: Source file name without extension" msgstr "" "Marcas de posición dispoñíbeis:\n" "%M: Texto escollido (marcado)\n" "%C: Posición do cursor\n" "%B: Viñeta\n" "%E: Sangría en ambientes\n" "%R: Escoller etiqueta de lista\n" "%T: Escoller chave de citación de lista\n" "%S: Nome de ficheiro orixe sen extensión" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:216 #, kde-format msgid "" -"

You can create, change and install a user-defined menu, which will appear as a part of Kile's menu. To create or change this menu, use the six buttons on the left side. Even more possible actions are available in the context menu of already existing menu items.

" -"

Like a standard menu, three different kinds of menu items are available:

" +"

You can create, change and install a user-defined menu, which will appear" +" as a part of Kile's menu. To create or change this menu, use the six buttons" +" on the left side. Even more possible actions are available in the context" +" menu of already existing menu items.

" +"

Like a standard menu, three different kinds of menu items are available:<" +"/p>" "

    " "
  • standard entries, which are assigned to an action
    • " "
  • submenus, which contain more menu items
    • " "
  • separators, to get a visible structure of all entries
    • " "
" "

Each standard menu item is assigned to one of three action types:

" "
    " -"
  • insert text: this action will insert your text at the current cursor position. Some metachars are available: %M, %C, %B, %E, %R, %T, %S: see the What's This or Tool Tip feature of this widget to get more information.
    • " -"
  • file content: inserts the complete contents of a given file (metachars are also available)
    • " -"
  • run an external program: The output of this program can be inserted into the opened document. Metachar %M is also possible in the commandline of this program, as the selected text will be saved in a temporary file. Use %M for the filename of this temporary file.
    • " +"
  • insert text: this action will insert your text at the current" +" cursor position. Some metachars are available: %M, %C, %B, %E, %R, %T, %S: see the What's This or Tool Tip feature of this widget to get more" +" information.
    • " +"
  • file content: inserts the complete contents of a given file" +" (metachars are also available)
    • " +"
  • run an external program: The output of this program can be" +" inserted into the opened document. Metachar %M is also possible in" +" the commandline of this program, as the selected text will be saved in a" +" temporary file. Use %M for the filename of this temporary file.
    • " "
" -"

If some important information for an action is missing, menu items are colored red. More information is available using the What's this feature of most widgets.

" -msgstr "" -"

Pódese crear, cambiar e instalar un menú definido polo usuario que apareza como parte do menú de Kile. Para crear ou cambiar este menú, empregue os seis botóns da parte esquerda. Hai máis accións posíbeis no menú de contexto dos elementos de menú existentes.

" -"

Como nun menú estándar, existen tres tipos distintos de elementos de menú:

" +"

If some important information for an action is missing, menu items are" +" colored red. More information is available using the What's this" +" feature of most widgets.

" +msgstr "" +"

Pódese crear, cambiar e instalar un menú definido polo usuario que apareza" +" como parte do menú de Kile. Para crear ou cambiar este menú, empregue os" +" seis botóns da parte esquerda. Hai máis accións posíbeis no menú de contexto" +" dos elementos de menú existentes.

" +"

Como nun menú estándar, existen tres tipos distintos de elementos de" +" menú:

" "
    " "
  • entradas estándar, que se asignan a unha acción
    • " "
  • submenús, que conteñen máis elementos de menú
    • " -"
  • separadores, para obter unha estrutura visíbel de todas as entradas
    • " +"
  • separadores, para obter unha estrutura visíbel de todas as" +" entradas
    • " "
" "

Cada elemento estándar do menú asígnase a un de tres tipos de acción:

" "
    " -"
  • inserir texto: esta acción insire o texto na posición do cursor. hai algúns meta-caracteres dispoñíbeis: %M, %C, %B, %E, %R, %T, %S: vexa a Axuda Que é isto dese trebello para obter máis información.
    • " -"
  • contido dun ficheiro: insire o contido completo dun ficheiro dado (tamén hai meta-caracteres dispoñíbeis)
    • " -"
  • executar un programa externo: A saída deste programa pódese inserir no documento aberto. Tamén é posíbel empregar o meta-carácter %M na liña da ordes dese programa, dado que o texto escollido se garda nun ficheiro temporal. Empregue %M para o nome de ficheiro deste ficheiro temporal.
    • " +"
  • inserir texto: esta acción insire o texto na posición do cursor." +" hai algúns meta-caracteres dispoñíbeis: %M, %C, %B, %E, %R, %T, %S: vexa a Axuda Que é isto dese trebello para obter máis información.
    • " +"
  • contido dun ficheiro: insire o contido completo dun ficheiro dado" +" (tamén hai meta-caracteres dispoñíbeis)
    • " +"
  • executar un programa externo: A saída deste programa pódese" +" inserir no documento aberto. Tamén é posíbel empregar o meta-carácter " +"%M na liña da ordes dese programa, dado que o texto escollido se garda" +" nun ficheiro temporal. Empregue %M para o nome de ficheiro deste" +" ficheiro temporal.
    • " "
" -"

Se falta información importante para unha acción, os elementos do menú aparecen en vermello. Hai máis información dispoñíbel empregando a funcionalidade Que é isto da maioría dos trebellos.

" +"

Se falta información importante para unha acción, os elementos do menú" +" aparecen en vermello. Hai máis información dispoñíbel empregando a" +" funcionalidade Que é isto da maioría dos trebellos.

" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:238 #, kde-format msgid "UserMenu Dialog" msgstr "Diálogo do menú do usuario" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:260 #: dialogs/usermenu/usermenudialog.cpp:278 #, kde-format msgid "" "Current menu tree was modified, but not saved.\n" "Discard this tree?" msgstr "" "Modificouse a árbore do menú actual, pero non se gardou.\n" "Descártase esta árbore?" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:284 #: dialogs/usermenu/usermenudialog.cpp:385 usermenu/usermenu.cpp:330 #: widgets/usermenuconfigwidget.cpp:62 #, kde-format msgid "User Menu Files (*.xml)" msgstr "Ficheiros de menú de usuario (*.xml)" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:286 usermenu/usermenu.cpp:332 #: widgets/usermenuconfigwidget.cpp:64 #, kde-format msgid "Select Menu File" msgstr "Escoller un ficheiro de menú" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:387 #, kde-format msgid "Save Menu File" msgstr "Gardar o ficheiro de ficheiro" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:393 #, kde-format msgid "" "File '%1' does already exist.\n" "Overwrite this file?" msgstr "" "O ficheiro «%1» xa existe\n" "Desexa substituílo?" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:406 #, kde-format msgid "" -"The menu tree contains some errors and installing this file may lead to unpredictable results.\n" +"The menu tree contains some errors and installing this file may lead to" +" unpredictable results.\n" "Do you really want to save this file?" msgstr "" -"A árbore do menú contén algúns erros e instalar este ficheiro pode provocar resultados impredicíbeis.\n" +"A árbore do menú contén algúns erros e instalar este ficheiro pode provocar" +" resultados impredicíbeis.\n" "Seguro que quere gardar este ficheiro?" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:560 #, kde-format msgid "Menutype" msgstr "Tipo de menú" #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:560 #, kde-format msgid "Please choose a menutype" msgstr "Escolla un tipo de menú" #. i18n: ectx: property (text), widget (QPushButton, m_pbIcon) #. +> trunk5 #: dialogs/usermenu/usermenudialog.cpp:972 #: dialogs/usermenu/usermenudialog_base.ui:485 #, kde-format msgid "Choose" msgstr "Escoller" #. i18n: ectx: property (title), widget (QGroupBox, m_gbUserMenu) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:45 #, kde-format msgid "LaTeX Usermenu" msgstr "Menú de usuario de LaTeX" #. i18n: ectx: property (whatsThis), widget (KileMenu::UserMenuTree, m_twUserMenu) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:66 #, kde-format -msgid "The user-defined menu tree, which can be modified with the six buttons below the tree (and their shortcuts). More actions are available in the context menu of selected items. You can also rearrange items with drag and drop." -msgstr "A árbore de menú definida polo usuario, que pode modificarse cos seis botóns que hai debaixo da árbore (e os seus atallos). Hai máis accións dispoñíbeis no menú de contexto dos elementos que se escollan. Tamén se poden arrumbar os elementos arrastrándoos e soltándoos." +msgid "" +"The user-defined menu tree, which can be modified with the six buttons below" +" the tree (and their shortcuts). More actions are available in the context" +" menu of selected items. You can also rearrange items with drag and drop." +msgstr "" +"A árbore de menú definida polo usuario, que pode modificarse cos seis botóns" +" que hai debaixo da árbore (e os seus atallos). Hai máis accións dispoñíbeis" +" no menú de contexto dos elementos que se escollan. Tamén se poden arrumbar" +" os elementos arrastrándoos e soltándoos." #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbInsertSeparator) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:100 #, kde-format msgid "Insert a new separator below the selected item." msgstr "Inserir un separador novo debaixo do elemento escollido." #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbDelete) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:110 #, kde-format msgid "Delete the selected item." msgstr "Eliminar o elemento escollido." #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbDown) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:120 #, kde-format msgid "Move the selected item down." msgstr "Mover o elemento escollido." #. i18n: ectx: property (text), widget (QPushButton, m_pbDown) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:123 #, kde-format msgid "Down" msgstr "Baixar" #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbInsertBelow) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:130 #, kde-format msgid "Insert a new menu item below the selected item." msgstr "Inserir un elemento de menú novo debaixo do elemento escollido." #. i18n: ectx: property (text), widget (QPushButton, m_pbInsertBelow) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:133 #, kde-format msgid "Insert" msgstr "Inserir" #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbInsertSubmenu) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:140 #, kde-format msgid "Insert a new submenu item below the selected item." msgstr "Inserir un elemento de submenú novo debaixo do elemento escollido." #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbUp) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:166 #, kde-format msgid "Move the selected item up." msgstr "Subir o elemento escollido." #. i18n: ectx: property (text), widget (QPushButton, m_pbUp) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:169 #, kde-format msgid "Up" msgstr "Subir" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:197 #: widgets/usermenuconfigwidget.ui:29 #, kde-format msgid "Menu File" msgstr "Ficheiro de menú" #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbInstall) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:221 #, kde-format msgid "Install an unmodified and saved menu tree as user-defined menu." -msgstr "Instalar unha árbore de menú gardada sen modificar como menú definido polo usuario." +msgstr "" +"Instalar unha árbore de menú gardada sen modificar como menú definido polo" +" usuario." #. i18n: ectx: property (text), widget (QPushButton, m_pbInstall) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:224 #: widgets/usermenuconfigwidget.ui:86 #, kde-format msgid "Install" msgstr "Instalar" #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbLoad) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:247 #, kde-format msgid "Load an xml file, which describes the user-defined menu." msgstr "Cargar un ficheiro en xml que describa o menú definido polo usuario." #. i18n: ectx: property (text), widget (QPushButton, m_pbLoad) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:250 #, kde-format msgid "Load" msgstr "Cargar" #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbSave) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:273 #, kde-format -msgid "Save a modified menu tree, which describes the user-defined menu, to an xml file into the local directory of Kile." -msgstr "Gardar unha árbore de menú modificado, que describe o menú definido polo usuario, nun ficheiro en xml no directorio local de Kile." +msgid "" +"Save a modified menu tree, which describes the user-defined menu, to an xml" +" file into the local directory of Kile." +msgstr "" +"Gardar unha árbore de menú modificado, que describe o menú definido polo" +" usuario, nun ficheiro en xml no directorio local de Kile." #. i18n: ectx: property (text), widget (QPushButton, m_pbSave) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:276 #, kde-format msgid "Save" msgstr "Gardar" #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbSaveAs) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:283 #, kde-format -msgid "Save a modified menu tree, which describes the user-defined menu, to an xml file into the local directory of Kile and choose a new name for this file." -msgstr "Gardar unha árbore de menú modificado, que describe o menú definido polo usuario, nun ficheiro en xml no directorio local de Kile e escoller un nome novo para este ficheiro." +msgid "" +"Save a modified menu tree, which describes the user-defined menu, to an xml" +" file into the local directory of Kile and choose a new name for this file." +msgstr "" +"Gardar unha árbore de menú modificado, que describe o menú definido polo" +" usuario, nun ficheiro en xml no directorio local de Kile e escoller un nome" +" novo para este ficheiro." #. i18n: ectx: property (text), widget (QPushButton, m_pbSaveAs) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:286 #, kde-format msgid "Save as" msgstr "Gardar como" #. i18n: ectx: property (text), widget (QLabel, m_lbXmlInstalled) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:352 #, kde-format msgid "(installed)" msgstr "(instalado)" #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbNew) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:375 #, kde-format msgid "Delete current menu tree and start a new one." msgstr "Eliminar a árbore de menú actual e comezar unha nova." #. i18n: ectx: property (text), widget (QPushButton, m_pbNew) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:378 #, kde-format msgid "New" msgstr "Nova" #. i18n: ectx: property (text), widget (QLabel, m_lbText) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:420 #, kde-format msgid "Text:" msgstr "Texto:" #. i18n: ectx: property (text), widget (QLabel, m_lbShortcut) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:452 #, kde-format msgid "Shortcut:" msgstr "Atallo:" #. i18n: ectx: property (text), widget (QLabel, m_lbType) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:466 #, kde-format msgid "Type:" msgstr "Tipo:" #. i18n: ectx: property (whatsThis), widget (KUrlRequester, m_urlRequester) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:473 #, kde-format msgid "Filename of the corresponding file." msgstr "Nome de ficheiro do ficheiro correspondente." #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbIcon) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:482 #, kde-format msgid "Choose an icon for this action." msgstr "Escoller unha icona para esta acción." #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbIconDelete) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:515 #, kde-format msgid "Remove the icon for this action." msgstr "Retirar a icona desta acción." #. i18n: ectx: property (whatsThis), widget (QPushButton, m_pbMenuentryType) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:559 #, kde-format msgid "Change the type of a menu item." msgstr "Cambiar o tipo dun elemento do menú." #. i18n: ectx: property (text), widget (QPushButton, m_pbMenuentryType) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:562 #, kde-format msgid "Change" msgstr "Cambiar" #. i18n: ectx: property (whatsThis), widget (KLineEdit, m_leMenuEntry) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:571 #, kde-format msgid "The label of the selected menu item." msgstr "A etiqueta do elemento do menú escollido." #. i18n: ectx: property (text), widget (QLabel, m_lbMenuEntry) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:584 #, kde-format msgid "Entry:" msgstr "Entrada:" #. i18n: ectx: property (whatsThis), widget (KLineEdit, m_leParameter) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:614 #, kde-format msgid "Commandline parameter for an executable program." msgstr "Parámetro da liña de ordes para un programa executábel." #. i18n: ectx: property (whatsThis), widget (KKeySequenceWidget, m_keyChooser) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:621 #, kde-format msgid "Choose or clear a shortcut for this action." msgstr "Escoller ou limpar un atallo para esta acción." #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbSelectInsertion) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:647 #, kde-format msgid "Select, if inserted text should be selected." msgstr "Escolla se desexa escoller o texto inserido." #. i18n: ectx: property (text), widget (QCheckBox, m_cbSelectInsertion) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:650 #, kde-format msgid "Select inserted text" msgstr "Escoller o texto inserido" #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbReplaceSelection) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:657 #, kde-format msgid "Select, if the action should replace selected text." msgstr "Escolla se desexa que a acción substitúa o texto escollido." #. i18n: ectx: property (text), widget (QCheckBox, m_cbReplaceSelection) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:660 #, kde-format msgid "Replace selected text" msgstr "Substituír o texto escollido" #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbNeedsSelection) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:673 #, kde-format msgid "Select, if the action needs selected text. " msgstr "Escolla se a acción precisa de texto escollido." #. i18n: ectx: property (text), widget (QCheckBox, m_cbNeedsSelection) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:676 #, kde-format msgid "Needs selected text" msgstr "Precisa de texto escollido" #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbInsertOutput) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:699 #, kde-format msgid "Select, if the output of an executable program should be inserted." msgstr "Escolla se desexa inserir a saída dun programa executábel." #. i18n: ectx: property (text), widget (QCheckBox, m_cbInsertOutput) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:702 #, kde-format msgid "Insert the output of the chosen program" msgstr "Inserir a saída do programa escollido" #. i18n: ectx: property (whatsThis), widget (QCheckBox, m_cbContextMenu) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:709 #, kde-format -msgid "Select, if the action should be added to the context menu of a selection." -msgstr "Escolla se desexa que a acción se engada ao menú de contexto dunha selección." +msgid "" +"Select, if the action should be added to the context menu of a selection." +msgstr "" +"Escolla se desexa que a acción se engada ao menú de contexto dunha selección." #. i18n: ectx: property (text), widget (QCheckBox, m_cbContextMenu) #. +> trunk5 #: dialogs/usermenu/usermenudialog_base.ui:712 #, kde-format msgid "Add to the context menu of selected text" msgstr "Engadir ao menú de contexto do texto escollido" #. +> trunk5 #: dialogs/usermenu/usermenuitem.h:26 #, kde-format msgid "???" msgstr "???" #. +> trunk5 #: dialogs/usermenu/usermenuitem.h:27 #, kde-format msgid " >" msgstr " >" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:179 #, kde-format msgid "Insert above" msgstr "Inserir enriba" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:180 #, kde-format msgid "Insert below" msgstr "Inserir embaixo" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:185 #, kde-format msgid "Insert a separator above" msgstr "Inserir un separador enriba" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:186 #, kde-format msgid "Insert a separator below" msgstr "Inserir un separador embaixo" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:191 #, kde-format msgid "Insert a submenu above" msgstr "Inserir un submenú enriba" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:192 #, kde-format msgid "Insert a submenu below" msgstr "Inserir un submenú embaixo" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:197 #, kde-format msgid "Insert into this submenu" msgstr "Inserir neste submenú" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:198 #, kde-format msgid "Insert a separator into this submenu" msgstr "Inserir un separador neste submenú" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:199 #, kde-format msgid "Insert a submenu into this submenu" msgstr "Inserir un submenú neste submenú" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:204 #, kde-format msgid "Delete this item" msgstr "Eliminar este elemento" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:206 #, kde-format msgid "Delete the complete tree" msgstr "Eliminar a árbore enteira" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:212 #, kde-format msgid "Collapse submenu" msgstr "Pregar o submenú" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:215 #, kde-format msgid "Expand submenu" msgstr "Expandir o submenú" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:218 #, kde-format msgid "Collapse complete tree" msgstr "Pregar a árbore enteira" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:219 #, kde-format msgid "Expand complete tree" msgstr "Expandir a árbore enteira" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:226 #, kde-format msgid "Info" msgstr "Información" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:450 #, kde-format msgid "File '%1' could not be opened to save the usermenu file." -msgstr "Non se puido abrir o ficheiro «%1» para gardar o ficheiro de menú de usuario." +msgstr "" +"Non se puido abrir o ficheiro «%1» para gardar o ficheiro de menú de usuario." #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:694 #, kde-format msgid "Please enter a label for this menu item:" msgstr "Insira unha etiqueta para este elemento do menú:" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:711 #, kde-format msgid "Please enter a label for this submenu:" msgstr "Insira unha etiqueta para este submenú:" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:769 #, kde-format msgid "Please enter a label for this entry:" msgstr "Insira unha etiqueta para esta entrada:" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:925 #, kde-format msgid "Do you really want to clear the complete menutree?" msgstr "Seguro que quere limpar a árbore de menú enteira?" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:941 #, kde-format msgid "This menuitem has no title." msgstr "Esta elemento de menú non ten título." #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:945 #, kde-format msgid "This submenu item is useless without children." msgstr "Este elemento de submenú é inútil sen fillos." #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:949 #, kde-format msgid "This item offers no text to insert." msgstr "Este elemento non ofrece texto para inserir." #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:953 #, kde-format msgid "No file is given for this task." msgstr "Non se indica ningún ficheiro para esta tarefa." #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:957 #, kde-format msgid "The file for this item does not exist." msgstr "O ficheiro para este elemento non existe." #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:961 #, kde-format msgid "The file for this item is not executable." msgstr "O ficheiro para este elemento non é executábel." #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:964 #, kde-format msgid "

Error:" msgstr "

Erro:" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:976 #, kde-format msgid "Menutree Error" msgstr "Erro na árbore do menú" #. +> trunk5 #: dialogs/usermenu/usermenutree.cpp:1027 #, kde-format msgid "Name" msgstr "Nome" #. +> trunk5 #: docpart.cpp:63 #, kde-format msgid "No KDE service found for the MIME type \"%1\"." msgstr "Non se atopou un servizo de KDE para o tipo MIME «%1»." #. i18n: ectx: ToolBar (extraToolBar) #. +> trunk5 #: docpartui.rc:3 #, kde-format msgid "Extra" msgstr "Extra" #. +> trunk5 #: documentinfo.cpp:108 #, kde-format msgid "Invalid Characters" msgstr "Os caracteres son incorrectos" #. +> trunk5 #: documentinfo.cpp:109 #, kde-format msgid "" "The filename contains invalid characters ($~ #).
" "Please provide another one, or click \"Cancel\" to save anyway." msgstr "" "O nome do ficheiro contén caracteres incorrectos ($~ #).
" "Forneza outro ou prema «Cancelar» para gardar de todos os xeitos." #. +> trunk5 #: documentinfo.cpp:135 #, kde-format msgid "" "A file with filename '%1' already exists.
" "Please provide another one, or click \"Cancel\" to overwrite it." msgstr "" "Xa existe un ficheiro co nome %1.
" "Forneza outro ou prema «Cancelar» para substituílo." #. +> trunk5 #: documentinfo.cpp:158 #, kde-format -msgid "The given filename has no extension; do you want one to be automatically added?" -msgstr "O nome de ficheiro dado non ten extensión; quere que se lle engada unha automaticamente?" +msgid "" +"The given filename has no extension; do you want one to be automatically" +" added?" +msgstr "" +"O nome de ficheiro dado non ten extensión; quere que se lle engada unha" +" automaticamente?" #. +> trunk5 #: documentinfo.cpp:159 #, kde-format msgid "Missing Extension" msgstr "Falta a extensión" #. +> trunk5 #: editorcommands.cpp:39 #, kde-format msgid "All documents saved to disk." msgstr "Gardáronse no disco todos os documentos." #. +> trunk5 #: editorcommands.cpp:40 #, kde-format msgid "Saving of all documents failed." msgstr "Fallou a gravación de todos os documentos." #. +> trunk5 #: editorcommands.cpp:45 #, kde-format msgid "Document saved to disk." msgstr "Documento gardado no disco." #. +> trunk5 #: editorcommands.cpp:46 #, kde-format msgid "Saving document failed." msgstr "Fallou a garda do documento." #. +> trunk5 #: editorcommands.cpp:60 #, kde-format msgid "Saving failed and quitting canceled." msgstr "Fallou a garda e cancelouse a saída." #. +> trunk5 #: editorextension.cpp:61 #, kde-format msgid "English quotes: `` ''" msgstr "Aspas á inglesa: `` ''" #. +> trunk5 #: editorextension.cpp:62 #, kde-format msgid "French quotes: "< ">" msgstr "Aspas á francesa: "< ">" #. +> trunk5 #: editorextension.cpp:63 #, kde-format msgid "German quotes: "` "'" msgstr "Aspas á alemá: "` "'" #. +> trunk5 #: editorextension.cpp:64 #, kde-format msgid "French quotes (long): \\flqq \\frqq" msgstr "Aspas á francesa (longas): \\flqq \\frqq" #. +> trunk5 #: editorextension.cpp:65 #, kde-format msgid "German quotes (long): \\glqq \\grqq" msgstr "Aspas á alemá (longas): \\glqq \\grqq" #. +> trunk5 #: editorextension.cpp:66 #, kde-format msgid "Icelandic quotes (v1): \\ilqq \\irqq" msgstr "Aspas á islandesa (v1): \\ilqq \\irqq" #. +> trunk5 #: editorextension.cpp:67 #, kde-format msgid "Icelandic quotes (v2): \\iflqq \\ifrqq" msgstr "Aspas á islandesa (v2): \\iflqq \\ifrqq" #. +> trunk5 #: editorextension.cpp:68 #, kde-format msgid "Czech quotes: \\uv{}" msgstr "Aspas á checa: \\uv{}" #. +> trunk5 #: editorextension.cpp:69 #, kde-format msgid "csquotes package: \\enquote{}" msgstr "paquete csquotes: \\enquote{}" #. +> trunk5 #: editorextension.cpp:3242 #, kde-format msgid "You have to include the package %1 to use %2." msgstr "Hai que incluír o paquete %1 para empregar %2." #. +> trunk5 #: editorextension.cpp:3493 #, kde-format -msgid "The document was modified and the structure view should be updated, before starting such an operation." -msgstr "O documento modificouse, polo que debería actualizar a vista da estrutura antes de iniciar esa operación." +msgid "" +"The document was modified and the structure view should be updated, before" +" starting such an operation." +msgstr "" +"O documento modificouse, polo que debería actualizar a vista da estrutura" +" antes de iniciar esa operación." #. +> trunk5 #: editorextension.cpp:3494 #, kde-format msgid "Structure View Error" msgstr "Erro na vista da estrutura" #. +> trunk5 #: editorkeysequencemanager.cpp:254 #, kde-format msgid "Script execution of %1" msgstr "Execución do script de %1" #. +> trunk5 #: errorhandler.cpp:77 #, kde-format msgid "Messages" msgstr "Mensaxes" #. +> trunk5 #: errorhandler.cpp:78 #, kde-format msgid "Errors" msgstr "Erros" #. +> trunk5 #: errorhandler.cpp:79 #, kde-format msgid "Warnings" msgstr "Avisos" #. +> trunk5 #: errorhandler.cpp:80 #, kde-format msgid "BadBoxes" msgstr "Caixas malas" #. +> trunk5 #: errorhandler.cpp:101 #, kde-format msgid "View Log File" msgstr "Ver o ficheiro de rexistro" #. +> trunk5 #: errorhandler.cpp:106 #, kde-format msgid "Previous LaTeX Error" msgstr "Erro de LaTeX anterior" #. +> trunk5 #: errorhandler.cpp:110 #, kde-format msgid "Next LaTeX Error" msgstr "Erro de LaTeX seguinte" #. +> trunk5 #: errorhandler.cpp:114 #, kde-format msgid "Previous LaTeX Warning" msgstr "Aviso de LaTeX anterior" #. +> trunk5 #: errorhandler.cpp:118 #, kde-format msgid "Next LaTeX Warnings" msgstr "Aviso de LaTeX seguinte" #. +> trunk5 #: errorhandler.cpp:122 #, kde-format msgid "Previous LaTeX BadBox" msgstr "Caixa mala de LaTeX anterior" #. +> trunk5 #: errorhandler.cpp:126 #, kde-format msgid "Next LaTeX BadBox" msgstr "Caixa mala de LaTeX seguinte" #. +> trunk5 #: errorhandler.cpp:316 #, kde-format msgid "Errors: %1" msgstr "Erros: %1" #. +> trunk5 #: errorhandler.cpp:319 #, kde-format msgid "Warnings: %1" msgstr "Avisos: %1" #. +> trunk5 #: errorhandler.cpp:322 #, kde-format msgid "BadBoxes: %1" msgstr "Caixas malas: %1" #. +> trunk5 #: errorhandler.cpp:326 #, kde-format msgctxt "Result of the compilation w.r.t. number of errors/warnings/badboxes" msgid "%1 %2 %3" msgstr "%1 %2 %3" #. +> trunk5 #: errorhandler.cpp:405 #, kde-format msgid "No information about warnings or errors is available." msgstr "Non hai información dispoñíbel sobre os avisos ou os erros." #. +> trunk5 #: errorhandler.cpp:455 parser/latexoutputparser.cpp:645 #, kde-format msgid "Cannot open log file; did you run LaTeX?" msgstr "Non se pode abrir o ficheiro de rexistro; executou LaTeX?" #. +> trunk5 #: errorhandler.cpp:541 #, kde-format msgid "No LaTeX warnings/errors detected." msgstr "Non se detectaron avisos ou erros de LaTeX." #. +> trunk5 #: kile.cpp:374 #, kde-format -msgid "You have defined some tools in the User menu. From now on these tools will be available from the Build->Other menu and can be configured in the configuration dialog (go to the Settings menu and choose Configure Kile). This has some advantages; your own tools can now be used in a QuickBuild command if you wish." -msgstr "Ten definidas algunhas ferramentas no menú Usuario. Desde agora esas ferramentas están dispoñíbeis no menú Crear->Outro e pode configuralas no diálogo de configuración (vaia para o menú de Configuración e escolla Configurar Kile). Isto ten algunhas vantaxes; pode usar as súas propias ferramentas nunha orde de Xeración rápida se o desexa." +msgid "" +"You have defined some tools in the User menu. From now on these tools will be" +" available from the Build->Other menu and can be configured in the" +" configuration dialog (go to the Settings menu and choose Configure Kile)." +" This has some advantages; your own tools can now be used in a QuickBuild" +" command if you wish." +msgstr "" +"Ten definidas algunhas ferramentas no menú Usuario. Desde agora esas" +" ferramentas están dispoñíbeis no menú Crear->Outro e pode configuralas no" +" diálogo de configuración (vaia para o menú de Configuración e escolla" +" Configurar Kile). Isto ten algunhas vantaxes; pode usar as súas propias" +" ferramentas nunha orde de Xeración rápida se o desexa." #. +> trunk5 #: kile.cpp:374 #, kde-format msgid "User Tools Detected" msgstr "Detectáronse ferramentas do usuario" #. +> trunk5 #: kile.cpp:382 #, kde-format msgid "" -"

The tool settings need to be reset for this version of Kile to function properly.
" +"

The tool settings need to be reset for this version of Kile to function" +" properly.
" "This will overwrite any changes you have made.

" "

Do you want to reset the tools now?

" msgstr "" -"

Hai que restabelecer a configuración das ferramentas para que esta versión de Kile funcione correctamente.

" +"

Hai que restabelecer a configuración das ferramentas para que esta versión" +" de Kile funcione correctamente.

" " " "

Isto sobrescribirá calquera cambio que fixese.

" " " "

Quere restabelecer as ferramentas agora?

" #. +> trunk5 #: kile.cpp:385 #, kde-format msgid "Tools need to be reset" msgstr "Hai que restabelecer as ferramentas." #. +> trunk5 #: kile.cpp:458 #, kde-format msgid "Open File" msgstr "Abrir un ficheiro" #. +> trunk5 #: kile.cpp:478 #, kde-format msgid "Files and Projects" msgstr "Ficheiros e proxectos" #. +> trunk5 #: kile.cpp:543 widgets/structurewidget.cpp:138 #, kde-format msgid "Structure" msgstr "Estrutura" #. +> trunk5 #: kile.cpp:566 #, kde-format msgid "Scripts" msgstr "Scripts" #. +> trunk5 #: kile.cpp:605 #, kde-format msgid "Symbols" msgstr "Símbolos" #. +> trunk5 #: kile.cpp:608 #, kde-format msgid "Most Frequently Used" msgstr "Os utilizados máis a miúdo" #. +> trunk5 #: kile.cpp:614 #, kde-format msgid "Relation" msgstr "Relación" #. +> trunk5 #: kile.cpp:619 #, kde-format msgid "Operators" msgstr "Operadores" #. +> trunk5 #: kile.cpp:624 #, kde-format msgid "Arrows" msgstr "Frechas" #. +> trunk5 #: kile.cpp:629 #, kde-format msgid "Miscellaneous Math" msgstr "Símbolos matemáticos diversos" #. +> trunk5 #: kile.cpp:634 #, kde-format msgid "Miscellaneous Text" msgstr "Símbolos de texto diversos" #. +> trunk5 #: kile.cpp:639 #, kde-format msgid "Delimiters" msgstr "Delimitadores" #. +> trunk5 #: kile.cpp:644 #, kde-format msgid "Greek" msgstr "Grego" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) #. +> trunk5 #: kile.cpp:649 widgets/latexconfigwidget.ui:133 #, kde-format msgid "Special Characters" msgstr "Caracteres especiais" #. +> trunk5 #: kile.cpp:654 #, kde-format msgid "Cyrillic Characters" msgstr "Caracteres cirílicos" #. +> trunk5 #: kile.cpp:659 #, kde-format msgid "User Defined" msgstr "Definido polo usuario" #. +> trunk5 #: kile.cpp:664 #, kde-format msgid "" "

Move the mouse over the icons to see the corresponding LaTeX commands.
" -"Click on an image to insert the corresponding command, additionally pressing \"Shift\" inserts it in math mode, pressing \"Ctrl\" in curly brackets.

" +"Click on an image to insert the corresponding command, additionally pressing" +" \"Shift\" inserts it in math mode, pressing \"Ctrl\" in curly brackets.

" msgstr "" "

Mova o rato sobre as iconas para ver as ordes LaTeX correspondentes.
" -"\tPrema as iconas para inserir as ordes; se ademais preme «Maiús» inserirá no modo matemático,\te con «Ctrl» entre chaves.

" +"\tPrema as iconas para inserir as ordes; se ademais preme «Maiús» inserirá no" +" modo matemático,\te con «Ctrl» entre chaves.

" #. +> trunk5 #: kile.cpp:684 widgets/codecompletionconfigwidget.cpp:55 #, kde-format msgid "Abbreviation" msgstr "Abreviatura" #. +> trunk5 #: kile.cpp:709 #, kde-format msgid "Log and Messages" msgstr "Rexistro e mensaxes" #. +> trunk5 #: kile.cpp:715 #, kde-format msgid "Output" msgstr "Saída" #. +> trunk5 #: kile.cpp:718 #, kde-format msgid "Konsole" msgstr "Konsole" #. +> trunk5 #: kile.cpp:801 #, kde-format msgid "Save All" msgstr "Gardar todo" #. +> trunk5 #: kile.cpp:803 #, kde-format msgid "Create Template From Document..." msgstr "Crear un modelo a partir do documento…" #. +> trunk5 #: kile.cpp:804 #, kde-format msgid "&Remove Template..." msgstr "Retira&r o modelo…" #. +> trunk5 #: kile.cpp:806 kile.cpp:928 #, kde-format msgid "Close All" msgstr "Pechar todo" #. +> trunk5 #: kile.cpp:807 #, kde-format msgid "Close All Ot&hers" msgstr "Pechar as &demais" #. +> trunk5 #: kile.cpp:808 #, kde-format msgid "S&tatistics" msgstr "Es&tatísticas" #. +> trunk5 #: kile.cpp:809 #, kde-format msgid "&ASCII" msgstr "&ASCII" #. +> trunk5 #: kile.cpp:810 #, kde-format msgid "Latin-&1 (iso 8859-1)" msgstr "Latin-&1 (iso 8859-1)" #. +> trunk5 #: kile.cpp:811 #, kde-format msgid "Latin-&2 (iso 8859-2)" msgstr "Latin-&2 (iso 8859-2)" #. +> trunk5 #: kile.cpp:812 #, kde-format msgid "Latin-&3 (iso 8859-3)" msgstr "Latin-&3 (iso 8859-3)" #. +> trunk5 #: kile.cpp:813 #, kde-format msgid "Latin-&4 (iso 8859-4)" msgstr "Latin-&4 (iso 8859-4)" #. +> trunk5 #: kile.cpp:814 #, kde-format msgid "Latin-&5 (iso 8859-5)" msgstr "Latin-&5 (iso 8859-5)" #. +> trunk5 #: kile.cpp:815 #, kde-format msgid "Latin-&9 (iso 8859-9)" msgstr "Latin-&9 (iso 8859-9)" #. +> trunk5 #: kile.cpp:816 #, kde-format msgid "&Central European (cp-1250)" msgstr "&Centroeuropeo (cp-1250)" #. +> trunk5 #: kile.cpp:817 #, kde-format msgid "&Western European (cp-1252)" msgstr "Europa &occidental (cp-1252)" #. +> trunk5 #: kile.cpp:820 #, kde-format msgid "Move Tab Left" msgstr "Mover a lapela cara á esquerda" #. +> trunk5 #: kile.cpp:821 #, kde-format msgid "Move Tab Right" msgstr "Mover a lapela cara á dereita" #. +> trunk5 #: kile.cpp:823 #, kde-format msgid "Next section" msgstr "Sección seguinte" #. +> trunk5 #: kile.cpp:825 #, kde-format msgid "Prev section" msgstr "Sección anterior" #. +> trunk5 #: kile.cpp:827 #, kde-format msgid "Next paragraph" msgstr "Parágrafo seguinte" #. +> trunk5 #: kile.cpp:829 #, kde-format msgid "Prev paragraph" msgstr "Parágrafo anterior" #. +> trunk5 #: kile.cpp:832 #, kde-format msgid "Find &in Files..." msgstr "Atopar nos f&icheiros…" #. +> trunk5 #: kile.cpp:834 #, kde-format msgid "Refresh Str&ucture" msgstr "Actualizar a estr&utura" #. +> trunk5 #: kile.cpp:837 #, kde-format msgid "&New Project..." msgstr "&Novo proxecto…" #. +> trunk5 #: kile.cpp:838 #, kde-format msgid "&Open Project..." msgstr "&Abrir un proxecto…" #. +> trunk5 #: kile.cpp:840 #, kde-format msgid "Open &Recent Project" msgstr "Abrir un proxecto &recente" #. +> trunk5 #: kile.cpp:847 #, kde-format msgid "A&dd Files to Project..." msgstr "Enga&dir ficheiros ao proxecto…" #. +> trunk5 #: kile.cpp:848 widgets/projectview.cpp:853 #, kde-format msgid "Refresh Project &Tree" msgstr "Ac&tualizar a árbore do proxecto" #. +> trunk5 #: kile.cpp:849 widgets/projectview.cpp:855 #, kde-format msgid "&Archive" msgstr "&Arquivar" #. +> trunk5 #: kile.cpp:850 widgets/projectview.cpp:854 #, kde-format msgid "Project &Options" msgstr "&Opcións do proxecto" #. +> trunk5 #: kile.cpp:851 #, kde-format msgid "&Close Project" msgstr "&Pechar o proxecto" #. +> trunk5 #: kile.cpp:854 #, kde-format msgid "&Show Projects..." msgstr "&Mostrar os proxectos…" #. +> trunk5 #: kile.cpp:855 #, kde-format msgid "Re&move Files From Project..." msgstr "&Retirar ficheiros do proxecto…" #. +> trunk5 #: kile.cpp:856 #, kde-format msgid "Show Project &Files..." msgstr "Mostrar os &ficheiros do proxecto…" #. +> trunk5 #: kile.cpp:858 widgets/projectview.cpp:851 #, kde-format msgid "Open All &Project Files" msgstr "Abrir todos os ficheiros do &proxecto" #. +> trunk5 #: kile.cpp:859 #, kde-format msgid "Find in &Project..." msgstr "Atopar no &proxecto…" #. +> trunk5 #: kile.cpp:862 kile.cpp:952 kile.cpp:2070 kiledocmanager.cpp:1989 #: kiledocmanager.cpp:1999 #, kde-format msgid "Clean" msgstr "Limpar" #. +> trunk5 #: kile.cpp:864 #, kde-format msgid "Next Document" msgstr "Documento seguinte" #. +> trunk5 #: kile.cpp:866 #, kde-format msgid "Previous Document" msgstr "Documento anterior" #. +> trunk5 #: kile.cpp:868 #, kde-format msgid "Focus Log/Messages View" msgstr "Focalizar a vista do Rexistro/Mensaxes" #. +> trunk5 #: kile.cpp:869 #, kde-format msgid "Focus Output View" msgstr "Focalizar a vista da Saída" #. +> trunk5 #: kile.cpp:870 #, kde-format msgid "Focus Konsole View" msgstr "Focalizar a vista de Konsole" #. +> trunk5 #: kile.cpp:871 #, kde-format msgid "Focus Editor View" msgstr "Focalizar a vista do Editor" #. +> trunk5 #: kile.cpp:873 #, kde-format msgctxt "@action: Starts the completion of the current LaTeX command" msgid "Complete (La)TeX Command" msgstr "Completar a orde de (La)TeX" #. +> trunk5 #: kile.cpp:875 #, kde-format msgctxt "@action: Starts the input (and completion) of a LaTeX environment" msgid "Complete LaTeX Environment" msgstr "Completar o ambiente de LaTeX" #. +> trunk5 #: kile.cpp:877 #, kde-format msgctxt "@action: Starts the completion of the current abbreviation" msgid "Complete Abbreviation" msgstr "Completar a abreviatura" #. +> trunk5 #: kile.cpp:880 #, kde-format msgid "Next Bullet" msgstr "Viñeta seguinte" #. +> trunk5 #: kile.cpp:882 #, kde-format msgid "Prev Bullet" msgstr "Viñeta anterior" #. +> trunk5 #: kile.cpp:886 kile.cpp:903 #, kde-format msgid "Environment (inside)" msgstr "Ambiente (interior)" #. +> trunk5 #: kile.cpp:888 kile.cpp:905 #, kde-format msgid "Environment (outside)" msgstr "Ambiente (exterior)" #. +> trunk5 #: kile.cpp:890 kile.cpp:907 #, kde-format msgid "TeX Group (inside)" msgstr "Grupo de TeX (interior)" #. +> trunk5 #: kile.cpp:892 kile.cpp:909 #, kde-format msgid "TeX Group (outside)" msgstr "Grupo de TeX (exterior)" #. +> trunk5 #: kile.cpp:894 kile.cpp:911 #, kde-format msgid "Math Group" msgstr "Grupo de matemáticas" #. +> trunk5 #: kile.cpp:896 kile.cpp:913 #, kde-format msgid "Paragraph" msgstr "Parágrafo" #. +> trunk5 #: kile.cpp:898 #, kde-format msgid "Line" msgstr "Liña" #. +> trunk5 #: kile.cpp:900 kile.cpp:917 #, kde-format msgid "TeX Word" msgstr "Palabra TeX" #. +> trunk5 #: kile.cpp:915 #, kde-format msgid "To End of Line" msgstr "Ata o fin da liña" #. +> trunk5 #: kile.cpp:920 kile.cpp:931 #, kde-format msgid "Go to Begin" msgstr "Ir ao inicio" #. +> trunk5 #: kile.cpp:922 kile.cpp:933 #, kde-format msgid "Go to End" msgstr "Ir ao fin" #. +> trunk5 #: kile.cpp:924 kile.cpp:935 #, kde-format msgid "Match" msgstr "Coincidencia" #. +> trunk5 #: kile.cpp:926 kile.cpp:937 #, kde-format msgid "Close" msgstr "Pechar" #. +> trunk5 #: kile.cpp:940 #, kde-format msgid "Selection" msgstr "Selección" #. +> trunk5 #: kile.cpp:942 #, kde-format msgid "Subdocument" msgstr "Subdocumento" #. +> trunk5 #: kile.cpp:943 #, kde-format msgid "Mathgroup" msgstr "Grupo de matemáticas" #. +> trunk5 #: kile.cpp:948 #, kde-format msgid "&Bibliography" msgstr "&Bibliografía" #. i18n: ectx: Menu (settings) #. +> trunk5 #: kile.cpp:954 kileui.rc:496 #, kde-format msgid "&Settings" msgstr "&Configuración" #. +> trunk5 #: kile.cpp:957 #, kde-format msgid "Settings for BibTeX" msgstr "Configuración de BibTeX" #. +> trunk5 #: kile.cpp:961 #, kde-format msgid "Settings for Biblatex" msgstr "Configuración de Biblatex" #. +> trunk5 #: kile.cpp:968 kile.cpp:2179 #, kde-format msgid "Quick Start" msgstr "Inicio rápido" #. +> trunk5 #: kile.cpp:971 kilestdactions.cpp:391 #, kde-format msgid "Array" msgstr "Matriz" #. +> trunk5 #: kile.cpp:972 kile.cpp:2231 kilestdactions.cpp:78 #, kde-format msgid "Tabbing" msgstr "Tabulación" #. +> trunk5 #: kile.cpp:973 #, kde-format msgid "Floats" msgstr "Flutuantes" #. +> trunk5 #: kile.cpp:978 #, kde-format msgid "Define Current Document as '&Master Document'" msgstr "Definir o documento actual como «Documento &mestre»" #. +> trunk5 #: kile.cpp:983 #, kde-format msgid "Show Document Viewer" msgstr "Mostrar o visor de documentos" #. +> trunk5 #: kile.cpp:990 #, kde-format msgid "Show S&ide Bar" msgstr "Mostrar a barra &lateral" #. +> trunk5 #: kile.cpp:996 #, kde-format msgid "Show Mess&ages Bar" msgstr "Mostrar a barra de &mensaxes" #. +> trunk5 #: kile.cpp:1008 #, kde-format msgid "Watch File Mode" msgstr "Modo de vixilancia do ficheiro" #. +> trunk5 #: kile.cpp:1019 #, kde-format msgid "TeX Guide" msgstr "Guía de TeX" #. +> trunk5 #: kile.cpp:1021 #, kde-format msgid "LaTeX Command" msgstr "Orde de LaTeX" #. +> trunk5 #: kile.cpp:1022 #, kde-format msgid "LaTeX Subject" msgstr "Asunto de LaTeX" #. +> trunk5 #: kile.cpp:1023 #, kde-format msgid "LaTeX Env" msgstr "Ambiente de LaTeX" #. +> trunk5 #: kile.cpp:1024 #, kde-format msgid "Context Help" msgstr "Axuda contextual" #. +> trunk5 #: kile.cpp:1027 #, kde-format msgid "LaTeX Reference" msgstr "Referencia de LaTeX" #. +> trunk5 #: kile.cpp:1029 #, kde-format msgid "&About Editor Component" msgstr "&Sobre a compoñente de edición" #. +> trunk5 #: kile.cpp:1037 #, kde-format msgid "&System Check..." msgstr "Comprobación do &sistema…" #. +> trunk5 #: kile.cpp:1052 kileinfo.cpp:357 #, kde-format msgid "BibTeX" msgstr "BibTeX" #. +> trunk5 #: kile.cpp:1055 #, kde-format msgid "Biblatex" msgstr "Biblatex" #. +> trunk5 #: kile.cpp:1203 widgets/toolconfigwidget.cpp:75 #, kde-format msgid "Compile" msgstr "Compilar" #. +> trunk5 #: kile.cpp:1204 widgets/toolconfigwidget.cpp:77 #, kde-format msgid "View" msgstr "Ver" #. +> trunk5 #: kile.cpp:1205 widgets/toolconfigwidget.cpp:76 #, kde-format msgid "Convert" msgstr "Converter" #. +> trunk5 #: kile.cpp:1206 widgets/toolconfigwidget.cpp:74 #, kde-format msgid "Quick" msgstr "Rápido" #. +> trunk5 #: kile.cpp:1380 #, kde-format msgid "" "It was impossible to create the \"Archive\" tool.\n" "\n" "Please check and repair your installation of Kile." msgstr "" "Non foi posíbel crear a ferramenta «Arquivo».\n" "\n" "Comprobe e arranxe a instalación de Kile." #. +> trunk5 #: kile.cpp:1382 #, kde-format msgid "Unable to Create Archive Tool" msgstr "Non se pode crear a ferramenta Arquivo" #. +> trunk5 #: kile.cpp:1451 #, kde-format msgid "Project: %1" msgstr "Proxecto: %1" #. +> trunk5 #: kile.cpp:1454 #, kde-format msgid "Project: %1 (Master document: %2)" msgstr "Proxecto: %1 (Documento mestre: %2)" #. +> trunk5 #: kile.cpp:1459 #, kde-format msgid "Normal mode" msgstr "Modo normal" #. +> trunk5 #: kile.cpp:1462 #, kde-format msgid "Master document: %1" msgstr "Documento mestre: %1" #. +> trunk5 #: kile.cpp:1467 kile.cpp:2604 #, kde-format msgid "Define Current Document as 'Master Document'" msgstr "Definir o documento actual como «Documento mestre»" #. +> trunk5 #: kile.cpp:1471 kile.cpp:2594 #, kde-format msgid "Normal mode (current master document: %1)" msgstr "Modo normal (documento mestre actual: %1)" #. +> trunk5 #: kile.cpp:1689 #, kde-format msgctxt "Window caption in read-only mode: [Read-Only]" msgid "%1 [Read-Only]" msgstr "%1 (só lectura)" #. +> trunk5 #: kile.cpp:2063 #, kde-format msgid "There is no active document or it is not saved." msgstr "Non hai ningún documento activo ou non está gardado." #. +> trunk5 #: kile.cpp:2150 #, kde-format msgid "You have to include the package %1." msgstr "Hai que incluír o paquete %1." #. +> trunk5 #: kile.cpp:2150 kile.cpp:2153 #, kde-format msgid "Insert text" msgstr "Inserir o texto" #. +> trunk5 #: kile.cpp:2153 #, kde-format msgid "You have to include the packages %1." msgstr "Ten que incluír os paquetes %1." #. +> trunk5 #: kile.cpp:2340 #, kde-format msgid "Could not create the \"ViewHTML\" tool. Please reset the tools." msgstr "Non se puido crear a ferramenta «VerHTML». Reinicie as ferramentas." #. +> trunk5 #: kile.cpp:2389 #, kde-format msgid "No Name" msgstr "Sen nome" #. +> trunk5 #: kile.cpp:2425 #, kde-format msgid "no name" msgstr "sen nome" #. +> trunk5 #: kile.cpp:2622 #, kde-format -msgid "In order to define the current document as a master document, it has to be saved first." -msgstr "Para definir o documento actual como un documento mestre, antes ten que gardalo." +msgid "" +"In order to define the current document as a master document, it has to be" +" saved first." +msgstr "" +"Para definir o documento actual como un documento mestre, antes ten que" +" gardalo." #. +> trunk5 #: kile.cpp:3029 #, kde-format msgctxt "@info:status status bar label for block selection mode" msgid "BLOCK" msgstr "BLOQUE" #. +> trunk5 #: kile.cpp:3030 #, kde-format msgctxt "@info:status status bar label for line selection mode" msgid "LINE" msgstr "LIÑA" #. +> trunk5 #: kile.cpp:3037 #, kde-format msgid "Refreshing structure..." msgstr "Actualizando a estrutura…" #. i18n: ectx: label, entry (RCVersion), group (VersionInfo) #. +> trunk5 #: kile.kcfg:18 #, kde-format msgid "The resource file version." msgstr "A versión do ficheiro do recurso." #. i18n: ectx: label, entry (MainwindowWidth), group (Geometries) #. +> trunk5 #: kile.kcfg:40 #, kde-format msgid "The main window's width." msgstr "A anchura da xanela principal." #. i18n: ectx: label, entry (MainwindowHeight), group (Geometries) #. +> trunk5 #: kile.kcfg:46 #, kde-format msgid "The main window's height." msgstr "A altura da xanela principal." #. i18n: ectx: label, entry (DefaultLevel), group (Structure) #. +> trunk5 #: kile.kcfg:54 #, kde-format msgid "The expansion level for the structure view." msgstr "O nivel de expansión para a vista da estrutura." #. i18n: ectx: label, entry (SvShowLabels), group (Structure) #. +> trunk5 #: kile.kcfg:58 #, kde-format msgid "Show label commands in the structure view" msgstr "Mostrar as ordes de lendas na vista da estrutura" #. i18n: ectx: label, entry (SvShowReferences), group (Structure) #. +> trunk5 #: kile.kcfg:62 #, kde-format msgid "Show undefined references in the structure view" msgstr "Mostrar as referencias non definidas na vista da estrutura" #. i18n: ectx: label, entry (SvShowBibitems), group (Structure) #. +> trunk5 #: kile.kcfg:66 #, kde-format msgid "Show bibitems commands in the structure view" msgstr "Mostrar as ordes dos elementos bibliográficos na vista da estrutura" #. i18n: ectx: label, entry (SvShowGraphics), group (Structure) #. +> trunk5 #: kile.kcfg:70 #, kde-format msgid "Show includegraphics commands in the structure view" msgstr "Mostrar as ordes de incluír gráficos na vista da estrutura" #. i18n: ectx: label, entry (SvShowFloats), group (Structure) #. +> trunk5 #: kile.kcfg:74 #, kde-format msgid "Show float environments in the structure view" msgstr "Mostrar os ambientes flutuantes na vista da estrutura" #. i18n: ectx: label, entry (SvShowInputFiles), group (Structure) #. +> trunk5 #: kile.kcfg:78 #, kde-format msgid "Show file input commands in the structure view" msgstr "Mostrar as ordes de ficheiro de entrada na vista da estrutura" #. i18n: ectx: label, entry (SvShowSectioningLabels), group (Structure) #. +> trunk5 #: kile.kcfg:82 #, kde-format msgid "Show labels as child of sectioning items in the structure view" -msgstr "Mostrar as lendas como fillo dos elementos de sección na vista da estrutura" +msgstr "" +"Mostrar as lendas como fillo dos elementos de sección na vista da estrutura" #. i18n: ectx: label, entry (SvShowTodo), group (Structure) #. +> trunk5 #: kile.kcfg:86 #, kde-format msgid "Show TODO and FIXME comments" msgstr "Mostrar os comentarios PENDENTE e CORRIXIR" #. i18n: ectx: label, entry (SvOpenLabels), group (Structure) #. +> trunk5 #: kile.kcfg:90 #, kde-format msgid "Open the parent item for all labels in the structure view as default" -msgstr "Abrir o elemento pai de todas as lendas na vista da estrutura de maneira predeterminada" +msgstr "" +"Abrir o elemento pai de todas as lendas na vista da estrutura de maneira" +" predeterminada" #. i18n: ectx: label, entry (SvOpenReferences), group (Structure) #. +> trunk5 #: kile.kcfg:94 #, kde-format msgid "Open the parent item for all undefined references in the structure view" -msgstr "Abrir o elemento pai de todas as referencias non definidas na vista da estrutura" +msgstr "" +"Abrir o elemento pai de todas as referencias non definidas na vista da" +" estrutura" #. i18n: ectx: label, entry (SvOpenBibitems), group (Structure) #. +> trunk5 #: kile.kcfg:98 #, kde-format msgid "Open the parent item for all bibitems in the structure view as default" -msgstr "Abrir o elemento pai de todos os elementos bibliográficos na vista da estrutura de maneira predeterminada" +msgstr "" +"Abrir o elemento pai de todos os elementos bibliográficos na vista da" +" estrutura de maneira predeterminada" #. i18n: ectx: label, entry (SvOpenTodo), group (Structure) #. +> trunk5 #: kile.kcfg:102 #, kde-format msgid "Open the parent item for all TODO and FIXME comments as default" -msgstr "Abrir o elemento pai de todos os comentarios PENDENTE e CORRIXIR de maneira predeterminada" +msgstr "" +"Abrir o elemento pai de todos os comentarios PENDENTE e CORRIXIR de maneira" +" predeterminada" #. i18n: ectx: label, entry (SvDefaultGraphicExt), group (Structure) #. +> trunk5 #: kile.kcfg:106 #, kde-format msgid "Default extension to use when opening graphic files with no extension" -msgstr "Extensión predeterminada que empregar cando se abran ficheiros gráficos sen extensión" +msgstr "" +"Extensión predeterminada que empregar cando se abran ficheiros gráficos sen" +" extensión" #. i18n: ectx: label, entry (BibliographyType), group (BibliographyMenu) #. +> trunk5 #: kile.kcfg:112 #, kde-format msgid "What type of bibliography (bibtex or biblatex) kile should show." msgstr "O tipo de bibliografía (bibtex ou biblatex) que mostrará Kile." #. i18n: ectx: label, entry (RunLyxServer), group (Tools) #. +> trunk5 #: kile.kcfg:118 #, kde-format msgid "Whether to run the Lyx server." msgstr "Indica se debe executarse o servidor de Lyx." #. i18n: ectx: label, entry (TeXPaths), group (Tools) #. +> trunk5 #: kile.kcfg:122 #, kde-format msgid "Holds the TEXINPUTS environment variable." msgstr "Contén a variábel de contorno TEXINPUTS." #. i18n: ectx: whatsthis, entry (TeXPaths), group (Tools) #. +> trunk5 #: kile.kcfg:123 #, kde-format -msgid "Set the TEXINPUTS environment variable here. TEXINPUTS should be a colon-separated list of all paths TeX should look for additional packages and/or files. You do not have to add :$TEXINPUTS at the end." -msgstr "Configure aquí a variábel de contorno TEXINPUTS. TEXINPUTS debera ser unha lista delimitada por comas de todas as rutas nas que TeX debera buscar paquetes e ficheiros adicionais. Non ten que engadir :$TEXINPUTS no fin." +msgid "" +"Set the TEXINPUTS environment variable here. TEXINPUTS should be a" +" colon-separated list of all paths TeX should look for additional packages" +" and/or files. You do not have to add :$TEXINPUTS at the end." +msgstr "" +"Configure aquí a variábel de contorno TEXINPUTS. TEXINPUTS debera ser unha" +" lista delimitada por comas de todas as rutas nas que TeX debera buscar" +" paquetes e ficheiros adicionais. Non ten que engadir :$TEXINPUTS no fin." #. i18n: ectx: label, entry (PreviewTeXPaths), group (Tools) #. +> trunk5 #: kile.kcfg:127 #, kde-format msgid "Holds the TEXINPUTS environment variable for QuickPreview tools." -msgstr "Contén a variábel de contorno TEXINPUTS para as ferramentas de vista previa rápida." +msgstr "" +"Contén a variábel de contorno TEXINPUTS para as ferramentas de vista previa" +" rápida." #. i18n: ectx: whatsthis, entry (PreviewTeXPaths), group (Tools) #. +> trunk5 #: kile.kcfg:128 #, kde-format -msgid "Set the TEXINPUTS environment variable for QuickPreview tools here. TEXINPUTS should be a colon-separated list of all paths TeX should look for additional packages and/or files. You do not have to add :$TEXINPUTS at the end." -msgstr "Configure aquí a variábel de contorno TEXINPUTS para as ferramentas de vista previa rápida. TEXINPUTS debe ser unha lista delimitada por comas de todas as rutas nas que TeX buscará paquetes ou ficheiros adicionais. Non ten que engadir :$TEXINPUTS no fin." +msgid "" +"Set the TEXINPUTS environment variable for QuickPreview tools here. TEXINPUTS" +" should be a colon-separated list of all paths TeX should look for additional" +" packages and/or files. You do not have to add :$TEXINPUTS at the end." +msgstr "" +"Configure aquí a variábel de contorno TEXINPUTS para as ferramentas de vista" +" previa rápida. TEXINPUTS debe ser unha lista delimitada por comas de todas" +" as rutas nas que TeX buscará paquetes ou ficheiros adicionais. Non ten que" +" engadir :$TEXINPUTS no fin." #. i18n: ectx: label, entry (BibInputPaths), group (Tools) #. +> trunk5 #: kile.kcfg:132 #, kde-format msgid "Holds the BIBINPUTS environment variable." msgstr "Contén a variábel de contorno BIBINPUTS." #. i18n: ectx: whatsthis, entry (BibInputPaths), group (Tools) #. +> trunk5 #: kile.kcfg:133 #, kde-format -msgid "Set the BIBINPUTS environment variable here. BIBINPUTS should be a colon-separated list of all paths bibtex should look for additional .bib files. You do not have to add :$BIBINPUTS at the end." -msgstr "Configure aquí a variábel de contorno BIBINPUTS. Esta debe conter unha lista separada por comas de todas as rutas onde bibtex debe buscar paquetes ou ficheiros adicionais. Non ten que engadir :$BIBINPUTS no fin." +msgid "" +"Set the BIBINPUTS environment variable here. BIBINPUTS should be a" +" colon-separated list of all paths bibtex should look for additional .bib" +" files. You do not have to add :$BIBINPUTS at the end." +msgstr "" +"Configure aquí a variábel de contorno BIBINPUTS. Esta debe conter unha lista" +" separada por comas de todas as rutas onde bibtex debe buscar paquetes ou" +" ficheiros adicionais. Non ten que engadir :$BIBINPUTS no fin." #. i18n: ectx: label, entry (PreviewBibInputPaths), group (Tools) #. +> trunk5 #: kile.kcfg:137 #, kde-format msgid "Holds the BIBINPUTS environment variable for QuickPreview tools." -msgstr "Contén a variábel de contorno BIBINPUTS para as ferramentas de vista previa rápida." +msgstr "" +"Contén a variábel de contorno BIBINPUTS para as ferramentas de vista previa" +" rápida." #. i18n: ectx: whatsthis, entry (PreviewBibInputPaths), group (Tools) #. +> trunk5 #: kile.kcfg:138 #, kde-format -msgid "Set the BIBINPUTS environment variable for QuickPreview tools here. BIBINPUTS should be a colon-separated list of all the paths where the bibliography tool (e.g. BibTeX or Biber) should look for additional packages and/or files. You do not have to add :$BIBINPUTS at the end." -msgstr "Configure aquí a variábel de contorno BIBINPUTS para as ferramentas de vista previa rápida. BIBINPUTS debe ser unha lista delimitada por comas de todas as rutas nas que a ferramenta bibliográfica (como BibTeX ou Biber) debería buscar paquetes ou ficheiros adicionais. Non ten que engadir :$BIBINPUTS no fin." +msgid "" +"Set the BIBINPUTS environment variable for QuickPreview tools here. BIBINPUTS" +" should be a colon-separated list of all the paths where the bibliography" +" tool (e.g. BibTeX or Biber) should look for additional packages and/or" +" files. You do not have to add :$BIBINPUTS at the end." +msgstr "" +"Configure aquí a variábel de contorno BIBINPUTS para as ferramentas de vista" +" previa rápida. BIBINPUTS debe ser unha lista delimitada por comas de todas" +" as rutas nas que a ferramenta bibliográfica (como BibTeX ou Biber) debería" +" buscar paquetes ou ficheiros adicionais. Non ten que engadir :$BIBINPUTS no" +" fin." #. i18n: ectx: label, entry (BstInputPaths), group (Tools) #. +> trunk5 #: kile.kcfg:142 #, kde-format msgid "Holds the BSTINPUTS environment variable." msgstr "Contén a variábel de contorno BSTINPUTS." #. i18n: ectx: whatsthis, entry (BstInputPaths), group (Tools) #. +> trunk5 #: kile.kcfg:143 #, kde-format -msgid "Set the BSTINPUTS environment variable here. BSTINPUTS should be a colon-separated list of all paths bibtex should look for additional .bst files. You do not have to add :$BSTINPUTS at the end." -msgstr "Configure aquí a variábel de contorno BSTINPUTS. Esta debe conter unha lista separada por comas de todas as rutas onde bibtex debe buscar paquetes ou ficheiros adicionais. Non ten que engadir :$BSTINPUTS no fin." +msgid "" +"Set the BSTINPUTS environment variable here. BSTINPUTS should be a" +" colon-separated list of all paths bibtex should look for additional .bst" +" files. You do not have to add :$BSTINPUTS at the end." +msgstr "" +"Configure aquí a variábel de contorno BSTINPUTS. Esta debe conter unha lista" +" separada por comas de todas as rutas onde bibtex debe buscar paquetes ou" +" ficheiros adicionais. Non ten que engadir :$BSTINPUTS no fin." #. i18n: ectx: label, entry (BottomBar), group (Show) #. +> trunk5 #: kile.kcfg:149 #, kde-format msgid "Whether to show the bottom bar." msgstr "Indica se se debe mostrar a barra do fondo." #. i18n: ectx: label, entry (BottomBarSize), group (Show) #. +> trunk5 #: kile.kcfg:153 #, kde-format msgid "Height of the bottom bar." msgstr "Altura da barra do fondo." #. i18n: ectx: label, entry (BottomBarIndex), group (Show) #. +> trunk5 #: kile.kcfg:157 #, kde-format msgid "Which tab of the bottom bar to show." msgstr "A lapela que mostrar da barra do fondo." #. i18n: ectx: label, entry (SideBarSize), group (Show) #. +> trunk5 #: kile.kcfg:161 #, kde-format msgid "Width of the sidebar." msgstr "Anchura da barra lateral." #. i18n: ectx: label, entry (SideBar), group (Show) #. +> trunk5 #: kile.kcfg:165 #, kde-format msgid "Whether to show the side bar." msgstr "Indica se mostrar a barra lateral." #. i18n: ectx: label, entry (ShowDocumentViewer), group (Show) #. +> trunk5 #: kile.kcfg:169 #, kde-format msgid "Whether to show the document viewer." msgstr "Indica se mostrar a visor de documentos." #. i18n: ectx: label, entry (ShowDocumentViewerInExternalWindow), group (Show) #. +> trunk5 #: kile.kcfg:173 #, kde-format msgid "Whether to show the document viewer in a separate external window." msgstr "Indica se mostrar a visor de documentos nunha xanela separada externa." #. i18n: ectx: label, entry (HideProblemBadBox), group (Show) #. +> trunk5 #: kile.kcfg:177 #, kde-format msgid "Whether to show Bad Box warnings in the LogMsg view." msgstr "Indica se debe mostrar avisos de caixas malas na vista de mensaxes." #. i18n: ectx: label, entry (HideProblemWarning), group (Show) #. +> trunk5 #: kile.kcfg:181 #, kde-format msgid "Whether to show (La)TeX warnings in the LogMsg view." -msgstr "Indica se debe mostrar as advertencias de (La)TeX na vista de mensaxes." +msgstr "" +"Indica se debe mostrar as advertencias de (La)TeX na vista de mensaxes." #. i18n: ectx: label, entry (SelectedLeftView), group (Show) #. +> trunk5 #: kile.kcfg:185 #, kde-format msgid "The identifier of the selected view in the left pane." msgstr "O identificador da vista escollida no panel da esquerda." #. i18n: ectx: label, entry (ShowSplashScreen), group (Show) #. +> trunk5 #: kile.kcfg:189 #, kde-format msgid "Whether to show the splash screen on startup." msgstr "Indicas se mostrar a pantalla de benvida ao arrincar." #. i18n: ectx: label, entry (SystemCheckLastVersionRunForAtStartUp), group (Show) #. +> trunk5 #: kile.kcfg:193 #, kde-format msgid "Last version of Kile for which the system check was run at start up" -msgstr "A versión máis recente de Kile para a que se realizou unha comprobación do sistema ao arrancar" +msgstr "" +"A versión máis recente de Kile para a que se realizou unha comprobación do" +" sistema ao arrancar" #. i18n: ectx: label, entry (CompleteEnvironment), group (Editor Ext) #. +> trunk5 #: kile.kcfg:199 #, kde-format msgid "Automatic completion \\begin{env} with \\end{env}." msgstr "Completar automaticamente \\begin{env} con \\end{env}." #. i18n: ectx: label, entry (envIndentation), group (Editor Ext) #. +> trunk5 #: kile.kcfg:203 #, kde-format msgid "Enable auto indentation of environments" msgstr "Activar o sangrado automático dos ambientes" #. i18n: ectx: label, entry (envIndentSpaces), group (Editor Ext) #. +> trunk5 #: kile.kcfg:207 #, kde-format msgid "Use spaces instead of a tabulator to autoindent environments" -msgstr "Empregar espazos en vez do tabulador para sangrar automaticamente os ambientes" +msgstr "" +"Empregar espazos en vez do tabulador para sangrar automaticamente os ambientes" #. i18n: ectx: label, entry (envIndentNumSpaces), group (Editor Ext) #. +> trunk5 #: kile.kcfg:211 #, kde-format msgid "Use this number of spaces to autoindent environments" -msgstr "Empregar este número de espazos para sangrar automaticamente os ambientes" +msgstr "" +"Empregar este número de espazos para sangrar automaticamente os ambientes" #. i18n: ectx: label, entry (InsertDoubleQuotes), group (Editor Ext) #. +> trunk5 #: kile.kcfg:219 #, kde-format msgid "Automatic insertion of double quotes." msgstr "Inserción automática de aspas dobres." #. i18n: ectx: label, entry (DoubleQuotes), group (Editor Ext) #. +> trunk5 #: kile.kcfg:223 #, kde-format msgid "Language dependent type of double quotes." msgstr "Tipo de aspas dependente do idioma." #. i18n: ectx: label, entry (InsertSpecialCharacters), group (Editor Ext) #. +> trunk5 #: kile.kcfg:227 #, kde-format msgid "Automatic insertion of special characters." msgstr "Inserción automática de caracteres especiais." #. i18n: ectx: label, entry (igCenter), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:233 #, kde-format msgid "Center the graphics." msgstr "Centrar os gráficos." #. i18n: ectx: label, entry (igBoundingBox), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:237 #, kde-format msgid "Insert the bounding box as an option for the includegraphics command." msgstr "Inserir a caixa contedora como opción da orde includegraphics." #. i18n: ectx: label, entry (igGraphicspath), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:241 #, kde-format msgid "Filename is relative to a path given in graphicspath command." msgstr "O nome do ficheiro e relativo á ruta dada no orde graphicspath." #. i18n: ectx: label, entry (igFigure), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:245 #, kde-format msgid "Embed the graphics in a figure environment." msgstr "Encaixar as gráficas nun ambiente de figuras." #. i18n: ectx: label, entry (igTop), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:249 #, kde-format msgid "Set preferred figure position to top of page." -msgstr "Indicar que a posición preferida para as figuras sexa a parte superior da páxina." +msgstr "" +"Indicar que a posición preferida para as figuras sexa a parte superior da" +" páxina." #. i18n: ectx: label, entry (igBottom), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:253 #, kde-format msgid "Set preferred figure position to bottom of page." -msgstr "Indicar que a posición preferida para as figuras sexa a parte inferior da páxina." +msgstr "" +"Indicar que a posición preferida para as figuras sexa a parte inferior da" +" páxina." #. i18n: ectx: label, entry (igHere), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:257 #, kde-format msgid "Set preferred figure position to \"exactly here\" on page." -msgstr "Indicar que a posición preferida para as figuras sexa «exactamente aquí» na páxina." +msgstr "" +"Indicar que a posición preferida para as figuras sexa «exactamente aquí» na" +" páxina." #. i18n: ectx: label, entry (igPage), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:261 #, kde-format msgid "Set preferred figure position to be on separate page." -msgstr "Indicar que a posición preferida para as figuras sexa nunha páxina separada." +msgstr "" +"Indicar que a posición preferida para as figuras sexa nunha páxina separada." #. i18n: ectx: label, entry (igForce), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:265 #, kde-format msgid "Force figure position." msgstr "Forzar a colocación das figuras." #. i18n: ectx: label, entry (igWrapFigure), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:269 #, kde-format msgid "Enable the wrapfigure environment." msgstr "Activar o ambiente de rodeo de figura." #. i18n: ectx: label, entry (igWrapRight), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:273 #, kde-format msgid "Set preferred wrapfigure position to the right of text." -msgstr "Indicar que a posición preferida para o rodeo das figuras sexa á dereita do texto." +msgstr "" +"Indicar que a posición preferida para o rodeo das figuras sexa á dereita do" +" texto." #. i18n: ectx: label, entry (igWrapLeft), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:277 #, kde-format msgid "Set preferred wrapfigure position to the left of text." -msgstr "Indicar que a posición preferida para o rodeo das figuras sexa á esquerda do texto." +msgstr "" +"Indicar que a posición preferida para o rodeo das figuras sexa á esquerda do" +" texto." #. i18n: ectx: label, entry (igWrapInside), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:281 #, kde-format msgid "Set preferred wrapfigure position to the inside of the page." -msgstr "Indicar que a posición preferida para o rodeo das figuras sexa dentro da páxina." +msgstr "" +"Indicar que a posición preferida para o rodeo das figuras sexa dentro da" +" páxina." #. i18n: ectx: label, entry (igWrapOutside), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:285 #, kde-format msgid "Set preferred wrapfigure position to the outside of the page." -msgstr "Indicar que a posición preferida para o rodeo das figuras sexa fóra da páxina." +msgstr "" +"Indicar que a posición preferida para o rodeo das figuras sexa fóra da páxina." #. i18n: ectx: label, entry (igWrapFloat), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:289 #, kde-format msgid "Allow wrapped figures to float." msgstr "Permitir que as figuras rodeadas flutúen." #. i18n: ectx: label, entry (imagemagick), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:293 #, kde-format msgid "Whether ImageMagick is installed." msgstr "Indica se ImageMagick está instalado." #. i18n: ectx: label, entry (boundingbox), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:297 #, kde-format msgid "Try to determine the bounding box from the picture." msgstr "Intentar determinar a caixa contedora a partir da imaxe." #. i18n: ectx: label, entry (resolution), group (IncludeGraphics) #. +> trunk5 #: kile.kcfg:301 #, kde-format msgid "The default image resolution." msgstr "A resolución predeterminada da imaxe." #. i18n: ectx: label, entry (location), group (Help) #. +> trunk5 #: kile.kcfg:307 #, kde-format msgid "Location of the TeX documentation." msgstr "Localización da documentación de TeX." #. i18n: ectx: label, entry (kilerefs), group (Help) #. +> trunk5 #: kile.kcfg:311 #, kde-format msgid "Use the Kile LaTeX reference for the contextual help." msgstr "Empregar a referencia de LaTeX de Kile para a axuda contextual." #. i18n: ectx: label, entry (latex2erefs), group (Help) #. +> trunk5 #: kile.kcfg:315 #, kde-format msgid "Use the system's TexLive LaTeX2e reference for the contextual help." msgstr "Empregar a referencia de LaTeX2 de TexLive para a axuda contextual." #. i18n: ectx: label, entry (texrefs), group (Help) #. +> trunk5 #: kile.kcfg:319 #, kde-format msgid "Use the system's TeX reference for the contextual help (older version)." -msgstr "Empregar a referencia de Tex do sistema para a axuda contextual (versión antiga)." +msgstr "" +"Empregar a referencia de Tex do sistema para a axuda contextual (versión" +" antiga)." #. i18n: ectx: label, entry (external), group (Help) #. +> trunk5 #: kile.kcfg:323 #, kde-format msgid "Use an external viewer for user help." msgstr "Empregar un visor externo para a axuda do usuario." #. i18n: ectx: label, entry (Restore), group (Files) #. +> trunk5 #: kile.kcfg:329 #, kde-format msgid "Reopen files and projects on startup." msgstr "Abrir os ficheiros e proxectos ao inicio." #. i18n: ectx: label, entry (CleanUpAfterClose), group (Files) #. +> trunk5 #: kile.kcfg:333 #, kde-format msgid "Automatically clean-up files after close." msgstr "Limpar automaticamente os ficheiros despois de pechar." #. i18n: ectx: label, entry (CleanUpFileExtensions), group (Files) #. +> trunk5 #: kile.kcfg:337 #, kde-format msgid "The file extensions to clean on exit." msgstr "As extensións de ficheiro para limpar ao saír." #. i18n: ectx: label, entry (showLaTeXFilesOnly), group (Files) #. +> trunk5 #: kile.kcfg:349 #, kde-format msgid "Only show LaTeX files in the file browser widget" msgstr "Só mostrar ficheiros LaTeX no trebello de navegador de ficheiros" #. i18n: ectx: label, entry (Author), group (User) #. +> trunk5 #: kile.kcfg:359 #, kde-format msgid "The Author template variable." msgstr "A variábel Autor do modelo." #. i18n: ectx: label, entry (DocumentClassOptions), group (User) #. +> trunk5 #: kile.kcfg:363 #, kde-format msgid "The Documentclass template variable." msgstr "A variábel Clase de documento do modelo." #. i18n: ectx: label, entry (TemplateEncoding), group (User) #. +> trunk5 #: kile.kcfg:367 #, kde-format msgid "The Input encoding template variable." msgstr "A variábel Codificación da entrada do modelo." #. i18n: ectx: label, entry (DefaultProjectLocation), group (User) #. +> trunk5 #: kile.kcfg:371 #, kde-format msgid "The default location where the projects must be created." msgstr "O lugar predeterminado onde se crearán os proxectos." #. i18n: ectx: label, entry (SyncConsoleDirWithTabs), group (User) #. +> trunk5 #: kile.kcfg:377 #, kde-format -msgid "Whether the current directory shown in the console is kept synchronized with the open tabs" -msgstr "Indicar se o directorio que se mostra na consola se mantén sincronizado coas lapelas abertas." +msgid "" +"Whether the current directory shown in the console is kept synchronized with" +" the open tabs" +msgstr "" +"Indicar se o directorio que se mostra na consola se mantén sincronizado coas" +" lapelas abertas." #. i18n: ectx: label, entry (WatchFileForDocumentViewer), group (User) #. +> trunk5 #: kile.kcfg:381 #, kde-format msgid "Whether the watch-file mode is enabled for the document viewer" -msgstr "Indicar se o modo de vixilancia de ficheiros se activa para o visor de documentos" +msgstr "" +"Indicar se o modo de vixilancia de ficheiros se activa para o visor de" +" documentos" #. i18n: ectx: label, entry (ShowFullPathInWindowTitle), group (User) #. +> trunk5 #: kile.kcfg:385 #, kde-format msgid "Whether to show the full path of file names in the window title." msgstr "Se mostrar a ruta completa dos ficheiros no título da xanela." #. i18n: ectx: label, entry (dvipng), group (QuickPreview) #. +> trunk5 #: kile.kcfg:453 #, kde-format msgid "Whether Dvipng is installed." msgstr "Indica se Dvipng está instalado." #. i18n: ectx: label, entry (convert), group (QuickPreview) #. +> trunk5 #: kile.kcfg:457 #, kde-format msgid "Whether Convert is installed." msgstr "Indica se Convert está instalado." #. i18n: ectx: label, entry (envPreviewInWidget), group (QuickPreview) #. +> trunk5 #: kile.kcfg:465 #, kde-format msgid "Show preview of environments in bottom bar." msgstr "Previsualizar os ambientes na barra do fondo." #. i18n: ectx: label, entry (selPreviewInWidget), group (QuickPreview) #. +> trunk5 #: kile.kcfg:469 #, kde-format msgid "Show preview of selected text in bottom bar." msgstr "Previsualizar o texto escollido na barra do fondo." #. i18n: ectx: label, entry (mathgroupPreviewInWidget), group (QuickPreview) #. +> trunk5 #: kile.kcfg:473 #, kde-format msgid "Show preview of mathgroups in bottom bar." msgstr "Previsualizar os grupos de matemáticas na barra do fondo." #. i18n: ectx: label, entry (envPreviewTool), group (QuickPreview) #. +> trunk5 #: kile.kcfg:477 #, kde-format msgid "Conversion tool for preview of environments in bottom bar." -msgstr "Ferramenta de conversión para previsualizar os ambientes na barra do fondo." +msgstr "" +"Ferramenta de conversión para previsualizar os ambientes na barra do fondo." #. i18n: ectx: label, entry (selPreviewTool), group (QuickPreview) #. +> trunk5 #: kile.kcfg:481 #, kde-format msgid "Conversion tool for preview of selected text in bottom bar." -msgstr "Ferramenta de conversión para previsualizar o texto escollido na barra do fondo." +msgstr "" +"Ferramenta de conversión para previsualizar o texto escollido na barra do" +" fondo." #. i18n: ectx: label, entry (mathgroupPreviewTool), group (QuickPreview) #. +> trunk5 #: kile.kcfg:485 #, kde-format msgid "Conversion tool for preview of mathgroups in bottom bar." -msgstr "Ferramenta de conversión para previsualizar os grupos de matemáticas na barra do fondo." +msgstr "" +"Ferramenta de conversión para previsualizar os grupos de matemáticas na barra" +" do fondo." #. i18n: ectx: label, entry (previewPaneBackgroundColor), group (QuickPreview) #. +> trunk5 #: kile.kcfg:489 #, kde-format msgid "The background color of the quick preview pane." msgstr "A cor de fondo do panel de visión rápida." #. i18n: ectx: label, entry (ScriptingEnabled), group (Scripting) #. +> trunk5 #: kile.kcfg:569 #, kde-format msgid "Enable the scripting support." msgstr "Activar a funcionalidade de scripts." #. i18n: ectx: label, entry (TimeLimitEnabled), group (Scripting) #. +> trunk5 #: kile.kcfg:573 #, kde-format msgid "Set a time limit for the execution of scripts." msgstr "Estabelecer un tempo-límite para a execución dos scripts." #. i18n: ectx: label, entry (TimeLimit), group (Scripting) #. +> trunk5 #: kile.kcfg:577 #, kde-format msgid "Time limit for the execution of scripts." msgstr "Tempo-límite para a execución dos scripts." #. i18n: ectx: label, entry (ScriptNameColumnWidth), group (Scripting) #. +> trunk5 #: kile.kcfg:581 #, kde-format -msgid "Width of the column containing the script name in the scripts management widget." -msgstr "Anchura da columna que contén o nome do script no trebello de xestión de scripts." +msgid "" +"Width of the column containing the script name in the scripts management" +" widget." +msgstr "" +"Anchura da columna que contén o nome do script no trebello de xestión de" +" scripts." #. i18n: ectx: label, entry (pdfWizardLastTask), group (PdfWizard) #. +> trunk5 #: kile.kcfg:587 #, kde-format msgid "Last task used by the PdfWizard." msgstr "Última tarefa empregada por PdfWizard." #. i18n: ectx: label, entry (numSymbolsMFUS), group (MostUsedSymbols) #. +> trunk5 #: kile.kcfg:593 #, kde-format msgid "Number of symbols to store in the Most Frequently Used Symbols view." msgstr "A cantidade de símbolos a gardar na vista dos símbolos frecuentes." #. i18n: ectx: label, entry (displayMFUS), group (MostUsedSymbols) #. +> trunk5 #: kile.kcfg:597 #, kde-format msgid "Display the Most Frequently Used Symbols view." msgstr "Mostrar a vista dos símbolos utilizados con máis frecuencia." #. i18n: ectx: label, entry (clearMFUS), group (MostUsedSymbols) #. +> trunk5 #: kile.kcfg:601 #, kde-format msgid "Clear the list of the most frequently used symbols whilst closing Kile." -msgstr "Limpar a lista dos símbolos utilizados con máis frecuencia cando se peche Kile." +msgstr "" +"Limpar a lista dos símbolos utilizados con máis frecuencia cando se peche" +" Kile." #. i18n: ectx: label, entry (symbolViewUTF8), group (MostUsedSymbols) #. +> trunk5 #: kile.kcfg:605 #, kde-format msgid "Should UTF-8 characters instead of commands be inserted" msgstr "Se se insiren caracteres de UTF-8 no canto de ordes" #. i18n: ectx: label, entry (userMenuFile), group (UserMenu) #. +> trunk5 #: kile.kcfg:611 #, kde-format msgid "XML file for the user menu" msgstr "Ficheiro en XML para o menú de usuario" #. i18n: ectx: label, entry (userMenuLocation), group (UserMenu) #. +> trunk5 #: kile.kcfg:615 #, kde-format -msgid "Use the main menubar (value 0) or the LaTeX menu (value 1) for the location of the user menu" -msgstr "Empregar a barra de menú principal (valor 0) ou o menú de LaTeX (valor 1) para o lugar no que se garda o menú de usuario" +msgid "" +"Use the main menubar (value 0) or the LaTeX menu (value 1) for the location" +" of the user menu" +msgstr "" +"Empregar a barra de menú principal (valor 0) ou o menú de LaTeX (valor 1)" +" para o lugar no que se garda o menú de usuario" #. i18n: ectx: label, entry (livePreviewEnabled), group (LivePreview) #. +> trunk5 #: kile.kcfg:621 #, kde-format msgid "Activate live preview functionality." msgstr "Activar a funcionalidade de previsualización ao vivo." #. i18n: ectx: label, entry (synchronizeCursorWithView), group (LivePreview) #. +> trunk5 #: kile.kcfg:625 #, kde-format msgid "Synchronize the cursor position with the view." msgstr "Sincronizar a posición do cursor coa vista." #. i18n: ectx: label, entry (previewEnabledForFreshlyOpenedDocuments), group (LivePreview) #. +> trunk5 #: kile.kcfg:629 #, kde-format msgid "Enable preview for freshly opened documents." msgstr "Activar a previsualización dos documentos abertos recentemente." #. i18n: ectx: label, entry (livePreviewCompilationDelay), group (LivePreview) #. +> trunk5 #: kile.kcfg:633 #, kde-format -msgid "Number of milliseconds after which the compilation is started when a change has occurred." -msgstr "Número de milisegundos a partir dos que comeza a compilación cando se produce un cambio." +msgid "" +"Number of milliseconds after which the compilation is started when a change" +" has occurred." +msgstr "" +"Número de milisegundos a partir dos que comeza a compilación cando se produce" +" un cambio." #. i18n: ectx: label, entry (livePreviewCompileOnlyAfterSaving), group (LivePreview) #. +> trunk5 #: kile.kcfg:637 #, kde-format msgid "Only compile documents after saving." msgstr "Só compilar os documentos cando se garden." #. +> trunk5 #: kileactions.cpp:337 #, kde-format msgid "&Label:" msgstr "&Etiqueta:" #. +> trunk5 #: kiledocmanager.cpp:92 #, kde-format msgid "No editor component found. Please check your KDE installation." -msgstr "Non foi posíbel atopar o compoñente do editor. Comprobe a instalación de KDE." +msgstr "" +"Non foi posíbel atopar o compoñente do editor. Comprobe a instalación de KDE." #. +> trunk5 #: kiledocmanager.cpp:93 #, kde-format msgid "No editor component found." msgstr "Non foi posíbel atopar o compoñente do editor." #. +> trunk5 #: kiledocmanager.cpp:144 #, kde-format msgid "" -"The internal structure of Kile is corrupted (probably due to a bug in Kile). Please select Save All from the File menu and close Kile.\n" -"The Kile team apologizes for any inconvenience and would appreciate a bug report." -msgstr "" -"A estrutura interna de Kile está corrupta (probabelmente debido a un fallo en Kile). Por favor escolla Gardar todo no menú Ficheiro e peche Kile.\n" -"O equipo de Kile descúlpase por calquera molestia e agradecerá que os informe do fallo." +"The internal structure of Kile is corrupted (probably due to a bug in Kile)." +" Please select Save All from the File menu and close Kile.\n" +"The Kile team apologizes for any inconvenience and would appreciate a bug" +" report." +msgstr "" +"A estrutura interna de Kile está corrupta (probabelmente debido a un fallo en" +" Kile). Por favor escolla Gardar todo no menú Ficheiro e peche Kile.\n" +"O equipo de Kile descúlpase por calquera molestia e agradecerá que os informe" +" do fallo." #. +> trunk5 #: kiledocmanager.cpp:536 #, kde-format msgid "" "The URL \"%1\" couldn't be opened.\n" "\n" "%2" msgstr "" "Non se puido abrir o URL «%1».\n" "\n" "%2" #. +> trunk5 #: kiledocmanager.cpp:537 kiledocmanager.cpp:540 #, kde-format msgid "Cannot open URL" msgstr "Non se pode abrir o URL." #. +> trunk5 #: kiledocmanager.cpp:540 #, kde-format msgid "The URL \"%1\" couldn't be opened." msgstr "Non se puido abrir o URL «%1»." #. +> trunk5 #: kiledocmanager.cpp:683 #, kde-format msgid "Could not find template: %1" msgstr "Non se puido atopar o modelo: %1" #. +> trunk5 #: kiledocmanager.cpp:683 #, kde-format msgid "File Not Found" msgstr "Non se atopou o ficheiro" #. +> trunk5 #: kiledocmanager.cpp:743 #, kde-format msgid "Please save the file first." msgstr "Garde antes o ficheiro." #. +> trunk5 #: kiledocmanager.cpp:748 #, kde-format msgid "Open/create a document first." msgstr "Abra/cree antes un documento." #. +> trunk5 #: kiledocmanager.cpp:756 #, kde-format msgid "A template for this type of document cannot be created." msgstr "Non se pode crear un modelo para este tipo de documento." #. +> trunk5 #: kiledocmanager.cpp:760 #, kde-format msgid "Create Template From Document" msgstr "Crear un modelo a partir do documento" #. +> trunk5 #: kiledocmanager.cpp:766 #, kde-format msgid "Remove Template" msgstr "Retirar o modelo" #. +> trunk5 #: kiledocmanager.cpp:825 #, kde-format msgid "Open Files" msgstr "Abrir ficheiros" #. +> trunk5 #: kiledocmanager.cpp:907 #, kde-format -msgid "Kile encountered problems while saving the file %1. Do you have enough free disk space left?" -msgstr "Kile atopouse con problemas ao gardar o ficheiro %1. Quédalle espazo libre de abondo no disco?" +msgid "" +"Kile encountered problems while saving the file %1. Do you have enough free" +" disk space left?" +msgstr "" +"Kile atopouse con problemas ao gardar o ficheiro %1. Quédalle espazo libre de" +" abondo no disco?" #. +> trunk5 #: kiledocmanager.cpp:908 #, kde-format msgid "Saving" msgstr "Estase a gardar" #. +> trunk5 #: kiledocmanager.cpp:941 #, kde-format msgid "Any files (*)" msgstr "Calquera ficheiro (*)" #. +> trunk5 #: kiledocmanager.cpp:943 #, kde-format msgid "Save Compiled Document As..." msgstr "Gardar o documento compilado como…" #. +> trunk5 #: kiledocmanager.cpp:968 #, kde-format msgid "" "The URL \"%1\" cannot be opened\n" "as it is a directory." msgstr "" "Non se pode abrir o URL «%1»\n" "porque é un directorio." #. +> trunk5 #: kiledocmanager.cpp:969 #, kde-format msgid "Cannot open directory" msgstr "Non se pode abrir o directorio." #. +> trunk5 #: kiledocmanager.cpp:1087 #, kde-format msgid "Save File" msgstr "Gardar o ficheiro" #. +> trunk5 #: kiledocmanager.cpp:1124 #, kde-format -msgid "A file with the name \"%1\" exists already. Do you want to overwrite it?" +msgid "" +"A file with the name \"%1\" exists already. Do you want to overwrite it?" msgstr "Xa existe un ficheiro co nome «%1». Quere substituílo?" #. +> trunk5 #: kiledocmanager.cpp:1125 #, kde-format msgid "Overwrite File?" msgstr "Desexa substituír o ficheiro?" #. +> trunk5 #: kiledocmanager.cpp:1301 #, kde-format msgid "Refresh Project Tree" msgstr "Actualizar a árbore do proxecto" #. +> trunk5 #: kiledocmanager.cpp:1309 #, kde-format -msgid "The current document is not associated to a project. Please activate a document that is associated to the project you want to build the tree for, then choose Refresh Project Tree again." -msgstr "O documento actual non está asociado a un proxecto. Por favor active un documento que estea asociado co proxecto do que queira construír a árbore, e logo escolla de novo Actualizar a árbore do proxecto." +msgid "" +"The current document is not associated to a project. Please activate a" +" document that is associated to the project you want to build the tree for," +" then choose Refresh Project Tree again." +msgstr "" +"O documento actual non está asociado a un proxecto. Por favor active un" +" documento que estea asociado co proxecto do que queira construír a árbore, e" +" logo escolla de novo Actualizar a árbore do proxecto." #. +> trunk5 #: kiledocmanager.cpp:1309 #, kde-format msgid "Could Not Refresh Project Tree" msgstr "Non se puido actualizar a árbore do proxecto" #. +> trunk5 #: kiledocmanager.cpp:1394 kiledocmanager.cpp:2161 kiledocmanager.cpp:2235 #: kiledocmanager.cpp:2272 #, kde-format msgid "Select Project" msgstr "Escoller un proxecto" #. +> trunk5 #: kiledocmanager.cpp:1419 kiledocmanager.cpp:1434 kiledocmanager.cpp:1441 #, kde-format msgid "Add to Project" msgstr "Engadir ao proxecto" #. +> trunk5 #: kiledocmanager.cpp:1433 #, kde-format msgid "The file %1 is already member of the project %2" msgstr "O ficheiro %1 xa é membro do proxecto %2" #. +> trunk5 #: kiledocmanager.cpp:1440 #, kde-format -msgid "The file %1 can not be added because it does not exist or is not readable" -msgstr "Non se pode engadir o ficheiro %1 porque ou non existe ou non é lexíbel" +msgid "" +"The file %1 can not be added because it does not exist or is not readable" +msgstr "" +"Non se pode engadir o ficheiro %1 porque ou non existe ou non é lexíbel" #. +> trunk5 #: kiledocmanager.cpp:1459 #, kde-format -msgid "This file is the project file, which holds all the information about your project. As such, it cannot be removed from the project." -msgstr "Este é o ficheiro do proxecto, que contén toda a información sobre este. Polo tanto non pode retirarse do proxecto." +msgid "" +"This file is the project file, which holds all the information about your" +" project. As such, it cannot be removed from the project." +msgstr "" +"Este é o ficheiro do proxecto, que contén toda a información sobre este. Polo" +" tanto non pode retirarse do proxecto." #. +> trunk5 #: kiledocmanager.cpp:1459 #, kde-format msgid "Cannot Remove File From Project" msgstr "Non se pode retirar o ficheiro do proxecto" #. +> trunk5 #: kiledocmanager.cpp:1527 #, kde-format msgid "" "

The project \"%1\" is already open.

" -"

If you wanted to reload the project, close the project before you re-open it.

" +"

If you wanted to reload the project, close the project before you re-open" +" it.

" msgstr "" "

O proxecto «%1» xa está aberto.

" " " "

Se quere recargar o proxecto, pécheo antes de abrilo de novo.

" #. +> trunk5 #: kiledocmanager.cpp:1529 #, kde-format msgid "Project Already Open" msgstr "Ese proxecto xa está aberto" #. +> trunk5 #: kiledocmanager.cpp:1539 #, kde-format msgid "" -"

The project file for the project \"%1\" does not exist or it is not readable.

" +"

The project file for the project \"%1\" does not exist or it is not" +" readable.

" "

Do you want to remove this project from the recent projects list?

" msgstr "" "

O ficheiro de proxecto do proxecto «%1» non existe ou non é lexíbel.

" " " "

Quere retirar este proxecto da lista de proxectos recentes?

" #. +> trunk5 #: kiledocmanager.cpp:1542 #, kde-format msgid "Could Not Open Project" msgstr "Non se puido abrir o proxecto" #. +> trunk5 #: kiledocmanager.cpp:1559 #, kde-format -msgid "

The file \"%1\" cannot be opened as it does not appear to be a project file.

" -msgstr "

Non se pode abrir o ficheiro «%1» porque non parece ser un ficheiro de proxecto.

" +msgid "" +"

The file \"%1\" cannot be opened as it does not appear to be a project" +" file.

" +msgstr "" +"

Non se pode abrir o ficheiro «%1» porque non parece ser un ficheiro de" +" proxecto.

" #. +> trunk5 #: kiledocmanager.cpp:1561 #, kde-format msgid "Impossible to Open Project File" msgstr "Non é posíbel abrir o ficheiro de proxecto" #. +> trunk5 #: kiledocmanager.cpp:1571 #, kde-format msgid "" "

The project \"%1\" cannot be opened as it was created
" "by a newer version of Kile.

" msgstr "" "

Non se pode abrir o proxecto «%1» porque se creou
" "cunha versión máis nova de Kile.

" #. +> trunk5 #: kiledocmanager.cpp:1573 #, kde-format msgid "Impossible to Open Project" msgstr "Non é posíbel abrir o proxecto" #. +> trunk5 #: kiledocmanager.cpp:1583 #, kde-format msgid "" "

The project file \"%1\" was created by a previous version of Kile.
" "It needs to be updated before it can be opened.

" "

Do you want to update it?

" msgstr "" "

O ficheiro de proxecto «%1» creouse cunha versión anterior de Kile.
" " Hai que actualizalo antes de poder abrilo.

" " " "

Quere actualizalo?

" #. +> trunk5 #: kiledocmanager.cpp:1586 #, kde-format msgid "Project File Needs to be Updated" msgstr "Hai que actualizar o ficheiro do proxecto" #. +> trunk5 #: kiledocmanager.cpp:1592 #, kde-format msgid "" "

The project file \"%1\" could be not updated.

" "

Do you want to remove this project from the recent projects list?

" msgstr "" "

Non foi posíbel actualizar o ficheiro de proxecto «%1».

" " " "

Quere retirar o proxecto da lista de proxectos recentes?

" #. +> trunk5 #: kiledocmanager.cpp:1594 #, kde-format msgid "Could Not Update Project File" msgstr "Non se puido actualizar o ficheiro de proxecto" #. +> trunk5 #: kiledocmanager.cpp:1695 #, kde-format msgid "Open Project" msgstr "Abrir un proxecto" #. +> trunk5 #: kiledocmanager.cpp:1714 #, kde-format msgid "Save Project" msgstr "Gardar o proxecto" #. +> trunk5 #: kiledocmanager.cpp:1766 #, kde-format -msgid "The current document is not associated to a project. Please activate a document that is associated to the project you want to save, then choose Save Project again." -msgstr "O documento actual non está asociado a un proxecto. Por favor active un documento que estea asociado ao proxecto que queira gardar, e entón garde o proxecto." +msgid "" +"The current document is not associated to a project. Please activate a" +" document that is associated to the project you want to save, then choose" +" Save Project again." +msgstr "" +"O documento actual non está asociado a un proxecto. Por favor active un" +" documento que estea asociado ao proxecto que queira gardar, e entón garde o" +" proxecto." #. +> trunk5 #: kiledocmanager.cpp:1766 #, kde-format msgid "Could Determine Active Project" msgstr "Foi posíbel determinar o proxecto activo" #. +> trunk5 #: kiledocmanager.cpp:1787 #, kde-format msgid "Add Files to Project" msgstr "Engadir ficheiros ao proxecto" #. +> trunk5 #: kiledocmanager.cpp:1800 #, kde-format msgid "Add Files" msgstr "Engadir ficheiros" #. +> trunk5 #: kiledocmanager.cpp:1803 #, kde-format msgid "Add" msgstr "Engadir" #. +> trunk5 #: kiledocmanager.cpp:1818 #, kde-format -msgid "There are no projects opened. Please open the project you want to add files to, then choose Add Files again." -msgstr "Non hai proxectos abertos. Por favor abra o proxecto no que queira engadir ficheiros, e entón escolla de novo Engadir ficheiros." +msgid "" +"There are no projects opened. Please open the project you want to add files" +" to, then choose Add Files again." +msgstr "" +"Non hai proxectos abertos. Por favor abra o proxecto no que queira engadir" +" ficheiros, e entón escolla de novo Engadir ficheiros." #. +> trunk5 #: kiledocmanager.cpp:1818 kiledocmanager.cpp:1853 #, kde-format msgid "Could Not Determine Active Project" msgstr "Non se puido determinar o proxecto activo" #. +> trunk5 #: kiledocmanager.cpp:1844 #, kde-format msgid "Project Options For" msgstr "Opcións do proxecto para" #. +> trunk5 #: kiledocmanager.cpp:1853 #, kde-format -msgid "The current document is not associated to a project. Please activate a document that is associated to the project you want to modify, then choose Project Options again." -msgstr "O documento actual non está asociado a un proxecto. Por favor active un documento que estea asociado ao proxecto que queira modificar, e entón escolla Opcións do proxecto de novo." +msgid "" +"The current document is not associated to a project. Please activate a" +" document that is associated to the project you want to modify, then choose" +" Project Options again." +msgstr "" +"O documento actual non está asociado a un proxecto. Por favor active un" +" documento que estea asociado ao proxecto que queira modificar, e entón" +" escolla Opcións do proxecto de novo." #. +> trunk5 #: kiledocmanager.cpp:1879 #, kde-format msgid "Close Project" msgstr "Pechar o proxecto" #. +> trunk5 #: kiledocmanager.cpp:1933 #, kde-format -msgid "The current document is not associated to a project. Please activate a document that is associated to the project you want to close, then choose Close Project again." -msgstr "O documento actual non está asociado a un proxecto. Por favor active un documento que estea asociado ao proxecto que queira pechar, e entón escolla de novo Pechar o proxecto." +msgid "" +"The current document is not associated to a project. Please activate a" +" document that is associated to the project you want to close, then choose" +" Close Project again." +msgstr "" +"O documento actual non está asociado a un proxecto. Por favor active un" +" documento que estea asociado ao proxecto que queira pechar, e entón escolla" +" de novo Pechar o proxecto." #. +> trunk5 #: kiledocmanager.cpp:1933 #, kde-format msgid "Could Not Close Project" msgstr "Non se puido pechar o proxecto" #. +> trunk5 #: kiledocmanager.cpp:1988 #, kde-format msgid "Nothing to clean for %1" msgstr "Nada que limpar en %1" #. +> trunk5 #: kiledocmanager.cpp:1998 #, kde-format msgid "Cleaning %1: %2" msgstr "Estase a limpar %1: %2" #. +> trunk5 #: kiledocmanager.cpp:2072 #, kde-format msgid "Switch Project" msgstr "Cambiar de proxecto" #. +> trunk5 #: kiledocmanager.cpp:2130 #, kde-format msgid "Select Files to Remove" msgstr "Escoller os ficheiros a retirar" #. +> trunk5 #: kiledocmanager.cpp:2143 kiledocmanager.cpp:2146 #, kde-format msgid "Show Project Files" msgstr "Mostrar os ficheiros do proxecto" #. +> trunk5 #: kiledocmanager.cpp:2143 kiledocmanager.cpp:2191 #, kde-format msgid "project configuration file" msgstr "ficheiro de configuración do proxecto" #. +> trunk5 #: kiledocmanager.cpp:2146 kiledocmanager.cpp:2194 #, kde-format msgid "graphics file" msgstr "ficheiro de gráficos" #. +> trunk5 #: kiledocmanager.cpp:2191 kiledocmanager.cpp:2194 #, kde-format msgid "Open All Project Files" msgstr "Abrir todos os ficheiros do proxecto" #. +> trunk5 #: kiledocmanager.cpp:2228 #, kde-format msgid "not opened: %1 (%2)" msgstr "non abertos: %1 (%2)" #. +> trunk5 #: kiledocmanager.cpp:2253 kiledocmanager.cpp:2290 #, kde-format msgid "Project Files" msgstr "Ficheiros do proxecto" #. +> trunk5 #: kiledocmanager.cpp:2261 kiledocmanager.cpp:2300 #, kde-format msgid "Could not determine the selected file." msgstr "Non se puido determinar o ficheiro escollido." #. +> trunk5 #: kiledocmanager.cpp:2261 kiledocmanager.cpp:2300 #, kde-format msgid "Project Error" msgstr "Erro do proxecto" #. +> trunk5 #: kiledocmanager.cpp:2367 #, kde-format msgid "Opening Project..." msgstr "Estase a abrir un proxecto…" #. +> trunk5 #: kiledocmanager.cpp:2370 #, kde-format msgid "Scanning project files..." msgstr "Estanse a analizar os ficheiros do proxecto…" #. +> trunk5 #: kileextensions.cpp:70 #, kde-format msgid "(La)TeX Source Files" msgstr "Ficheiros de fontes de (La)TeX" #. +> trunk5 #: kileextensions.cpp:74 #, kde-format msgid "(La)TeX Packages" msgstr "Paquetes de (La)TeX" #. +> trunk5 #: kileextensions.cpp:78 #, kde-format msgid "BibTeX Files" msgstr "Ficheiros BibTeX" #. +> trunk5 #: kileextensions.cpp:86 #, kde-format msgid "Metapost Files" msgstr "Ficheiros MetaPost" #. +> trunk5 #: kileextensions.cpp:90 #, kde-format msgid "Kile Script Files" msgstr "Ficheiros de script de Kile" #. +> trunk5 #: kileextensions.cpp:94 #, kde-format msgid "Kile Project Files" msgstr "Ficheiros de proxecto de Kile" #. +> trunk5 #: kileextensions.cpp:108 #, kde-format msgid "* |All Files" msgstr "* |Todos os ficheiros" #. +> trunk5 #: kileextensions.cpp:123 #, kde-format msgid "All Files (*)" msgstr "Todos os ficheiros (*)" #. +> trunk5 #: kilehelp.cpp:192 #, kde-format -msgid "Could not find the LaTeX documentation at %1; please set the correct path in Settings->Configure Kile->Help." -msgstr "Non se puido atopar a documentación de LaTeX en %1; escolla a ruta correcta en Configuración->Configurar Kile->Axuda." +msgid "" +"Could not find the LaTeX documentation at %1; please set the correct path in" +" Settings->Configure Kile->Help." +msgstr "" +"Non se puido atopar a documentación de LaTeX en %1; escolla a ruta correcta" +" en Configuración->Configurar Kile->Axuda." #. +> trunk5 #: kilehelp.cpp:323 #, kde-format msgid "No help available for %1." msgstr "Non hai axuda dispoñíbel para %1." #. +> trunk5 #: kileinfo.cpp:351 #, kde-format msgid "Undefined" msgstr "Non definido" #. +> trunk5 #: kileinfo.cpp:359 #, kde-format msgid "Script" msgstr "Script" #. +> trunk5 #: kilelauncher.cpp:112 #, kde-format msgid " output: \n" msgstr " saída: \n" #. +> trunk5 #: kilelauncher.cpp:223 #, kde-format msgid "terminated" msgstr "terminado" #. +> trunk5 #: kilelauncher.cpp:232 #, kde-format msgid "Launching failed, diagnostics:" msgstr "Fallou o inicio, diagnóstico:" #. +> trunk5 #: kilelauncher.cpp:237 #, kde-format msgid "An error occurred while parsing the options given to the tool." msgstr "Produciuse un erro ao analizar as opcións dadas á ferramenta." #. +> trunk5 #: kilelauncher.cpp:241 #, kde-format -msgid "Shell meta characters that cannot be handled are present in the options given to the tool." -msgstr "Hai meta-caracteres de intérprete de ordes presentes nas opcións dadas á ferramenta que non se poden xestionar." +msgid "" +"Shell meta characters that cannot be handled are present in the options given" +" to the tool." +msgstr "" +"Hai meta-caracteres de intérprete de ordes presentes nas opcións dadas á" +" ferramenta que non se poden xestionar." #. +> trunk5 #: kilelauncher.cpp:250 #, kde-format msgid "There is no executable named \"%1\" in your path." msgstr "Non hai ningún executábel chamado «%1» na súa ruta." #. +> trunk5 #: kilelauncher.cpp:256 #, kde-format msgid "You do not have permission to run %1." msgstr "Non ten permisos para executar %1." #. +> trunk5 #: kilelauncher.cpp:261 #, kde-format msgid "Diagnostics could not find any obvious problems." msgstr "Os diagnósticos non puideron atopar ningún problema evidente." #. +> trunk5 #: kilelauncher.cpp:282 #, kde-format msgid "finished with exit code %1" msgstr "finalizado co estado de saída %1" #. +> trunk5 #: kilelauncher.cpp:294 #, kde-format msgid "finished abruptly" msgstr "finalizado abruptamente" #. +> trunk5 #: kilelauncher.cpp:310 #, kde-format msgid "failed to start" msgstr "non se puido iniciar" #. +> trunk5 #: kilelauncher.cpp:313 #, kde-format msgid "crashed" msgstr "quebrou" #. +> trunk5 #: kilelauncher.cpp:316 #, kde-format msgid "failed (error code %1)" msgstr "fallou (código de erro %1)" #. +> trunk5 #: kilelauncher.cpp:357 #, kde-format msgid "The document viewer is not available" msgstr "O visor de documentos non está dispoñíbel" #. +> trunk5 #: kilelauncher.cpp:361 #, kde-format msgid "Please disable the live preview before launching this tool" msgstr "Desactive a previsualización ao vivo antes de iniciar esta ferramenta" #. +> trunk5 #: kilelyxserver.cpp:240 #, kde-format msgid "Cite" msgstr "Cita" #. +> trunk5 #: kilelyxserver.cpp:243 #, kde-format msgid "Add BibTeX database" msgstr "Engadir unha base de datos BibTeX" #. +> trunk5 #: kilelyxserver.cpp:246 #, kde-format msgid "Paste" msgstr "Pegar" #. +> trunk5 #: kilestdactions.cpp:30 #, kde-format msgid "Document Class Selection - \\documentclass{}" msgstr "Selección da clase do documento - \\documentclass{}" #. +> trunk5 #: kilestdactions.cpp:31 #, kde-format msgid "" "\\documentclass[options]{class}\n" "class : article,report,book,letter\n" "size options : 10pt, 11pt, 12pt\n" -"paper size options: a4paper, a5paper, b5paper, letterpaper, legalpaper, executivepaper\n" +"paper size options: a4paper, a5paper, b5paper, letterpaper, legalpaper," +" executivepaper\n" "other options: \n" "landscape -- selects landscape format; default is portrait. \n" "titlepage, notitlepage -- selects if there should be a separate title page.\n" -"leqno -- display equation number on left side of equations; default is right side.\n" +"leqno -- display equation number on left side of equations; default is right" +" side.\n" "fleqn -- display formulae flush left; default is centered.\n" "onecolumn, twocolumn -- one or two columns; defaults to one column\n" "oneside, twoside -- selects one- or two-sided layout.\n" msgstr "" "\\documentclass[opcións]{clase}\n" "clases: article,report,book,letter\n" "opcións de tamaño : 10pt, 11pt, 12pt\n" -"opcións de tamaño do papel: a4paper, a5paper, b5paper, letterpaper, legalpaper, executivepaper\n" +"opcións de tamaño do papel: a4paper, a5paper, b5paper, letterpaper," +" legalpaper, executivepaper\n" "outras opcións: \n" "landscape -- escolle o formato apaisado; o predeterminado é o natural. \n" -"titlepage, notitlepage -- escolle se haberá unha páxina a parte para o título.\n" -"leqno -- mostrar o número da ecuación ao lado esquerdo das ecuacións; de maneira predeterminada é no lado dereito.\n" -"fleqn -- mostra as fórmulas axustadas á esquerda; o predeterminado é o centrado.\n" -"onecolumn, twocolumn -- unha ou dúas columnas; de maneira predeterminada úsase unha columna\n" +"titlepage, notitlepage -- escolle se haberá unha páxina a parte para o" +" título.\n" +"leqno -- mostrar o número da ecuación ao lado esquerdo das ecuacións; de" +" maneira predeterminada é no lado dereito.\n" +"fleqn -- mostra as fórmulas axustadas á esquerda; o predeterminado é o" +" centrado.\n" +"onecolumn, twocolumn -- unha ou dúas columnas; de maneira predeterminada" +" úsase unha columna\n" "oneside, twoside -- escolle disposición a unha ou dúas-caras.\n" #. +> trunk5 #: kilestdactions.cpp:35 #, kde-format msgid "Package Import - \\usepackage{}" msgstr "Importación de paquete - \\usepackage{}" #. +> trunk5 #: kilestdactions.cpp:35 #, kde-format msgid "Package Import" msgstr "Importación de paquete" #. +> trunk5 #: kilestdactions.cpp:36 #, kde-format msgid "" -"Any options given in the \\documentclass command that are unknown by the selected document class\n" +"Any options given in the \\documentclass command that are unknown by the" +" selected document class\n" "are passed on to the packages loaded with \\usepackage." msgstr "" -"Calquera opción pasada á orde \\documentclass que clase de documento escollida\n" +"Calquera opción pasada á orde \\documentclass que clase de documento" +" escollida\n" "non coñeza pasarase aos paquetes cargados con \\usepackage." #. +> trunk5 #: kilestdactions.cpp:39 #, kde-format msgid "AMS Packages" msgstr "Paquetes da AMS" #. +> trunk5 #: kilestdactions.cpp:39 #, kde-format msgid "The principal American Mathematical Society packages" msgstr "Os paquetes principais da Sociedade Matemática Americana" #. +> trunk5 #: kilestdactions.cpp:40 #, kde-format msgid "Start Document Body - \\begin{document}" msgstr "Iniciar o corpo do documento - \\begin{document}" #. +> trunk5 #: kilestdactions.cpp:40 #, kde-format msgid "Start Document Body" msgstr "Iniciar o corpo do documento" #. +> trunk5 #: kilestdactions.cpp:40 #, kde-format msgid "" "Text is allowed only between \\begin{document} and \\end{document}.\n" "The 'preamble' (before \\begin{document} ) may contain declarations only." msgstr "" "Só se permite texto entre \\begin{document} e \\end{document}.\n" "O preámbulo (antes de \\begin{document}} ) só pode conter declaracións." #. +> trunk5 #: kilestdactions.cpp:41 #, kde-format msgid "Generate Title - \\maketitle" msgstr "Xerar o título - \\maketitle" #. +> trunk5 #: kilestdactions.cpp:41 #, kde-format msgid "Generate Title" msgstr "Xerar o título" #. +> trunk5 #: kilestdactions.cpp:41 #, kde-format msgid "" "This command generates a title on a separate title page\n" -"- except in the article class, where the title normally goes at the top of the first page." +"- except in the article class, where the title normally goes at the top of" +" the first page." msgstr "" "Esta orde xera un título nunha páxina de título separada,\n" -"excepto na clase artigo, onde o título normalmente vai na parte de riba da primeira páxina." +"excepto na clase artigo, onde o título normalmente vai na parte de riba da" +" primeira páxina." #. +> trunk5 #: kilestdactions.cpp:42 #, kde-format msgid "Table of Contents - \\tableofcontents" msgstr "Índice - \\tableofcontents" #. +> trunk5 #: kilestdactions.cpp:42 #, kde-format msgid "Put this command where you want the table of contents to go" msgstr "Poña esta orde onde queira que vaia o índice" #. +> trunk5 #: kilestdactions.cpp:43 #, kde-format msgid "Title Definition - \\title{}" msgstr "Definición de título - \\title{}" #. +> trunk5 #: kilestdactions.cpp:43 #, kde-format msgid "Title Definition" msgstr "Definición de título" #. +> trunk5 #: kilestdactions.cpp:43 #, kde-format msgid "" "\\title{text}\n" "The \\title command declares text to be the title.\n" "Use \\\\ to tell LaTeX where to start a new line in a long title." msgstr "" "\\title{texto}\n" "A orde \\title declara o texto do título.\n" "Use \\\\ para indicarlle a LaTeX onde empezar unha nova liña nun título longo." #. +> trunk5 #: kilestdactions.cpp:44 #, kde-format msgid "Author Definition - \\author{}" msgstr "Definición de autor - \\author{}" #. +> trunk5 #: kilestdactions.cpp:44 #, kde-format msgid "Author Definition" msgstr "Definición do autor" #. +> trunk5 #: kilestdactions.cpp:44 #, kde-format msgid "" "\\author{names}\n" -"The \\author command declares the author(s), where names is a list of authors separated by \\and commands." +"The \\author command declares the author(s), where names is a list of authors" +" separated by \\and commands." msgstr "" "\\author{nome}\n" -"A orde \\author declara o(s) autor(es), onde os nomes dunha lista de autores son separadas por ordes \\and." +"A orde \\author declara o(s) autor(es), onde os nomes dunha lista de autores" +" son separadas por ordes \\and." #. +> trunk5 #: kilestdactions.cpp:46 #, kde-format msgid "Center - \\begin{center}" msgstr "Centrado - \\begin{center}" #. +> trunk5 #: kilestdactions.cpp:46 kilestdactions.cpp:47 kilestdactions.cpp:48 #, kde-format msgid "Each line must be terminated with the string \\\\." msgstr "Cada liña debe terminar coa cadea \\\\." #. +> trunk5 #: kilestdactions.cpp:47 #, kde-format msgid "Align Left - \\begin{flushleft}" msgstr "Aliñar á esquerda - \\begin{flushleft}" #. +> trunk5 #: kilestdactions.cpp:48 #, kde-format msgid "Align Right - \\begin{flushright}" msgstr "Aliñar á dereita - \\begin{flushright}" #. +> trunk5 #: kilestdactions.cpp:49 #, kde-format msgid "Quote - \\begin{quote}" msgstr "Cita - \\begin{quote}" #. +> trunk5 #: kilestdactions.cpp:49 #, kde-format msgid "Quote" msgstr "Cita" #. +> trunk5 #: kilestdactions.cpp:49 #, kde-format msgid "" "The text is justified at both margins.\n" "Leaving a blank line between text produces a new paragraph." msgstr "" "O texto é xustificado por ambas as marxes.\n" "Se deixa unha liña en branco entre o texto iniciará un parágrafo novo." #. +> trunk5 #: kilestdactions.cpp:50 #, kde-format msgid "Quotation - \\begin{quotation}" msgstr "Cita - \\begin{quotation}" #. +> trunk5 #: kilestdactions.cpp:50 #, kde-format msgid "Quotation" msgstr "Cita" #. +> trunk5 #: kilestdactions.cpp:50 #, kde-format msgid "" "The text is justified at both margins and there is paragraph indentation.\n" "Leaving a blank line between text produces a new paragraph." msgstr "" "O texto é xustificado por ambas marxes e hai sangrado do parágrafo.\n" "Se deixa unha liña en branco entre o texto producirá un novo parágrafo." #. +> trunk5 #: kilestdactions.cpp:51 #, kde-format msgid "Verse - \\begin{verse}" msgstr "Estrofa - \\begin{verse}" #. +> trunk5 #: kilestdactions.cpp:51 #, kde-format msgid "Verse" msgstr "Estrofa" #. +> trunk5 #: kilestdactions.cpp:51 #, kde-format msgid "" "The verse environment is designed for poetry.\n" -"Separate the lines of each stanza with \\\\, and use one or more blank lines to separate the stanzas." +"Separate the lines of each stanza with \\\\, and use one or more blank lines" +" to separate the stanzas." msgstr "" "O ambiente Estrofa está deseñado para a poesía.\n" -"Separa as liñas de cada estrofa con \\\\, e usa unha ou máis liñas en branco para separar as estrofas." +"Separa as liñas de cada estrofa con \\\\, e usa unha ou máis liñas en branco" +" para separar as estrofas." #. +> trunk5 #: kilestdactions.cpp:53 #, kde-format msgid "Verbatim - \\begin{verbatim}" msgstr "Copia literal - \\begin{verbatim}" #. +> trunk5 #: kilestdactions.cpp:53 #, kde-format msgid "Environment that gets LaTeX to print exactly what you type in." msgstr "Ambiente LaTeX que imprime exactamente o que escriba." #. +> trunk5 #: kilestdactions.cpp:54 #, kde-format msgid "Bulleted List - \\begin{itemize}" msgstr "Lista con viñetas - \\begin{itemize}" #. +> trunk5 #: kilestdactions.cpp:54 #, kde-format msgid "Bulleted List" msgstr "Lista con viñetas" #. +> trunk5 #: kilestdactions.cpp:54 #, kde-format msgid "" "The itemize environment produces a 'bulleted' list.\n" "Each item of an itemized list begins with an \\item command." msgstr "" "O ambiente itemize produce unha lista con viñetas.\n" "Cada elemento dunha lista itemize comeza cunha orde \\item." #. +> trunk5 #: kilestdactions.cpp:55 #, kde-format msgid "Enumeration - \\begin{enumerate}" msgstr "Enumeración - \\begin{enumerate}" #. +> trunk5 #: kilestdactions.cpp:55 #, kde-format msgid "Enumeration" msgstr "Enumeración" #. +> trunk5 #: kilestdactions.cpp:55 #, kde-format msgid "" "The enumerate environment produces a numbered list.\n" "Each item of an enumerated list begins with an \\item command." msgstr "" "O ambiente enumerate produce unha lista numerada.\n" "Cada elemento dunha lista enumerada comeza cunha orde \\item." #. +> trunk5 #: kilestdactions.cpp:56 #, kde-format msgid "Description - \\begin{description}" msgstr "Descrición - \\begin{description}" #. +> trunk5 #: kilestdactions.cpp:56 #, kde-format msgid "" "The description environment is used to make labeled lists.\n" "Each item of the list begins with an \\item[label] command.\n" "The 'label' is bold face and flushed right." msgstr "" "O ambiente descrición é usado para facer listas etiquetadas.\n" "Cada elemento da lista comeza cunha orde \\item[label].\n" "O «label» é un texto en letra grosa vertido á dereita." #. +> trunk5 #: kilestdactions.cpp:58 #, kde-format msgid "Table - \\begin{table}" msgstr "Táboa - \\begin{table}" #. +> trunk5 #: kilestdactions.cpp:59 #, kde-format msgid "" "\\begin{table}[placement]\n" "body of the table\n" "\\caption{table title}\n" "\\end{table}\n" -"Tables are objects that are not part of the normal text, and are usually floated to a convenient place.\n" -"The optional argument [placement] determines where LaTeX will try to place your table\n" +"Tables are objects that are not part of the normal text, and are usually" +" floated to a convenient place.\n" +"The optional argument [placement] determines where LaTeX will try to place" +" your table\n" "h : Here - at the position in the text where the table environment appears\n" "t : Top - at the top of a text page\n" "b : Bottom - at the bottom of a text page\n" -"p : Page of floats - on a separate float page, which is a page containing no text, only floats.\n" -"The body of the table is made up of whatever text or LaTeX commands, etc., you wish.\n" +"p : Page of floats - on a separate float page, which is a page containing no" +" text, only floats.\n" +"The body of the table is made up of whatever text or LaTeX commands, etc.," +" you wish.\n" "The \\caption command allows you to title your table." msgstr "" "\\begin{táboa}[emprazamento]\n" "corpo da táboa\n" "\\caption{título da táboa}\n" "\\end{táboa}\n" -"As táboas son obxectos que non son parte do texto normal e normalmente desprázanse ata un lugar axeitado.\n" -"O argumento opcional [emprazamento] determina onde LaTeX intentará colocar a sua táboa\n" +"As táboas son obxectos que non son parte do texto normal e normalmente" +" desprázanse ata un lugar axeitado.\n" +"O argumento opcional [emprazamento] determina onde LaTeX intentará colocar a" +" sua táboa\n" "h : Here - na posición do texto na que apareza o ambiente da táboa\n" "t: Top - na parte superior da páxina do texto\n" -"p : Page of floats - nunha páxina flutuante separada, que é unha páxina que non contén texto, só flutuantes\n" -"O corpo da táboa componse dun texto calquera, ordes LaTeX, etc., o que desexe.\n" +"p : Page of floats - nunha páxina flutuante separada, que é unha páxina que" +" non contén texto, só flutuantes\n" +"O corpo da táboa componse dun texto calquera, ordes LaTeX, etc., o que" +" desexe.\n" "A orde \\caption permite titular a táboa." #. +> trunk5 #: kilestdactions.cpp:63 #, kde-format msgid "Figure - \\begin{figure}" msgstr "Figura - \\begin{figure}" #. +> trunk5 #: kilestdactions.cpp:64 #, kde-format msgid "" "\\begin{figure}[placement]\n" "body of the figure\n" "\\caption{figure title}\n" "\\end{figure}\n" -"Figures are objects that are not part of the normal text, and are usually floated to a convenient place.\n" -"The optional argument [placement] determines where LaTeX will try to place your figure\n" +"Figures are objects that are not part of the normal text, and are usually" +" floated to a convenient place.\n" +"The optional argument [placement] determines where LaTeX will try to place" +" your figure\n" "h : Here - at the position in the text where the figure environment appears\n" "t : Top - at the top of a text page\n" "b : Bottom - at the bottom of a text page\n" -"p : Page of floats - on a separate float page, which is a page containing no text, only floats.\n" -"The body of the figure is made up of whatever text or LaTeX commands, etc., you wish.\n" +"p : Page of floats - on a separate float page, which is a page containing no" +" text, only floats.\n" +"The body of the figure is made up of whatever text or LaTeX commands, etc.," +" you wish.\n" "The \\caption command allows you to title your figure." msgstr "" "\\begin{figure}[emprazamento]\n" "corpo da figura\n" "\\caption{título da figura}\n" "\\end{figura}\n" -"As figuras son obxectos que non son parte do texto normal e normalmente desprázanse ata un lugar axeitado.\n" -"O argumento opcional [emprazamento] determina onde LaTeX intentará colocar a figura\n" +"As figuras son obxectos que non son parte do texto normal e normalmente" +" desprázanse ata un lugar axeitado.\n" +"O argumento opcional [emprazamento] determina onde LaTeX intentará colocar a" +" figura\n" "h : Here - na posición do texto na que apareza o ambiente da táboa\n" "t: Top - na parte superior da páxina do texto\n" -"p : Page of floats - nunha páxina flutuante separada, que é unha páxina que non contén texto, só flutuantes\n" -"O corpo da táboa componse dun texto calquera, ordes LaTeX, etc., o que desexe.\n" +"p : Page of floats - nunha páxina flutuante separada, que é unha páxina que" +" non contén texto, só flutuantes\n" +"O corpo da táboa componse dun texto calquera, ordes LaTeX, etc., o que" +" desexe.\n" "A orde \\caption permite titular a figura." #. +> trunk5 #: kilestdactions.cpp:68 #, kde-format msgid "Title Page - \\begin{titlepage}" msgstr "Páxina de título - \\begin{titlepage}" #. +> trunk5 #: kilestdactions.cpp:68 #, kde-format msgid "Title Page" msgstr "Páxina do título" #. +> trunk5 #: kilestdactions.cpp:69 #, kde-format msgid "" "\\begin{titlepage}\n" "text\n" "\\end{titlepage}\n" -"The titlepage environment creates a title page, i.e. a page with no printed page number or heading." +"The titlepage environment creates a title page, i.e. a page with no printed" +" page number or heading." msgstr "" "\\begin{titlepage}\n" "texto\n" "\\end{titlepage}\n" -"O ambiente titlepage crea unha páxina de título, é dicir unha páxina impresa sen número nin cabeceira." +"O ambiente titlepage crea unha páxina de título, é dicir unha páxina impresa" +" sen número nin cabeceira." #. +> trunk5 #: kilestdactions.cpp:71 #, kde-format msgid "Italics - \\textit{}" msgstr "Itálica - \\textit{}" #. +> trunk5 #: kilestdactions.cpp:71 #, kde-format msgid "Italics" msgstr "Itálica" #. +> trunk5 #: kilestdactions.cpp:71 #, kde-format msgid "\\textit{italic text}" msgstr "\\textit{texto en cursiva}" #. +> trunk5 #: kilestdactions.cpp:72 #, kde-format msgid "Slanted - \\textsl{}" msgstr "Inclinada - \\textsl{}" #. +> trunk5 #: kilestdactions.cpp:72 kilestdactions.cpp:213 #, kde-format msgid "Slanted" msgstr "Inclinada" #. +> trunk5 #: kilestdactions.cpp:72 #, kde-format msgid "\\textsl{slanted text}" msgstr "\\textsl{texto inclinado}" #. +> trunk5 #: kilestdactions.cpp:73 #, kde-format msgid "Boldface - \\textbf{}" msgstr "Letra grosa - \\textbf{}" #. +> trunk5 #: kilestdactions.cpp:73 #, kde-format msgid "Boldface" msgstr "Letra grosa" #. +> trunk5 #: kilestdactions.cpp:73 #, kde-format msgid "\\textbf{boldface text}" msgstr "\\textbf{texto en letra grosa}" #. +> trunk5 #: kilestdactions.cpp:74 #, kde-format msgid "Typewriter - \\texttt{}" msgstr "Escritura de máquina de escribir - \\texttt{}" #. +> trunk5 #: kilestdactions.cpp:74 #, kde-format msgid "Typewriter" msgstr "Escritura de máquina de escribir" #. +> trunk5 #: kilestdactions.cpp:74 #, kde-format msgid "\\texttt{typewriter text}" msgstr "\\texttt{texto en escritura de máquina de escribir}" #. +> trunk5 #: kilestdactions.cpp:75 #, kde-format msgid "Small Caps - \\textsc{}" msgstr "Versais - \\textsc{}" #. +> trunk5 #: kilestdactions.cpp:75 #, kde-format msgid "Small Caps" msgstr "Versais" #. +> trunk5 #: kilestdactions.cpp:75 #, kde-format msgid "\\textsc{small caps text}" msgstr "\\textsc{texto en versal}" #. +> trunk5 #: kilestdactions.cpp:76 #, kde-format msgid "\\item[label] Hello!" msgstr "\\item[etiqueta] Olá!" #. +> trunk5 #: kilestdactions.cpp:78 #, kde-format msgid "Tabbing - \\begin{tabbing}" msgstr "Tabulado - \\begin{tabbing}" #. +> trunk5 #: kilestdactions.cpp:78 #, kde-format msgid "" "The tabbing environment provides a way to align text in columns.\n" "\\begin{tabbing}\n" -"text \\= more text \\= still more text \\= last text \\\\\nsecond row \\> \\> more \\\\\n\\end{tabbing}\n" +"text \\= more text \\= still more text \\= last text \\\\\nsecond row \\> " +" \\> more \\\\\n\\end{tabbing}\n" "Commands :\n" "\\= Sets a tab stop at the current position.\n" "\\> Advances to the next tab stop.\n" -"\\< Allows you to put something to the left of the local margin without changing the margin. Can only be used at the start of the line.\n" -"\\+ Moves the left margin of the next and all the following commands one tab stop to the right\n" -"\\- Moves the left margin of the next and all the following commands one tab stop to the left\n" -"\\' Moves everything that you have typed so far in the current column to the right of the previous column, flush against the current column's tab stop. \n" -"\\` Allows you to put text flush right against any tab stop, including tab stop 0\n" +"\\< Allows you to put something to the left of the local margin without" +" changing the margin. Can only be used at the start of the line.\n" +"\\+ Moves the left margin of the next and all the following commands one tab" +" stop to the right\n" +"\\- Moves the left margin of the next and all the following commands one tab" +" stop to the left\n" +"\\' Moves everything that you have typed so far in the current column to the" +" right of the previous column, flush against the current column's tab stop. \n" +"\\` Allows you to put text flush right against any tab stop, including tab" +" stop 0\n" "\\kill Sets tab stops without producing text.\n" -"\\a In a tabbing environment, the commands \\=, \\' and \\` do not produce accents as normal. Instead, the commands \\a=, \\a' and \\a` are used." +"\\a In a tabbing environment, the commands \\=, \\' and \\` do not produce" +" accents as normal. Instead, the commands \\a=, \\a' and \\a` are used." msgstr "" "O ambiente tabbing fornece un xeito de aliñar o texto en columnas.\n" "\\begin{tabbing}\n" -"texto \\= máis texto \\= máis texto aínda \\= último texto \\\\\n segunda fila \\> \\> máis \\\\\n\\end{tabbing}\n" +"texto \\= máis texto \\= máis texto aínda \\= último texto \\\\\n segunda" +" fila \\> \\> máis \\\\\n\\end{tabbing}\n" "Ordes :\n" "\\= Pon una parada de tabulador na posición actual.\n" "\\> Avanza ata a seguinte parada de tabulador.\n" -"\\< Permite colocar algo á esquerda da marxe local sen cambiar a marxe. Pode usarse só ao inicio da liña.\n" -"\\+ Move a marxe esquerda de todas as ordes seguintes unha parada de tabulador á dereita.\n" -"\\- Move a marxe esquerda de todas as ordes seguintes unha parada de tabulador á esquerda\n" -"\\' Move todo o que escribiu máis aló da columna actual á dereita da columna anterior, xustifica contra a parada de tabulador da columna actual.\n" -"\\` Permite colocar texto xustificado á dereita contra calquera parada de tabulador, incluíndo a parada de tabulador 0\n" +"\\< Permite colocar algo á esquerda da marxe local sen cambiar a marxe." +" Pode usarse só ao inicio da liña.\n" +"\\+ Move a marxe esquerda de todas as ordes seguintes unha parada de" +" tabulador á dereita.\n" +"\\- Move a marxe esquerda de todas as ordes seguintes unha parada de" +" tabulador á esquerda\n" +"\\' Move todo o que escribiu máis aló da columna actual á dereita da columna" +" anterior, xustifica contra a parada de tabulador da columna actual.\n" +"\\` Permite colocar texto xustificado á dereita contra calquera parada de" +" tabulador, incluíndo a parada de tabulador 0\n" "\\kill Coloca as paradas de tabulador sen producir texto.\n" -"\\a Nun ambiente «tabbing», as ordes \\=, \\' e \\` non producen acentos do modo normal. No seu lugar, utilízanse as ordes \\a=, \\a' e \\a`." +"\\a Nun ambiente «tabbing», as ordes \\=, \\' e \\` non producen acentos do" +" modo normal. No seu lugar, utilízanse as ordes \\a=, \\a' e \\a`." #. +> trunk5 #: kilestdactions.cpp:79 #, kde-format msgid "Tabular - \\begin{tabular}" msgstr "Táboa - \\begin{tabular}" #. +> trunk5 #: kilestdactions.cpp:79 #, kde-format msgid "" "\\begin{tabular}[pos]{cols}\n" "column 1 entry & column 2 entry ... & column n entry \\\\\n...\n" "\\end{tabular}\n" -"pos : Specifies the vertical position; default is alignment on the center of the environment.\n" +"pos : Specifies the vertical position; default is alignment on the center of" +" the environment.\n" " t - align on top row\n" " b - align on bottom row\n" "cols : Specifies the column formatting.\n" " l - A column of left-aligned items.\n" " r - A column of right-aligned items.\n" " c - A column of centered items.\n" " | - A vertical line the full height and depth of the environment.\n" " @{text} - this inserts text in every row.\n" "The \\hline command draws a horizontal line the width of the table.\n" -"The \\cline{i-j} command draws horizontal lines across the columns specified, beginning in column i and ending in column j.\n" -"The \\vline command draws a vertical line extending the full height and depth of its row." +"The \\cline{i-j} command draws horizontal lines across the columns specified," +" beginning in column i and ending in column j.\n" +"The \\vline command draws a vertical line extending the full height and depth" +" of its row." msgstr "" "\\begin{tabular}[posición][columnas]\n" "columna 1 entrada & columna 2 entrada … & columna n entrada \\\\\n …\n" "\\end{tabular}\n" -"posición : Especifica a posición vertical; a predeterminada é o aliñamento ao centro do ambiente.\n" +"posición : Especifica a posición vertical; a predeterminada é o aliñamento ao" +" centro do ambiente.\n" " t - aliña na fila de enriba\n" " b - aliña na fila de abaixo\n" "columnas: Especifica o formato da columna\n" " l - A columna aliña os elementos a esquerda.\n" " r - A columna aliña os elementos a dereita.\n" " c - A columna aliña os elementos centrados\n" " | - Unha liña vertical coa altura e o fondo do ambiente.\n" " @{text} - insire texto en cada fila.\n" "A orde \\hline debuxa unha liña horizontal á anchura da táboa.\n" -"A orde \\cline{i-j}debuxa liñas horizontais a través das columnas especificadas, comezando na columna i e finalizando na columna j,\n" -"A orde \\vline debuxa unha liña vertical estendida á altura e fondo desta fila." +"A orde \\cline{i-j}debuxa liñas horizontais a través das columnas" +" especificadas, comezando na columna i e finalizando na columna j,\n" +"A orde \\vline debuxa unha liña vertical estendida á altura e fondo desta" +" fila." #. +> trunk5 #: kilestdactions.cpp:80 #, kde-format msgid "Multicolumn Cells - \\multicolumn" msgstr "Celas multi-columna - \\multicolumn" #. +> trunk5 #: kilestdactions.cpp:80 #, kde-format msgid "Multicolumn Cells" msgstr "Celas multi-columna" #. +> trunk5 #: kilestdactions.cpp:80 #, kde-format msgid "" "\\multicolumn{cols}{pos}{text}\n" "col, specifies the number of columns to span.\n" -"pos specifies the formatting of the entry: c for centered, l for flushleft, r for flushright.\n" +"pos specifies the formatting of the entry: c for centered, l for flushleft, r" +" for flushright.\n" "text specifies what text is to make up the entry." msgstr "" "\\multicolumn{columnas}{posición}{texto}\n" "columnas, especifica o número de columnas para o texto.\n" -"posición especifica o formato da entrada: c para centrado, l para verter á esquerda, r para verter á dereita.\n" +"posición especifica o formato da entrada: c para centrado, l para verter á" +" esquerda, r para verter á dereita.\n" "texto especifica que texto conterá a entrada." #. +> trunk5 #: kilestdactions.cpp:81 #, kde-format msgid "Horizontal Line - \\hline" msgstr "Liña horizontal - \\hline" #. +> trunk5 #: kilestdactions.cpp:81 #, kde-format msgid "Horizontal Line" msgstr "Liña horizontal" #. +> trunk5 #: kilestdactions.cpp:81 #, kde-format msgid "The \\hline command draws a horizontal line the width of the table." msgstr "A orde \\hline debuxa unha liña horizontal ao longo da táboa." #. +> trunk5 #: kilestdactions.cpp:82 #, kde-format msgid "Vertical Line - \\vline" msgstr "Liña vertical - \\vline" #. +> trunk5 #: kilestdactions.cpp:82 #, kde-format msgid "Vertical Line" msgstr "Liña vertical" #. +> trunk5 #: kilestdactions.cpp:82 #, kde-format -msgid "The \\vline command draws a vertical line extending the full height and depth of its row." -msgstr "A orde \\vline debuxa unha liña vertical estendida á altura e profundidade desta fila." +msgid "" +"The \\vline command draws a vertical line extending the full height and depth" +" of its row." +msgstr "" +"A orde \\vline debuxa unha liña vertical estendida á altura e profundidade" +" desta fila." #. +> trunk5 #: kilestdactions.cpp:83 #, kde-format msgid "Horizontal Line Across Columns - \\cline{m-n}" msgstr "Liña horizontal a través das columnas - \\cline{m-n}" #. +> trunk5 #: kilestdactions.cpp:83 #, kde-format msgid "Horizontal Line Across Columns" msgstr "Liña horizontal a través das columnas" #. +> trunk5 #: kilestdactions.cpp:83 #, kde-format -msgid "The \\cline{i-j} command draws horizontal lines across the columns specified, beginning in column i and ending in column j," -msgstr "A orde \\cline{i-j} debuxa liñas horizontais ao longo das columnas especificadas, comezando na columna i e finalizando na columna j," +msgid "" +"The \\cline{i-j} command draws horizontal lines across the columns specified," +" beginning in column i and ending in column j," +msgstr "" +"A orde \\cline{i-j} debuxa liñas horizontais ao longo das columnas" +" especificadas, comezando na columna i e finalizando na columna j," #. +> trunk5 #: kilestdactions.cpp:85 #, kde-format msgid "New Page - \\newpage" msgstr "Nova páxina - \\newpage" #. +> trunk5 #: kilestdactions.cpp:85 #, kde-format msgid "New Page" msgstr "Nova páxina" #. +> trunk5 #: kilestdactions.cpp:85 #, kde-format msgid "The \\newpage command ends the current page" msgstr "A orde \\newpage finaliza a páxina actual" #. +> trunk5 #: kilestdactions.cpp:86 #, kde-format msgid "Line Break - \\linebreak" msgstr "Quebra de liña - \\linebreak" #. +> trunk5 #: kilestdactions.cpp:86 #, kde-format msgid "Line Break" msgstr "Quebra de liña" #. +> trunk5 #: kilestdactions.cpp:86 #, kde-format -msgid "The \\linebreak command tells LaTeX to break the current line at the point of the command." -msgstr "A orde \\linebreak dille a LaTeX que quebre a liña actual no punto da orde." +msgid "" +"The \\linebreak command tells LaTeX to break the current line at the point of" +" the command." +msgstr "" +"A orde \\linebreak dille a LaTeX que quebre a liña actual no punto da orde." #. +> trunk5 #: kilestdactions.cpp:87 #, kde-format msgid "Page Break - \\pagebreak" msgstr "Quebra de páxina - \\pagebreak" #. +> trunk5 #: kilestdactions.cpp:87 #, kde-format msgid "Page Break" msgstr "Quebra de páxina" #. +> trunk5 #: kilestdactions.cpp:87 #, kde-format -msgid "The \\pagebreak command tells LaTeX to break the current page at the point of the command." -msgstr "A orde \\pagebreak dille a LaTeX que quebre a páxina actual no punto do orde." +msgid "" +"The \\pagebreak command tells LaTeX to break the current page at the point of" +" the command." +msgstr "" +"A orde \\pagebreak dille a LaTeX que quebre a páxina actual no punto do orde." #. +> trunk5 #: kilestdactions.cpp:88 #, kde-format msgid "\"Big\" Vertical Space - \\bigskip" msgstr "Espazo vertical «Grande» - \\bigskip" #. +> trunk5 #: kilestdactions.cpp:88 #, kde-format msgid "\"Big\" Vertical Space" msgstr "Espazo vertical «Grande»" #. +> trunk5 #: kilestdactions.cpp:88 #, kde-format msgid "The \\bigskip command adds a 'big' vertical space." msgstr "A orde \\bigskip engade un espazo vertical «grande»." #. +> trunk5 #: kilestdactions.cpp:89 #, kde-format msgid "\"Medium\" Vertical Space - \\medskip" msgstr "Espazo vertical «medio»" #. +> trunk5 #: kilestdactions.cpp:89 #, kde-format msgid "\"Medium\" Vertical Space" msgstr "Espazo vertical «medio»" #. +> trunk5 #: kilestdactions.cpp:89 #, kde-format msgid "The \\medskip command adds a 'medium' vertical space." msgstr "A orde \\medskip engade un espazo vertical «medio»." #. +> trunk5 #: kilestdactions.cpp:92 #, kde-format msgid "Image Insertion - \\includegraphics{file}" msgstr "Inserción de imaxe - \\includegraphics{file}" #. +> trunk5 #: kilestdactions.cpp:92 #, kde-format msgid "Image Insertion" msgstr "Inserción de imaxe" #. +> trunk5 #: kilestdactions.cpp:94 #, kde-format msgid "Customizable File Inclusion - \\include{file}" msgstr "Inclusión personalizábel de ficheiro - \\include{file}" #. +> trunk5 #: kilestdactions.cpp:94 #, kde-format msgid "Customizable File Inclusion" msgstr "Inclusión personalizábel de ficheiro" #. +> trunk5 #: kilestdactions.cpp:94 #, kde-format msgid "" "\\include{file}\n" -"The \\include command is used in conjunction with the \\includeonly command for selective inclusion of files." +"The \\include command is used in conjunction with the \\includeonly command" +" for selective inclusion of files." msgstr "" "\\include{ficheiro}\n" -"A orde \\include úsase en conxunción co orde \\includeonly para escoller ficheiros a incluír." +"A orde \\include úsase en conxunción co orde \\includeonly para escoller" +" ficheiros a incluír." #. +> trunk5 #: kilestdactions.cpp:94 kilestdactions.cpp:95 #, kde-format msgid "Type or select a filename: " msgstr "Escriba ou escolla un nome de ficheiro: " #. +> trunk5 #: kilestdactions.cpp:95 #, kde-format msgid "File Inclusion - \\input{file}" msgstr "Inclusión de ficheiro - \\input{file}" #. +> trunk5 #: kilestdactions.cpp:95 #, kde-format msgid "File Inclusion" msgstr "Inclusión de ficheiro" #. +> trunk5 #: kilestdactions.cpp:95 #, kde-format msgid "" "\\input{file}\n" -"The \\input command causes the indicated file to be read and processed, exactly as if its contents had been inserted in the current file at that point." +"The \\input command causes the indicated file to be read and processed," +" exactly as if its contents had been inserted in the current file at that" +" point." msgstr "" "\\input{ficheiro}\n" -"A orde \\input fai que o ficheiro indicado se lea e procese, como se o seu contido fose inserido no ficheiro actual nese punto." +"A orde \\input fai que o ficheiro indicado se lea e procese, como se o seu" +" contido fose inserido no ficheiro actual nese punto." #. +> trunk5 #: kilestdactions.cpp:97 widgets/structurewidget.cpp:763 #, kde-format msgid "Sectioning" msgstr "Estase a seccionar" #. +> trunk5 #: kilestdactions.cpp:99 #, kde-format msgid "" "\\part{title}\n" -"\\part*{title} : do not include a number and do not make an entry in the table of contents\n" +"\\part*{title} : do not include a number and do not make an entry in the" +" table of contents\n" msgstr "" "\\part{título}\n" "\\part*{título} ; non inclúe o número e non constrúa unha entrada no índice\n" #. +> trunk5 #: kilestdactions.cpp:99 #, kde-format msgid "&Part" msgstr "&Parte" #. +> trunk5 #: kilestdactions.cpp:99 kilestdactions.cpp:101 kilestdactions.cpp:102 #: kilestdactions.cpp:103 kilestdactions.cpp:104 kilestdactions.cpp:106 #: kilestdactions.cpp:107 #, kde-format msgid "No &numbering" msgstr "Sen &numeración" #. +> trunk5 #: kilestdactions.cpp:101 #, kde-format msgid "" "\\chapter{title}\n" -"\\chapter*{title} : do not include a number and do not make an entry in the table of contents\n" +"\\chapter*{title} : do not include a number and do not make an entry in the" +" table of contents\n" "Only for 'report' and 'book' class document." msgstr "" "\\chapter{título}\n" -"\\chapter*{título} : non inclúe o número e non constrúe unha entrada no índice\n" +"\\chapter*{título} : non inclúe o número e non constrúe unha entrada no" +" índice\n" "Só para as clases de documento «report» e «book»." #. +> trunk5 #: kilestdactions.cpp:101 #, kde-format msgid "C&hapter" msgstr "&Capítulo" #. +> trunk5 #: kilestdactions.cpp:102 #, kde-format msgid "" "\\section{title}\n" -"\\section*{title} : do not include a number and do not make an entry in the table of contents" +"\\section*{title} : do not include a number and do not make an entry in the" +" table of contents" msgstr "" "\\section{título}\n" "\\section*{título} : non inclúe o número e non constrúe unha entrada no índice" #. +> trunk5 #: kilestdactions.cpp:102 #, kde-format msgid "&Section" msgstr "&Sección" #. +> trunk5 #: kilestdactions.cpp:103 #, kde-format msgid "" "\\subsection{title}\n" -"\\subsection*{title} : do not include a number and do not make an entry in the table of contents" +"\\subsection*{title} : do not include a number and do not make an entry in" +" the table of contents" msgstr "" "\\subsection{título}\n" -"\\subsection*{título} : non inclúe o número e non constrúe unha entrada no índice" +"\\subsection*{título} : non inclúe o número e non constrúe unha entrada no" +" índice" #. +> trunk5 #: kilestdactions.cpp:103 #, kde-format msgid "&Subsection" msgstr "&Subsección" #. +> trunk5 #: kilestdactions.cpp:104 #, kde-format msgid "" "\\subsubsection{title}\n" -"\\subsubsection*{title} : do not include a number and do not make an entry in the table of contents" +"\\subsubsection*{title} : do not include a number and do not make an entry in" +" the table of contents" msgstr "" "\\subsubsection{título}\n" -"\\subsubsection*{título} : non inclúe o número e non constrúe unha entrada no índice" +"\\subsubsection*{título} : non inclúe o número e non constrúe unha entrada no" +" índice" #. +> trunk5 #: kilestdactions.cpp:104 #, kde-format msgid "&Subsubsection" msgstr "&Subsubsection" #. +> trunk5 #: kilestdactions.cpp:106 #, kde-format msgid "" "\\paragraph{title}\n" -"\\paragraph*{title} : do not include a number and do not make an entry in the table of contents" +"\\paragraph*{title} : do not include a number and do not make an entry in the" +" table of contents" msgstr "" "\\paragraph{título}\n" -"\\paragraph*{titulo} : non inclúe o número e non constrúe unha entrada no índice" +"\\paragraph*{titulo} : non inclúe o número e non constrúe unha entrada no" +" índice" #. +> trunk5 #: kilestdactions.cpp:106 #, kde-format msgid "&Paragraph" msgstr "&Parágrafo" #. +> trunk5 #: kilestdactions.cpp:107 #, kde-format msgid "" "\\subparagraph{title}\n" -"\\subparagraph*{title} : do not include a number and do not make an entry in the table of contents" +"\\subparagraph*{title} : do not include a number and do not make an entry in" +" the table of contents" msgstr "" "\\subparagraph{título}\n" -"\\subparagraph*{título} : non inclúe o número e non constrúe unha entrada no índice" +"\\subparagraph*{título} : non inclúe o número e non constrúe unha entrada no" +" índice" #. +> trunk5 #: kilestdactions.cpp:107 #, kde-format msgid "&Subparagraph" msgstr "&Subparágrafo" #. +> trunk5 #: kilestdactions.cpp:109 #, kde-format msgid "Size" msgstr "Tamaño" #. +> trunk5 #: kilestdactions.cpp:111 #, kde-format msgid "tiny" msgstr "anana" #. +> trunk5 #: kilestdactions.cpp:112 #, kde-format msgid "scriptsize" msgstr "tamaño do script" #. +> trunk5 #: kilestdactions.cpp:113 #, kde-format msgid "footnotesize" msgstr "tamaño da nota do rodapé" #. +> trunk5 #: kilestdactions.cpp:114 #, kde-format msgid "small" msgstr "pequeno" #. +> trunk5 #: kilestdactions.cpp:116 #, kde-format msgid "normalsize" msgstr "tamaño normal" #. +> trunk5 #: kilestdactions.cpp:118 #, kde-format msgid "large" msgstr "grande" #. +> trunk5 #: kilestdactions.cpp:119 #, kde-format msgid "Large" msgstr "Grande" #. +> trunk5 #: kilestdactions.cpp:120 #, kde-format msgid "LARGE" msgstr "GRANDE" #. +> trunk5 #: kilestdactions.cpp:121 #, kde-format msgid "huge" msgstr "xigante" #. +> trunk5 #: kilestdactions.cpp:122 #, kde-format msgid "Huge" msgstr "Xigante" #. +> trunk5 #: kilestdactions.cpp:124 widgets/projectview.cpp:464 #: widgets/toolconfigwidget.cpp:78 #, kde-format msgid "Other" msgstr "Outro" #. +> trunk5 #: kilestdactions.cpp:126 #, kde-format msgid "\\label{key}" msgstr "\\label{chave}" #. +> trunk5 #: kilestdactions.cpp:130 #, kde-format msgid "\\index{word}" msgstr "\\index{palabra}" #. +> trunk5 #: kilestdactions.cpp:131 #, kde-format msgid "\\footnote{text}" msgstr "\\footnote{texto}" #. +> trunk5 #: kilestdactions.cpp:133 #, kde-format msgid "" -"This command generates an in-text citation to the reference associated with the ref entry in the bib file\n" +"This command generates an in-text citation to the reference associated with" +" the ref entry in the bib file\n" "You can open the bib file with Kile to see all the available references" msgstr "" -"Esta orde xera unha citación no texto para a referencia asociada coa entrada da referencia no ficheiro bib\n" +"Esta orde xera unha citación no texto para a referencia asociada coa entrada" +" da referencia no ficheiro bib\n" "Pode abrir o ficheiro bib con Kile para ver todas as referencias dispoñíbeis" #. i18n("cite from ViewBib")); #. actionother_list->addAction(action); #. +> trunk5 #: kilestdactions.cpp:138 #, kde-format msgid "Underline - \\underline{}" msgstr "Subliñado - \\underline{}" #. +> trunk5 #: kilestdactions.cpp:141 #, kde-format msgid "Smart New Line" msgstr "Nova liña intelixente" #. +> trunk5 #: kilestdactions.cpp:146 #, kde-format msgid "Smart Tabulator" msgstr "Tabulador intelixente" #. +> trunk5 #: kilestdactions.cpp:153 #, kde-format msgid "Abstract - \\begin{abstract}" msgstr "Resumo - \\begin{abstract}" #. +> trunk5 #: kilestdactions.cpp:153 #, kde-format msgid "Abstract" msgstr "Resumo" #. +> trunk5 #: kilestdactions.cpp:153 #, kde-format msgid "" "\\begin{abstract}\n" "text\n" "\\end{abstract}\n" -"The abstract environment creates a title page, i.e. a page with no printed page number or heading." +"The abstract environment creates a title page, i.e. a page with no printed" +" page number or heading." msgstr "" "\\begin{abstract}\n" "texto\n" "\\end{abstract}\n" -"O ambiente abstract crea unha páxina de título, é dicir, unha páxina imprimida sen número nin cabeceira." +"O ambiente abstract crea unha páxina de título, é dicir, unha páxina" +" imprimida sen número nin cabeceira." #. +> trunk5 #: kilestdactions.cpp:155 #, kde-format msgid "Tabular* - \\begin{tabular*}" msgstr "Tabular* - \\begin{tabular*}" #. +> trunk5 #: kilestdactions.cpp:155 #, kde-format msgid "Tabular*" msgstr "Tabular*" #. +> trunk5 #: kilestdactions.cpp:155 #, kde-format msgid "" "\\begin{tabular*}{width}[pos]{cols}\n" "column 1 entry & column 2 entry ... & column n entry \\\\\n...\n" "\\end{tabular*}\n" -"This is an extended version of the tabular environment with an extra parameter for the width. There must be rubber space between columns that can stretch to fill out the specified width." +"This is an extended version of the tabular environment with an extra" +" parameter for the width. There must be rubber space between columns that can" +" stretch to fill out the specified width." msgstr "" "\\begin{tabular*}{width}[pos]{cols}\n" "entrada da columna 1 & entrada da columna 2 … & entrada da columna n\\\\\n…\n" "\\end{tabular*}\n" -"Esta é unha versión ampliada do ambiente tabular con parámetros extras para a anchura. Debe haber espazo de abondo entre columnas que se poden estender para conseguir a anchura especificada." +"Esta é unha versión ampliada do ambiente tabular con parámetros extras para a" +" anchura. Debe haber espazo de abondo entre columnas que se poden estender" +" para conseguir a anchura especificada." #. +> trunk5 #: kilestdactions.cpp:157 #, kde-format msgid "Minipage - \\begin{minipage}" msgstr "Minipáxina - \\begin{minipage}" #. +> trunk5 #: kilestdactions.cpp:157 #, kde-format msgid "Minipage" msgstr "Minipáxina" #. +> trunk5 #: kilestdactions.cpp:157 #, kde-format -msgid "The minipage environment is similar to a \\parbox command. It takes the same optional position argument and mandatory width argument. You may use other paragraph-making environments inside a minipage." -msgstr "O ambiente minipage é similar ao orde \\parbox. Colle o mesmo argumento de posición opcional e o argumento de anchura obrigatorio. Pode empregar outro parágrafo, facendo ambientes dentro da minipáxina." +msgid "" +"The minipage environment is similar to a \\parbox command. It takes the same" +" optional position argument and mandatory width argument. You may use other" +" paragraph-making environments inside a minipage." +msgstr "" +"O ambiente minipage é similar ao orde \\parbox. Colle o mesmo argumento de" +" posición opcional e o argumento de anchura obrigatorio. Pode empregar outro" +" parágrafo, facendo ambientes dentro da minipáxina." #. +> trunk5 #: kilestdactions.cpp:160 #, kde-format msgid "Table of Figures - \\listoffigures" msgstr "Lista de figuras - \\listoffigures" #. +> trunk5 #: kilestdactions.cpp:160 #, kde-format msgid "Table of Figures" msgstr "Lista de figuras" #. +> trunk5 #: kilestdactions.cpp:160 #, kde-format msgid "Put this command where you want the list of figures to go." msgstr "Poña esta orde onde queira que vaia a lista de figuras." #. +> trunk5 #: kilestdactions.cpp:162 #, kde-format msgid "Table of Tables - \\listoftables" msgstr "Lista de táboas - \\listoftables" #. +> trunk5 #: kilestdactions.cpp:162 #, kde-format msgid "Table of Tables" msgstr "Lista de táboas" #. +> trunk5 #: kilestdactions.cpp:162 #, kde-format msgid "Put this command where you want the list of tables to go." msgstr "Poña esta orde onde queira que vaia a lista de táboas." #. +> trunk5 #: kilestdactions.cpp:164 #, kde-format msgid "Generate Index - \\makeindex" msgstr "Xerar o índice de materias- \\makeindex" #. +> trunk5 #: kilestdactions.cpp:164 #, kde-format msgid "Generate Index" msgstr "Xerar o índice de materias" #. +> trunk5 #: kilestdactions.cpp:164 #, kde-format msgid "Put this command when you want to generate the raw index." msgstr "Poña esta orde onde queira que vaia o índice de materias cru." #. +> trunk5 #: kilestdactions.cpp:166 #, kde-format msgid "Print Index - \\printindex" msgstr "Imprimir o índice de materias- \\printindex" #. +> trunk5 #: kilestdactions.cpp:166 #, kde-format msgid "Print Index" msgstr "Imprimir o índice de materias" #. +> trunk5 #: kilestdactions.cpp:166 #, kde-format msgid "Put this command when you want to print the formatted index." msgstr "Poña esta orde onde queira imprimir o índice de materias formatado." #. +> trunk5 #: kilestdactions.cpp:168 #, kde-format msgid "Glossary - \\makeglossary" msgstr "Glosario - \\makeglosary" #. +> trunk5 #: kilestdactions.cpp:168 #, kde-format msgid "Glossary" msgstr "Glosario" #. +> trunk5 #: kilestdactions.cpp:168 #, kde-format msgid "Put this command when you want to print a glossary." msgstr "Poña esta orde onde queira imprimir o glosario." #. +> trunk5 #: kilestdactions.cpp:170 widgets/projectview.cpp:460 #, kde-format msgid "Bibliography" msgstr "Bibliografía" #. +> trunk5 #: kilestdactions.cpp:170 #, kde-format msgid "Bibliography - \\begin{thebibliography}" msgstr "Bibliografía - \\begin{thebibliography}" #. +> trunk5 #: kilestdactions.cpp:170 #, kde-format msgid "" "\\begin{thebibliography}{widest-label}\n" "\\bibitem[label]{cite_key}\n" "...\n" "\\end{thebibliography}\n" "\n" -"widest-label : Text that, when printed, is approximately as wide as the widest item label produces by the \\bibitem commands\n" +"widest-label : Text that, when printed, is approximately as wide as the" +" widest item label produces by the \\bibitem commands\n" "\\bibitem : Specify a bibliography item" msgstr "" "\\begin{thebibliography}{widest-label}\n" "\\bibitem[label]{cite_key}\n" "…\n" "\\end{thebibliography}\n" "\n" -"widest-label : Cando se imprima o texto será tan ancho como a etiqueta producida polos ordes \\bibitem\n" +"widest-label : Cando se imprima o texto será tan ancho como a etiqueta" +" producida polos ordes \\bibitem\n" "\\bibitem : Especifica un elemento da bibliografía" #. +> trunk5 #: kilestdactions.cpp:173 #, kde-format msgid "Verbatim (show spaces) - \\begin{verbatim*}" msgstr "Copia literal (mostrando espazos) - \\begin{verbatim*}" #. +> trunk5 #: kilestdactions.cpp:173 #, kde-format msgid "Verbatim (show spaces)" msgstr "Copia literal (mostrando espazos)" #. +> trunk5 #: kilestdactions.cpp:173 #, kde-format -msgid "Environment that gets LaTeX to print exactly what you type in. In this variant, spaces are printed in a special manner." -msgstr "Ambiente LaTeX que consegue imprimir exactamente o que escriba. Nesta variante, os espazos imprímense dun xeito especial." +msgid "" +"Environment that gets LaTeX to print exactly what you type in. In this" +" variant, spaces are printed in a special manner." +msgstr "" +"Ambiente LaTeX que consegue imprimir exactamente o que escriba. Nesta" +" variante, os espazos imprímense dun xeito especial." #. +> trunk5 #: kilestdactions.cpp:175 #, kde-format msgid "Embedded Code - \\verb||" msgstr "Código incorporado - \\verb||" #. +> trunk5 #: kilestdactions.cpp:175 #, kde-format msgid "Embedded Code" msgstr "Código incorporado" #. +> trunk5 #: kilestdactions.cpp:175 #, kde-format msgid "Macro form of the verbatim environment." msgstr "Forma macro do ambiente de copia literal." #. +> trunk5 #: kilestdactions.cpp:177 #, kde-format msgid "Embedded Code (show spaces) - \\verb*||" msgstr "Código incorporado (mostrando espazos) - \\verb*||" #. +> trunk5 #: kilestdactions.cpp:177 #, kde-format msgid "Embedded Code (show spaces)" msgstr "Código incorporado (mostrando espazos)" #. +> trunk5 #: kilestdactions.cpp:177 #, kde-format msgid "Macro form of the verbatim* environment." msgstr "Macroforma do ambiente verbatim*." #. +> trunk5 #: kilestdactions.cpp:180 #, kde-format msgid "\"Small\" Vertical Space - \\smallskip" msgstr "Espazo vertical «pequeno» - \\smallskip" #. +> trunk5 #: kilestdactions.cpp:180 #, kde-format msgid "\"Small\" Vertical Space" msgstr "Espazo vertical «pequeno»" #. +> trunk5 #: kilestdactions.cpp:180 #, kde-format msgid "The \\smallskip command adds a 'small' vertical space." msgstr "A orde \\smallskip engade un espazo vertical «pequeno»." #. +> trunk5 #: kilestdactions.cpp:182 #, kde-format msgid "\\enskip" msgstr "\\enskip" #. +> trunk5 #: kilestdactions.cpp:184 #, kde-format msgid "Horizontal Variable Space - \\hfill" msgstr "Espazo variábel horizontal - \\hfill" #. +> trunk5 #: kilestdactions.cpp:184 #, kde-format msgid "Horizontal Variable Space" msgstr "Espazo variábel horizontal" #. +> trunk5 #: kilestdactions.cpp:184 #, kde-format -msgid "The \\hfill fill command produces a \"rubber length\" which can stretch or shrink horizontally. It will be filled with spaces." -msgstr "A orde de recheo \\hfill produce unha «goma» que se pode estirar ou encoller horizontalmente. Encherase con espazos." +msgid "" +"The \\hfill fill command produces a \"rubber length\" which can stretch or" +" shrink horizontally. It will be filled with spaces." +msgstr "" +"A orde de recheo \\hfill produce unha «goma» que se pode estirar ou encoller" +" horizontalmente. Encherase con espazos." #. +> trunk5 #: kilestdactions.cpp:186 #, kde-format msgid "Horizontal Dots - \\dotfill" msgstr "Puntos horizontais - \\dotfill" #. +> trunk5 #: kilestdactions.cpp:186 #, kde-format msgid "Horizontal Dots" msgstr "Puntos horizontais" #. +> trunk5 #: kilestdactions.cpp:186 #, kde-format -msgid "The \\dotfill command produces a \"rubber length\" that produces dots instead of just spaces." +msgid "" +"The \\dotfill command produces a \"rubber length\" that produces dots instead" +" of just spaces." msgstr "A orde produce unha «goma» que produce puntos no canto de espazos." #. +> trunk5 #: kilestdactions.cpp:188 #, kde-format msgid "Horizontal Rule - \\hrulefill" msgstr "Regra horizontal - \\hrulefill" #. +> trunk5 #: kilestdactions.cpp:188 #, kde-format msgid "Horizontal Rule" msgstr "Regra horizontal" #. +> trunk5 #: kilestdactions.cpp:188 #, kde-format -msgid "The \\hrulefill fill command produces a \"rubber length\" which can stretch or shrink horizontally. It will be filled with a horizontal rule." -msgstr "A orde de recheo \\hrulefill produce unha «goma» que se pode estirar e encoller horizontalmente. Énchese cunha regra horizontal." +msgid "" +"The \\hrulefill fill command produces a \"rubber length\" which can stretch" +" or shrink horizontally. It will be filled with a horizontal rule." +msgstr "" +"A orde de recheo \\hrulefill produce unha «goma» que se pode estirar e" +" encoller horizontalmente. Énchese cunha regra horizontal." #. +> trunk5 #: kilestdactions.cpp:190 #, kde-format msgid "Vertical Variable Space - \\vfill" msgstr "Espazo variábel vertical - \\vfill" #. +> trunk5 #: kilestdactions.cpp:190 #, kde-format msgid "Vertical Variable Space" msgstr "Espazo variábel vertical" #. +> trunk5 #: kilestdactions.cpp:190 #, kde-format -msgid "The \\vfill fill command produces a \"rubber length\" which can stretch or shrink vertically." -msgstr "A orde de recheo \\vfill produce unha «goma» que se pode estirar ou encoller verticalmente." +msgid "" +"The \\vfill fill command produces a \"rubber length\" which can stretch or" +" shrink vertically." +msgstr "" +"A orde de recheo \\vfill produce unha «goma» que se pode estirar ou encoller" +" verticalmente." #. +> trunk5 #: kilestdactions.cpp:192 #, kde-format msgid "Horizontal Space - \\hspace{}" msgstr "Espazo horizontal - \\hspace{}" #. +> trunk5 #: kilestdactions.cpp:192 #, kde-format msgid "Horizontal Space" msgstr "Espazo horizontal" #. +> trunk5 #: kilestdactions.cpp:192 #, kde-format -msgid "The \\hspace command adds horizontal space. The length of the space can be expressed in any terms that LaTeX understands, i.e., points, inches, etc. You can add negative as well as positive space with an \\hspace command. Adding negative space is like backspacing." -msgstr "A orde \\hspace engade un espazo horizontal. O longo do espazo pódese expresar en calquera unidade que LaTeX entenda, p.e., puntos, polgadas, etc. A orde \\hspace pode tomar tanto valores positivos como negativos. Engadir espazos negativos é similar á tecla de retroceso." +msgid "" +"The \\hspace command adds horizontal space. The length of the space can be" +" expressed in any terms that LaTeX understands, i.e., points, inches, etc." +" You can add negative as well as positive space with an \\hspace command." +" Adding negative space is like backspacing." +msgstr "" +"A orde \\hspace engade un espazo horizontal. O longo do espazo pódese" +" expresar en calquera unidade que LaTeX entenda, p.e., puntos, polgadas, etc." +" A orde \\hspace pode tomar tanto valores positivos como negativos. Engadir" +" espazos negativos é similar á tecla de retroceso." #. +> trunk5 #: kilestdactions.cpp:194 #, kde-format msgid "Horizontal Space (forced) - \\hspace*{}" msgstr "Espazo horizontal (forzado) - \\hspace*{}" #. +> trunk5 #: kilestdactions.cpp:194 #, kde-format msgid "Horizontal Space (forced)" msgstr "Espazo horizontal (forzado)" #. +> trunk5 #: kilestdactions.cpp:194 #, kde-format -msgid "The \\hspace* command adds horizontal space like the \\hspace command. LaTeX removes horizontal space that comes at the end of a line. If you do not want LaTeX to remove this space, include the optional * argument. Then the space is never removed." -msgstr "A orde \\hspace* engade un espazo horizontal como a orde \\hspace. LaTeX retira o espazo horizontal que comeza no fin dunha liña. Se non quere que LaTeX retire este espazo, inclúa o argumento opcional *. Neste caso o espazo nunca se retira." +msgid "" +"The \\hspace* command adds horizontal space like the \\hspace command. LaTeX" +" removes horizontal space that comes at the end of a line. If you do not want" +" LaTeX to remove this space, include the optional * argument. Then the space" +" is never removed." +msgstr "" +"A orde \\hspace* engade un espazo horizontal como a orde \\hspace. LaTeX" +" retira o espazo horizontal que comeza no fin dunha liña. Se non quere que" +" LaTeX retire este espazo, inclúa o argumento opcional *. Neste caso o espazo" +" nunca se retira." #. +> trunk5 #: kilestdactions.cpp:196 #, kde-format msgid "Vertical Space - \\vspace{}" msgstr "Espazo vertical - \\vspace{}" #. +> trunk5 #: kilestdactions.cpp:196 #, kde-format msgid "Vertical Space" msgstr "Espazo vertical" #. +> trunk5 #: kilestdactions.cpp:196 #, kde-format -msgid "The \\vspace command adds vertical space. The length of the space can be expressed in any terms that LaTeX understands, i.e., points, inches, etc. You can add negative as well as positive space with an \\vspace command." -msgstr "A orde \\vspace engade un espazo vertical. O tamaño do espazo pódese expresar en calquera das unidades que LaTeX entenda, p.e., puntos, polgadas, etc. A orde \\vspace pode admitir tanto valores negativos como positivos." +msgid "" +"The \\vspace command adds vertical space. The length of the space can be" +" expressed in any terms that LaTeX understands, i.e., points, inches, etc." +" You can add negative as well as positive space with an \\vspace command." +msgstr "" +"A orde \\vspace engade un espazo vertical. O tamaño do espazo pódese expresar" +" en calquera das unidades que LaTeX entenda, p.e., puntos, polgadas, etc. A" +" orde \\vspace pode admitir tanto valores negativos como positivos." #. +> trunk5 #: kilestdactions.cpp:198 #, kde-format msgid "Vertical Space (forced) - \\vspace*{}" msgstr "Espazo vertical (forzado) - \\vspace*{}" #. +> trunk5 #: kilestdactions.cpp:198 #, kde-format msgid "Vertical Space (forced)" msgstr "Espazo vertical (forzado)" #. +> trunk5 #: kilestdactions.cpp:198 #, kde-format -msgid "The \\vspace* command adds vertical space like the \\vspace command. LaTeX removes vertical space that comes at the end of a page. If you do not want LaTeX to remove this space, include the optional * argument. Then the space is never removed." -msgstr "A orde \\vspace* engade un espazo vertical como a orde \\vspace. LaTeX retira o espazo vertical ao fin da páxina. Se non quere que LaTeX retire este espazo, inclúa o argumento opcional *. Neste caso o espazo nunca se retirará." +msgid "" +"The \\vspace* command adds vertical space like the \\vspace command. LaTeX" +" removes vertical space that comes at the end of a page. If you do not want" +" LaTeX to remove this space, include the optional * argument. Then the space" +" is never removed." +msgstr "" +"A orde \\vspace* engade un espazo vertical como a orde \\vspace. LaTeX retira" +" o espazo vertical ao fin da páxina. Se non quere que LaTeX retire este" +" espazo, inclúa o argumento opcional *. Neste caso o espazo nunca se retirará." #. +> trunk5 #: kilestdactions.cpp:201 #, kde-format msgid "Emphasized - \\emph{}" msgstr "Énfase - \\emph{}" #. +> trunk5 #: kilestdactions.cpp:201 #, kde-format msgid "Emphasized" msgstr "Énfase" #. +> trunk5 #: kilestdactions.cpp:201 #, kde-format msgid "\\emph{emphasized text}" msgstr "\\emph{texto en énfase}" #. +> trunk5 #: kilestdactions.cpp:202 #, kde-format msgid "Strong - \\strong{}" msgstr "Forte - \\strong{}" #. +> trunk5 #: kilestdactions.cpp:202 #, kde-format msgid "Strong" msgstr "Forte" #. +> trunk5 #: kilestdactions.cpp:202 #, kde-format msgid "\\strong{text}" msgstr "\\strong{texto}" #. +> trunk5 #: kilestdactions.cpp:204 #, kde-format msgid "Roman - \\rmfamily" msgstr "Romana - \\rmfamily" #. +> trunk5 #: kilestdactions.cpp:204 #, kde-format msgid "Roman" msgstr "Romana" #. +> trunk5 #: kilestdactions.cpp:205 #, kde-format msgid "Sans Serif - \\sffamily" msgstr "Sans Serif - \\sffamily" #. +> trunk5 #: kilestdactions.cpp:205 #, kde-format msgid "Sans Serif" msgstr "Sans Serif" #. +> trunk5 #: kilestdactions.cpp:206 #, kde-format msgid "Monospace - \\ttfamily" -msgstr "Monospace - \\ttfamily" +msgstr "Monoespazo - \\ttfamily" #. +> trunk5 #: kilestdactions.cpp:206 #, kde-format msgid "Monospace" -msgstr "Monospace" +msgstr "Monoespazo" #. +> trunk5 #: kilestdactions.cpp:208 #, kde-format msgid "Medium - \\mdseries" msgstr "Media - \\mdseries" #. +> trunk5 #: kilestdactions.cpp:208 #, kde-format msgid "Medium" msgstr "Media" #. +> trunk5 #: kilestdactions.cpp:209 #, kde-format msgid "Bold - \\bfseries" msgstr "Letra grosa - \\bfseries" #. +> trunk5 #: kilestdactions.cpp:211 #, kde-format msgid "Upright - \\upshape" msgstr "Elevado - \\upshape" #. +> trunk5 #: kilestdactions.cpp:211 #, kde-format msgid "Upright" msgstr "Elevado" #. +> trunk5 #: kilestdactions.cpp:212 #, kde-format msgid "Italic - \\itshape" msgstr "Itálica - \\itshape" #. +> trunk5 #: kilestdactions.cpp:213 #, kde-format msgid "Slanted - \\slshape" msgstr "Inclinada - \\slshape" #. +> trunk5 #: kilestdactions.cpp:214 #, kde-format msgid "Smallcaps - \\scshape" msgstr "Versais - \\scshape" #. +> trunk5 #: kilestdactions.cpp:214 #, kde-format msgid "Smallcaps" msgstr "Versais" #. +> trunk5 #: kilestdactions.cpp:226 #, kde-format msgid "Bibliography Style Selection - \\bibliographystyle{}" msgstr "Escolla de estilo bibliográfico - \\bibliographystyle{}" #. +> trunk5 #: kilestdactions.cpp:226 #, kde-format msgid "Bibliography Style Selection" msgstr "Escolla do tipo da bibliografía" #. +> trunk5 #: kilestdactions.cpp:226 #, kde-format msgid "" -"The argument to \\bibliographystyle refers to a file style.bst, which defines how your citations will look\n" +"The argument to \\bibliographystyle refers to a file style.bst, which defines" +" how your citations will look\n" "The standard styles distributed with BibTeX are:\n" -"alpha : sorted alphabetically. Labels are formed from name of author and year of publication.\n" +"alpha : sorted alphabetically. Labels are formed from name of author and year" +" of publication.\n" "plain : sorted alphabetically. Labels are numeric.\n" "unsrt : like plain, but entries are in order of citation.\n" "abbrv : like plain, but more compact labels." msgstr "" -"O argumento para \\bibliographystyle refírese a un ficheiro style.bst, o cal define como serán as súas citas \n" +"O argumento para \\bibliographystyle refírese a un ficheiro style.bst, o cal" +" define como serán as súas citas \n" "Os estilos estándar distribuídos con BibTeX son:\n" -"alpha : ordenado alfabeticamente. As etiquetas fórmanse a partir do nome do autor e ano de publicación.\n" +"alpha : ordenado alfabeticamente. As etiquetas fórmanse a partir do nome do" +" autor e ano de publicación.\n" "plain ; ordenado alfabeticamente. As etiquetas son numéricas.\n" "unsrt : como texto simple, pero as entradas ordénanse por citación.\n" "abbrv : como texto simple, pero as etiquetas son máis compactas." #. +> trunk5 #: kilestdactions.cpp:227 kilestdactions.cpp:235 #, kde-format msgid "Bibliography Generation - \\bibliography{}" msgstr "Xeración de bibliografía - \\bibliography{}" #. +> trunk5 #: kilestdactions.cpp:227 kilestdactions.cpp:235 #, kde-format msgid "Bibliography Generation" msgstr "Xeración da bibliografía" #. +> trunk5 #: kilestdactions.cpp:227 kilestdactions.cpp:235 #, kde-format msgid "" "The argument to \\bibliography refers to the bib file (without extension)\n" "which should contain your database in BibTeX format.\n" "Kile inserts automatically the base name of the TeX file" msgstr "" -"O argumento para as referencias \\bibliography para un ficheiro bib (sen extensión)\n" +"O argumento para as referencias \\bibliography para un ficheiro bib (sen" +" extensión)\n" "que deberá conter a súa base de datos no formato BibTeX.\n" "Kile insire automaticamente o nome da base no ficheiro TeX" #. +> trunk5 #: kilestdactions.cpp:234 #, kde-format msgid "Load Biblatex Package - \\usepackage{biblatex}" msgstr "Importación do paquete Biblatex - \\usepackage{biblatex}" #. +> trunk5 #: kilestdactions.cpp:234 #, kde-format msgid "Load Biblatex Package" msgstr "Cargar o paquete Biblatex" #. +> trunk5 #: kilestdactions.cpp:234 #, kde-format msgid "This includes the package biblatex" msgstr "Isto inclúe o paquete biblatex" #. +> trunk5 #: kilestdactions.cpp:236 #, kde-format msgid "Print Bibliography" msgstr "Imprimir a bibliografía" #. +> trunk5 #: kilestdactions.cpp:236 #, kde-format msgid "Prints the complete bibliography" msgstr "Imprime toda a bibliografía" #. +> trunk5 #: kilestdactions.cpp:237 #, kde-format msgid "Print Bibliography by Section" msgstr "Imprimir a bibliografía por seccións" #. +> trunk5 #: kilestdactions.cpp:237 #, kde-format msgid "Print the bibliography for each section" msgstr "Imprimir a bibliografía de cada sección" #. +> trunk5 #: kilestdactions.cpp:238 #, kde-format msgid "Print List of Shorthands" msgstr "Imprimir a lista de atallos" #. +> trunk5 #: kilestdactions.cpp:337 #, kde-format msgid "ALT.... : you have the choice between these two fields\n" msgstr "ALT.… : pode escoller entre estes dous campos\n" #. +> trunk5 #: kilestdactions.cpp:338 #, kde-format msgid "OPT.... : optional fields (use the 'Clean' command to remove them)" msgstr "OPT.… : campos opcionais (empregue a orde «Limpar» para retiralos)" #. +> trunk5 #: kilestdactions.cpp:339 #, kde-format msgid "Bib fields - %1\n" msgstr "Campos de bibliografía, %1\n" #. +> trunk5 #: kilestdactions.cpp:354 #, kde-format msgid "\\mathrm{}" msgstr "\\mathrm{}" #. +> trunk5 #: kilestdactions.cpp:355 #, kde-format msgid "\\mathit{}" msgstr "\\mathit{}" #. +> trunk5 #: kilestdactions.cpp:356 #, kde-format msgid "\\mathbf{}" msgstr "\\mathbf{}" #. +> trunk5 #: kilestdactions.cpp:357 #, kde-format msgid "\\mathsf{}" msgstr "\\mathsf{}" #. +> trunk5 #: kilestdactions.cpp:358 #, kde-format msgid "\\mathtt{}" msgstr "\\mathtt{}" #. +> trunk5 #: kilestdactions.cpp:359 #, kde-format msgid "\\mathcal{}" msgstr "\\mathcal{}" #. +> trunk5 #: kilestdactions.cpp:360 #, kde-format msgid "\\mathbb{}" msgstr "\\mathbb{}" #. +> trunk5 #: kilestdactions.cpp:361 #, kde-format msgid "\\mathfrak{}" msgstr "\\mathfrak{}" #. +> trunk5 #: kilestdactions.cpp:363 #, kde-format msgid "\\acute{}" msgstr "\\acute{}" #. +> trunk5 #: kilestdactions.cpp:364 #, kde-format msgid "\\grave{}" msgstr "\\grave{}" #. +> trunk5 #: kilestdactions.cpp:365 #, kde-format msgid "\\tilde{}" msgstr "\\tilde{}" #. +> trunk5 #: kilestdactions.cpp:366 #, kde-format msgid "\\bar{}" msgstr "\\bar{}" #. +> trunk5 #: kilestdactions.cpp:367 #, kde-format msgid "\\vec{}" msgstr "\\vec{}" #. +> trunk5 #: kilestdactions.cpp:368 #, kde-format msgid "\\hat{}" msgstr "\\hat{}" # skip-rule: trasno-check #. +> trunk5 #: kilestdactions.cpp:369 #, kde-format msgid "\\check{}" msgstr "\\check{}" #. +> trunk5 #: kilestdactions.cpp:370 #, kde-format msgid "\\breve{}" msgstr "\\breve{}" #. +> trunk5 #: kilestdactions.cpp:371 #, kde-format msgid "\\dot{}" msgstr "\\dot{}" #. +> trunk5 #: kilestdactions.cpp:372 #, kde-format msgid "\\ddot{}" msgstr "\\ddot{}" #. +> trunk5 #: kilestdactions.cpp:374 #, kde-format msgid "Small Space" msgstr "Espazo pequeno" #. +> trunk5 #: kilestdactions.cpp:375 #, kde-format msgid "Medium Space" msgstr "Espazo medio" #. +> trunk5 #: kilestdactions.cpp:376 #, kde-format msgid "Large Space" msgstr "Espazo longo" #. +> trunk5 #: kilestdactions.cpp:377 #, kde-format msgid "\\quad" msgstr "\\quad" #. +> trunk5 #: kilestdactions.cpp:378 #, kde-format msgid "\\qquad" msgstr "\\qquad" #. +> trunk5 #: kilestdactions.cpp:380 #, kde-format msgid "Math Mode - $...$" msgstr "Modo matemático - $…$" #. +> trunk5 #: kilestdactions.cpp:380 #, kde-format msgid "Math Mode" msgstr "Modo matemático" #. +> trunk5 #: kilestdactions.cpp:381 #, kde-format msgid "Displaymath Mode - \\[...\\]" msgstr "Modo «displaymath» - \\[…\\]" #. +> trunk5 #: kilestdactions.cpp:381 #, kde-format msgid "Displaymath Mode" msgstr "Modo «displaymath»" #. +> trunk5 #: kilestdactions.cpp:382 #, kde-format msgid "Equation - \\begin{equation}" msgstr "Ecuación - \\begin{equation}" #. +> trunk5 #: kilestdactions.cpp:382 #, kde-format msgid "Equation" msgstr "Ecuación" #. +> trunk5 #: kilestdactions.cpp:383 #, kde-format msgid "Subscript - _{}" msgstr "Subíndice - _{}" #. +> trunk5 #: kilestdactions.cpp:383 #, kde-format msgid "Subscript" msgstr "Subíndice" #. +> trunk5 #: kilestdactions.cpp:384 #, kde-format msgid "Superscript - ^{}" msgstr "Superíndice - ^{}" #. +> trunk5 #: kilestdactions.cpp:384 #, kde-format msgid "Superscript" msgstr "Superíndice" #. +> trunk5 #: kilestdactions.cpp:385 #, kde-format msgid "Normal Fraction - \\frac{}{}" msgstr "Fracción normal - \\frac{}{}" #. +> trunk5 #: kilestdactions.cpp:385 #, kde-format msgid "Normal Fraction" msgstr "Fracción normal" #. +> trunk5 #: kilestdactions.cpp:386 #, kde-format msgid "Displaystyle Fraction - \\dfrac{}{}" msgstr "Fracción en estilo visual - \\dfrac{}{}" #. +> trunk5 #: kilestdactions.cpp:386 #, kde-format msgid "Displaystyle Fraction" msgstr "Fracción en estilo visual" #. +> trunk5 #: kilestdactions.cpp:387 #, kde-format msgid "Textstyle Fraction - \\tfrac{}{}" msgstr "Fracción en estilo de texto - \\tfrac{}{}" #. +> trunk5 #: kilestdactions.cpp:387 #, kde-format msgid "Textstyle Fraction" msgstr "Fracción en estilo de texto" #. +> trunk5 #: kilestdactions.cpp:388 #, kde-format msgid "Square Root - \\sqrt{}" msgstr "Raíz cadrada - \\sqrt{}" #. +> trunk5 #: kilestdactions.cpp:388 #, kde-format msgid "Square Root" msgstr "Raíz cadrada" #. +> trunk5 #: kilestdactions.cpp:389 #, kde-format msgid "\\left" msgstr "\\left" #. +> trunk5 #: kilestdactions.cpp:390 #, kde-format msgid "\\right" msgstr "\\right" #. +> trunk5 #: kilestdactions.cpp:391 #, kde-format msgid "Array - \\begin{array}" msgstr "Matriz - \\begin{array}" #. +> trunk5 #: kilestdactions.cpp:392 #, kde-format msgid "" "\\begin{array}{col1col2...coln}\n" "column 1 entry & column 2 entry ... & column n entry \\\\ \n" "...\n" "\\end{array}\n" -"Each column, coln, is specified by a single letter that tells how items in that column should be formatted.\n" +"Each column, coln, is specified by a single letter that tells how items in" +" that column should be formatted.\n" " c -- for centered \n" " l -- for flush left \n" " r -- for flush right\n" msgstr "" "\\begin{array}{columna1columna2…columnan}\n" "columna 1 entrada & columna 2 entrada … & columna n entrada \\\\ \n" "…\n" "\\end{array}\n" -"Cada columna, columnan, especifícase por unha única letra que indica como os elementos deben ser formados na columna\n" +"Cada columna, columnan, especifícase por unha única letra que indica como os" +" elementos deben ser formados na columna\n" " c -- para centrado \n" " l -- para verter á esquerda \n" " r -- para verter á dereita\n" #. +> trunk5 #: kilestdactions.cpp:395 #, kde-format msgid "Left Delimiter" msgstr "Delimitador da esquerda" #. +> trunk5 #: kilestdactions.cpp:397 #, kde-format msgid "left (" msgstr "( esquerdo" #. +> trunk5 #: kilestdactions.cpp:398 #, kde-format msgid "left [" msgstr "[ esquerdo" #. +> trunk5 #: kilestdactions.cpp:399 #, kde-format msgid "left {" msgstr "{ esquerdo" #. +> trunk5 #: kilestdactions.cpp:400 #, kde-format msgid "left <" msgstr "< esquerdo" #. +> trunk5 #: kilestdactions.cpp:402 #, kde-format msgid "left )" msgstr ") esquerdo" #. +> trunk5 #: kilestdactions.cpp:403 #, kde-format msgid "left ]" msgstr "] esquerdo" #. +> trunk5 #: kilestdactions.cpp:404 #, kde-format msgid "left }" msgstr "} esquerdo" #. +> trunk5 #: kilestdactions.cpp:405 #, kde-format msgid "left >" msgstr "> esquerdo" # skip-rule: mecanografía-punto-no-final #. +> trunk5 #: kilestdactions.cpp:407 #, kde-format msgid "left ." msgstr ". esquerdo" #. +> trunk5 #: kilestdactions.cpp:409 #, kde-format msgid "Right Delimiter" msgstr "Delimitador da dereita" #. +> trunk5 #: kilestdactions.cpp:411 #, kde-format msgid "right )" msgstr ") dereito" #. +> trunk5 #: kilestdactions.cpp:412 #, kde-format msgid "right ]" msgstr "] dereito" #. +> trunk5 #: kilestdactions.cpp:413 #, kde-format msgid "right }" msgstr "} dereito" #. +> trunk5 #: kilestdactions.cpp:414 #, kde-format msgid "right >" msgstr "> dereito" #. +> trunk5 #: kilestdactions.cpp:416 #, kde-format msgid "right (" msgstr "( dereito" #. +> trunk5 #: kilestdactions.cpp:417 #, kde-format msgid "right [" msgstr "[ dereito" #. +> trunk5 #: kilestdactions.cpp:418 #, kde-format msgid "right {" msgstr "{ dereito" #. +> trunk5 #: kilestdactions.cpp:419 #, kde-format msgid "right <" msgstr "< dereito" # skip-rule: mecanografía-punto-no-final #. +> trunk5 #: kilestdactions.cpp:421 #, kde-format msgid "right ." msgstr ". dereito" #. +> trunk5 #: kilestdactions.cpp:426 #, kde-format msgid "Normal Binomial - \\binom{}{}" msgstr "Binomial normal - \\binom{}{}" #. +> trunk5 #: kilestdactions.cpp:426 #, kde-format msgid "Normal Binomial" msgstr "Binomial normal" #. +> trunk5 #: kilestdactions.cpp:428 #, kde-format msgid "Displaystyle Binomial - \\dbinom{}{}" msgstr "Binomial en estilo visual - \\dbinom{}{}" #. +> trunk5 #: kilestdactions.cpp:428 #, kde-format msgid "Displaystyle Binomial" msgstr "Binomial en estilo visual" #. +> trunk5 #: kilestdactions.cpp:430 #, kde-format msgid "Textstyle Binomial - \\tbinom{}{}" msgstr "Binomial en estilo de texto - \\tbinom{}{}" #. +> trunk5 #: kilestdactions.cpp:430 #, kde-format msgid "Textstyle Binomial" msgstr "Binomial en estilo de texto" #. +> trunk5 #: kilestdactions.cpp:432 #, kde-format msgid "N-th Root - \\sqrt[]{}" msgstr "Raíz n-ésima - \\sqrt[]{}" #. +> trunk5 #: kilestdactions.cpp:432 #, kde-format msgid "N-th Root" msgstr "Raíz n-ésima" #. +> trunk5 #: kilestdactions.cpp:434 #, kde-format msgid "Left-Right () - \\left(..\\right)" msgstr "() esquerdo-dereito - \\left(..\\right)" #. +> trunk5 #: kilestdactions.cpp:434 #, kde-format msgid "Left-Right ()" msgstr "() esquerdo-dereito" #. +> trunk5 #: kilestdactions.cpp:436 #, kde-format msgid "Extendable Left Arrow - \\xleftarrow{}" msgstr "Frecha extensíbel para a esquerda - \\xleftarrow{}" #. +> trunk5 #: kilestdactions.cpp:436 #, kde-format msgid "Extendable Left Arrow" msgstr "Frecha extensíbel para a esquerda" #. +> trunk5 #: kilestdactions.cpp:438 #, kde-format msgid "Extendable Right Arrow - \\xrightarrow{}" msgstr "Frecha extensíbel para a dereita - \\xrightarrow{}" #. +> trunk5 #: kilestdactions.cpp:438 #, kde-format msgid "Extendable Right Arrow" msgstr "Frecha extensíbel para a dereita" #. +> trunk5 #: kilestdactions.cpp:440 #, kde-format msgid "Boxed Formula - \\boxed{}" msgstr "Fórmula nun recadro - \\boxed{}" #. +> trunk5 #: kilestdactions.cpp:440 #, kde-format msgid "Boxed Formula" msgstr "Fórmula nun recadro" #. +> trunk5 #: kilestdactions.cpp:442 #, kde-format msgid "bigl - \\bigl" msgstr "bigl - \\bigl" #. +> trunk5 #: kilestdactions.cpp:442 #, kde-format msgid "bigl" msgstr "bigl" #. +> trunk5 #: kilestdactions.cpp:443 #, kde-format msgid "Bigl - \\Bigl" msgstr "Bigl - \\Bigl" #. +> trunk5 #: kilestdactions.cpp:443 #, kde-format msgid "Bigl" msgstr "Bigl" #. +> trunk5 #: kilestdactions.cpp:444 #, kde-format msgid "biggl - \\biggl" msgstr "biggl - \\biggl" #. +> trunk5 #: kilestdactions.cpp:444 #, kde-format msgid "biggl" msgstr "biggl" #. +> trunk5 #: kilestdactions.cpp:445 #, kde-format msgid "Biggl - \\Biggl" msgstr "Biggl - \\Biggl" #. +> trunk5 #: kilestdactions.cpp:445 #, kde-format msgid "Biggl" msgstr "Biggl" #. +> trunk5 #: kilestdactions.cpp:447 #, kde-format msgid "bigr - \\bigr" msgstr "bigr - \\bigr" #. +> trunk5 #: kilestdactions.cpp:447 #, kde-format msgid "bigr" msgstr "bigr" #. +> trunk5 #: kilestdactions.cpp:448 #, kde-format msgid "Bigr - \\Bigr" msgstr "Bigr - \\Bigr" #. +> trunk5 #: kilestdactions.cpp:448 #, kde-format msgid "Bigr" msgstr "Bigr" #. +> trunk5 #: kilestdactions.cpp:449 #, kde-format msgid "biggr - \\biggr" msgstr "biggr - \\biggr" #. +> trunk5 #: kilestdactions.cpp:449 #, kde-format msgid "biggr" msgstr "biggr" #. +> trunk5 #: kilestdactions.cpp:450 #, kde-format msgid "Biggr - \\Biggr" msgstr "Biggr - \\Biggr" #. +> trunk5 #: kilestdactions.cpp:450 #, kde-format msgid "Biggr" msgstr "Biggr" #. +> trunk5 #: kilestdactions.cpp:453 #, kde-format msgid "Text in Mathmode - \\text{}" msgstr "Texto en modo matemático - \\text{}" #. +> trunk5 #: kilestdactions.cpp:453 #, kde-format msgid "Text in Mathmode" msgstr "Texto en modo matemático" #. +> trunk5 #: kilestdactions.cpp:455 #, kde-format msgid "Intertext - \\intertext{}" msgstr "Intertexto - \\intertext{}" #. +> trunk5 #: kilestdactions.cpp:455 #, kde-format msgid "Intertext" msgstr "Intertexto" #. +> trunk5 #: kilestdactions.cpp:458 #, kde-format msgid "Displaymath - \\begin{displaymath}" msgstr "Displaymath - \\begin{displaymath}" #. +> trunk5 #: kilestdactions.cpp:458 #, kde-format msgid "Displaymath" msgstr "Displaymath" #. +> trunk5 #: kilestdactions.cpp:460 #, kde-format msgid "Equation (not numbered) - \\begin{equation*}" msgstr "Ecuación (non numerada) - \\begin{equation*}" #. +> trunk5 #: kilestdactions.cpp:460 #, kde-format msgid "Equation (not numbered)" msgstr "Ecuación (non numerada)" #. +> trunk5 #: kilestdactions.cpp:463 #, kde-format msgid "Multline - \\begin{multline}" msgstr "Multi-liña - \\begin{multline}" #. +> trunk5 #: kilestdactions.cpp:463 #, kde-format msgid "Multline" msgstr "Multi-liña" #. +> trunk5 #: kilestdactions.cpp:464 #, kde-format msgid "Multline* - \\begin{multline*}" msgstr "Multi-liña* - \\begin{multline*}" #. +> trunk5 #: kilestdactions.cpp:464 #, kde-format msgid "Multline*" msgstr "Multi-liña*" #. +> trunk5 #: kilestdactions.cpp:466 #, kde-format msgid "Split - \\begin{split}" msgstr "División - \\begin{split}" #. +> trunk5 #: kilestdactions.cpp:466 #, kde-format msgid "Split" msgstr "División" #. +> trunk5 #: kilestdactions.cpp:468 #, kde-format msgid "Gather - \\begin{gather}" msgstr "Reunir - \\begin{gather}" #. +> trunk5 #: kilestdactions.cpp:468 #, kde-format msgid "Gather" msgstr "Reunir" #. +> trunk5 #: kilestdactions.cpp:469 #, kde-format msgid "Gather* - \\begin{gather*}" msgstr "Reunir* - \\begin{gather*}" #. +> trunk5 #: kilestdactions.cpp:469 #, kde-format msgid "Gather*" msgstr "Reunir*" #. +> trunk5 #: kilestdactions.cpp:471 #, kde-format msgid "Align - \\begin{align}" msgstr "Aliñar - \\begin{align}" #. +> trunk5 #: kilestdactions.cpp:471 #, kde-format msgid "Align" msgstr "Aliñar" #. +> trunk5 #: kilestdactions.cpp:472 #, kde-format msgid "Align* - \\begin{align*}" msgstr "Aliñar* - \\begin{align*}" #. +> trunk5 #: kilestdactions.cpp:472 #, kde-format msgid "Align*" msgstr "Aliñar*" #. +> trunk5 #: kilestdactions.cpp:474 #, kde-format msgid "Flalign - \\begin{flalign}" msgstr "Aliñflu - \\begin{flalign}" #. +> trunk5 #: kilestdactions.cpp:474 #, kde-format msgid "Flalign" msgstr "Aliñflu" #. +> trunk5 #: kilestdactions.cpp:475 #, kde-format msgid "Flalign* - \\begin{flalign*}" msgstr "Aliñflu* - \\begin{flalign*}" #. +> trunk5 #: kilestdactions.cpp:475 #, kde-format msgid "Flalign*" msgstr "Aliñflu*" # skip-rule: PT-2013-dual_align #. +> trunk5 #: kilestdactions.cpp:477 #, kde-format msgid "Alignat - \\begin{alignat}" msgstr "Aliñaren - \\begin{alignat}" # skip-rule: PT-2013-dual_align #. +> trunk5 #: kilestdactions.cpp:477 #, kde-format msgid "Alignat" msgstr "Aliñaren" # skip-rule: PT-2013-dual_align #. +> trunk5 #: kilestdactions.cpp:478 #, kde-format msgid "Alignat* - \\begin{alignat*}" msgstr "Aliñaren* - \\begin{alignat*}" # skip-rule: PT-2013-dual_align #. +> trunk5 #: kilestdactions.cpp:478 #, kde-format msgid "Alignat*" msgstr "Aliñaren*" #. +> trunk5 #: kilestdactions.cpp:480 #, kde-format msgid "Aligned - \\begin{aligned}" msgstr "Aliñado - \\begin{aligned}" #. +> trunk5 #: kilestdactions.cpp:480 #, kde-format msgid "Aligned" msgstr "Aliñado" #. +> trunk5 #: kilestdactions.cpp:481 #, kde-format msgid "Gathered - \\begin{gathered}" msgstr "Xuntado - \\begin{gathered}" #. +> trunk5 #: kilestdactions.cpp:481 #, kde-format msgid "Gathered" msgstr "Reunido" # skip-rule: PT-2013-dual_align #. +> trunk5 #: kilestdactions.cpp:482 #, kde-format msgid "Alignedat - \\begin{alignedat}" msgstr "Aliñadoen - \\begin{alignedat}" # skip-rule: PT-2013-dual_align #. +> trunk5 #: kilestdactions.cpp:482 #, kde-format msgid "Alignedat" msgstr "Aliñadoen" #. +> trunk5 #: kilestdactions.cpp:484 #, kde-format msgid "Cases - \\begin{cases}" msgstr "Casos- \\begin{cases}" #. +> trunk5 #: kilestdactions.cpp:484 #, kde-format msgid "Cases" msgstr "Casos" #. +> trunk5 #: kilestdactions.cpp:486 #, kde-format msgid "matrix - \\begin{matrix}" msgstr "matriz - \\begin{matrix}" #. +> trunk5 #: kilestdactions.cpp:486 #, kde-format msgid "matrix" msgstr "matriz" #. +> trunk5 #: kilestdactions.cpp:487 #, kde-format msgid "pmatrix - \\begin{pmatrix}" msgstr "matriz p - \\begin{gather}" #. +> trunk5 #: kilestdactions.cpp:487 #, kde-format msgid "pmatrix" msgstr "matriz p" #. +> trunk5 #: kilestdactions.cpp:488 #, kde-format msgid "vmatrix - \\begin{vmatrix}" msgstr "matriz v - \\begin{vmatrix}" #. +> trunk5 #: kilestdactions.cpp:488 #, kde-format msgid "vmatrix" msgstr "matriz v" #. +> trunk5 #: kilestdactions.cpp:489 #, kde-format msgid "Vmatrix - \\begin{Vmatrix}" msgstr "matriz V - \\begin{Vmatrix}" #. +> trunk5 #: kilestdactions.cpp:489 #, kde-format msgid "Vmatrix" msgstr "matriz V" #. +> trunk5 #: kilestdactions.cpp:490 #, kde-format msgid "bmatrix - \\begin{bmatrix}" msgstr "matriz b - \\begin{bmatrix}" #. +> trunk5 #: kilestdactions.cpp:490 #, kde-format msgid "bmatrix" msgstr "matriz b" #. +> trunk5 #: kilestdactions.cpp:491 #, kde-format msgid "Bmatrix - \\begin{Bmatrix}" msgstr "matriz B - \\begin{Bmatrix}" #. +> trunk5 #: kilestdactions.cpp:491 #, kde-format msgid "Bmatrix" msgstr "matriz B" #. i18np call can cause some confusion when 0 is passed to it (#275700) #. +> trunk5 #: kilestdtools.cpp:327 #, kde-format msgid "0 errors" msgstr "0 erros" #. +> trunk5 #: kilestdtools.cpp:327 #, kde-format msgid "1 error" msgid_plural "%1 errors" msgstr[0] "1 erro" msgstr[1] "%1 erros" #. +> trunk5 #: kilestdtools.cpp:328 #, kde-format msgid "0 warnings" msgstr "0 avisos" #. +> trunk5 #: kilestdtools.cpp:328 #, kde-format msgid "1 warning" msgid_plural "%1 warnings" msgstr[0] "1 aviso" msgstr[1] "%1 avisos" #. +> trunk5 #: kilestdtools.cpp:329 #, kde-format msgid "0 badboxes" msgstr "0 caixas malas" #. +> trunk5 #: kilestdtools.cpp:329 #, kde-format msgid "1 badbox" msgid_plural "%1 badboxes" msgstr[0] "1 caixa mala" msgstr[1] "%1 caixas malas" #. +> trunk5 #: kilestdtools.cpp:332 #, kde-format -msgctxt "String displayed in the log panel showing the number of errors/warnings/badboxes" +msgctxt "" +"String displayed in the log panel showing the number of" +" errors/warnings/badboxes" msgid "%1, %2, %3" msgstr "%1, %2, %3" #. +> trunk5 #: kilestdtools.cpp:375 #, kde-format -msgid "Manually selected bibliography tool does not exist: trying to auto-detect it now." -msgstr "Non existe unha ferramenta de bibliografía escollida manualmente: vaise intentar detectar automaticamente agora." +msgid "" +"Manually selected bibliography tool does not exist: trying to auto-detect it" +" now." +msgstr "" +"Non existe unha ferramenta de bibliografía escollida manualmente: vaise" +" intentar detectar automaticamente agora." #. +> trunk5 #: kilestdtools.cpp:659 #, kde-format -msgid "The version %1.%2.%3 of okular is too old for ForwardDVI. Please update okular to version 0.8.6 or higher" -msgstr "A versión %1.%2.%3 de okular é demasiado vella para ForwardDVI. Actualice okular á versión 0.8.6 ou posterior" +msgid "" +"The version %1.%2.%3 of okular is too old for ForwardDVI. Please update" +" okular to version 0.8.6 or higher" +msgstr "" +"A versión %1.%2.%3 de okular é demasiado vella para ForwardDVI. Actualice" +" okular á versión 0.8.6 ou posterior" #. +> trunk5 #: kilestdtools.cpp:726 #, kde-format msgid "Select Bibliography" msgstr "Escoller unha bibliografía" #. +> trunk5 #: kilestdtools.cpp:726 #, kde-format msgid "Select a bibliography" msgstr "Escolla unha bibliografía" #. +> trunk5 #: kilestdtools.cpp:735 #, kde-format msgid "No bibliography selected." msgstr "Non se escolleu ningunha bibliografía." #. +> trunk5 #: kilestdtools.cpp:747 #, kde-format msgid "No bibliographies found." msgstr "Non se atopou ningunha bibliografía." #. +> trunk5 #: kilestdtools.cpp:783 #, kde-format -msgid "Unable to find %1 or %2; if you are trying to view some other HTML file, go to Settings->Configure Kile->Tools->ViewHTML->Advanced." -msgstr "Non se pode atopar %1 nin %2; se está a intentar ver algún outro ficheiro HTML, vaia a Configuración->Configurar Kile->Ferramentas->VerHTML->Avanzado." +msgid "" +"Unable to find %1 or %2; if you are trying to view some other HTML file, go" +" to Settings->Configure Kile->Tools->ViewHTML->Advanced." +msgstr "" +"Non se pode atopar %1 nin %2; se está a intentar ver algún outro ficheiro" +" HTML, vaia a Configuración->Configurar Kile->Ferramentas->VerHTML->Avanzado." #. +> trunk5 #: kiletool.cpp:58 #, kde-format msgid "Could not change to the folder %1." msgstr "Non se puido cambiar para o cartafol %1." #. +> trunk5 #: kiletool.cpp:59 #, kde-format -msgid "The folder %1 is not writable, therefore %2 will not be able to save its results." -msgstr "O cartafol %1 non permite escritura, polo que %2 non poderá gardar o resultado." +msgid "" +"The folder %1 is not writable, therefore %2 will not be able to save its" +" results." +msgstr "" +"O cartafol %1 non permite escritura, polo que %2 non poderá gardar o" +" resultado." #. +> trunk5 #: kiletool.cpp:60 #, kde-format -msgid "The file %1/%2 does not exist. If this is unexpected, check the file permissions." -msgstr "O ficheiro %1/%2 non existe. Se lle sorprende, comprobe os permisos do ficheiro." +msgid "" +"The file %1/%2 does not exist. If this is unexpected, check the file" +" permissions." +msgstr "" +"O ficheiro %1/%2 non existe. Se lle sorprende, comprobe os permisos do" +" ficheiro." #. +> trunk5 #: kiletool.cpp:61 #, kde-format -msgid "The file %1/%2 is not readable. If this is unexpected, check the file permissions." -msgstr "O ficheiro %1/%2 non e lexíbel. Se lle sorprende, comprobe os permisos do ficheiro." +msgid "" +"The file %1/%2 is not readable. If this is unexpected, check the file" +" permissions." +msgstr "" +"O ficheiro %1/%2 non e lexíbel. Se lle sorprende, comprobe os permisos do" +" ficheiro." #. +> trunk5 #: kiletool.cpp:62 #, kde-format -msgid "Could not determine on which file to run %1, because there is no active document." -msgstr "Non se puido determinar en que ficheiro executar %1 porque non hai ningún documento activo." +msgid "" +"Could not determine on which file to run %1, because there is no active" +" document." +msgstr "" +"Non se puido determinar en que ficheiro executar %1 porque non hai ningún" +" documento activo." #. +> trunk5 #: kiletool.cpp:63 #, kde-format msgid "Could not determine the master file for this document." msgstr "Non se puido determinar o ficheiro mestre para este documento." #. +> trunk5 #: kiletool.cpp:64 #, kde-format msgid "Please save the untitled document first." msgstr "Garde antes o documento sen título." #. +> trunk5 #: kiletool.cpp:65 #, kde-format msgid "The file %1 does not exist." msgstr "O ficheiro %1 non existe." #. +> trunk5 #: kiletool.cpp:66 #, kde-format msgid "The file %1 is not readable." msgstr "O ficheiro %1 non é lexíbel." #. +> trunk5 #: kiletool.cpp:642 #, kde-format msgid "The document %1 is not a LaTeX root document; continue anyway?" -msgstr "O documento %1 non é un documento raíz de LaTeX. Desexa continuar aínda así?" +msgstr "" +"O documento %1 non é un documento raíz de LaTeX. Desexa continuar aínda así?" #. +> trunk5 #: kiletool.cpp:642 #, kde-format msgid "Continue?" msgstr "Desexa continuar?" #. +> trunk5 #: kiletool.cpp:654 #, kde-format msgid "The file %1/%2 does not exist; did you compile the source file?" msgstr "O ficheiro %1/%2 non existe; compilou vostede o ficheiro fonte?" #. +> trunk5 #: kiletool.cpp:674 #, kde-format -msgid "The current document is not associated to a project. Please activate a document that is associated to the project you want to archive, then choose Archive again." -msgstr "O documento actual non está asociado a un proxecto. Active un documento que estea asociado ao proxecto que quere arquivar e entón escolla Arquivar de novo." +msgid "" +"The current document is not associated to a project. Please activate a" +" document that is associated to the project you want to archive, then choose" +" Archive again." +msgstr "" +"O documento actual non está asociado a un proxecto. Active un documento que" +" estea asociado ao proxecto que quere arquivar e entón escolla Arquivar de" +" novo." #. +> trunk5 #: kiletool.cpp:678 #, kde-format msgid "No files have been chosen for archiving." msgstr "Non escolleu ningún documento para arquivalo." #. +> trunk5 #: kiletool.cpp:694 #, kde-format msgid "Archive Project" msgstr "Arquivar o proxecto" #. +> trunk5 #: kiletool.cpp:821 kiletoolmanager.cpp:285 #, kde-format msgid "Unknown tool %1." msgstr "Non se coñece a ferramenta %1." #. +> trunk5 #: kiletoolmanager.cpp:279 #, kde-format msgid "No factory installed, contact the author of Kile." msgstr "Non hai ningunha fábrica instalada, contacte co autor de Kile." #. +> trunk5 #: kiletoolmanager.cpp:362 #, kde-format msgid "Aborted" msgstr "Interrompido" #. +> trunk5 #: kiletoolmanager.cpp:486 #, kde-format msgid "Cannot find the tool \"%1\" in the configuration database." -msgstr "Non se pode atopar a ferramenta «»%1» na base de datos da configuración." +msgstr "" +"Non se pode atopar a ferramenta «»%1» na base de datos da configuración." #. +> trunk5 #: kiletoolmanager.cpp:743 #, kde-format msgid "&Stop" msgstr "&Parar" #. +> trunk5 #: kiletoolmanager.cpp:752 #, kde-format msgid "Bibliography Back End" msgstr "Infraestrutura da bibliografía" #. +> trunk5 #: kiletoolmanager.cpp:753 #, kde-format msgid "Auto-Detect" msgstr "Detectar automaticamente" #. +> trunk5 #: kiletoolmanager.cpp:754 #, kde-format msgid "Auto-detect the bibliography back end from LaTeX output" -msgstr "Detectar automaticamente a infraestrutura da bibliografía a partir da saída de LaTeX" +msgstr "" +"Detectar automaticamente a infraestrutura da bibliografía a partir da saída" +" de LaTeX" #. +> trunk5 #: kiletoolmanager.cpp:759 #, kde-format msgid "Reset Auto-Detected Back End" msgstr "Reiniciar a infraestrutura detectada automaticamente" #. i18n: ectx: Menu (file) #. +> trunk5 #: kileui.rc:12 #, kde-format msgid "&File" msgstr "&Ficheiro" #. i18n: ectx: Menu (convert) #. +> trunk5 #: kileui.rc:32 #, kde-format msgid "Con&vert To" msgstr "&Converter en" #. i18n: ectx: Menu (edit) #. +> trunk5 #: kileui.rc:53 widgets/abbreviationview.cpp:120 #, kde-format msgid "&Edit" msgstr "&Editar" #. i18n: ectx: Menu (goto_menu) #. +> trunk5 #: kileui.rc:60 #, kde-format msgid "&Go to" msgstr "&Ir a" #. i18n: ectx: Menu (complete) #. +> trunk5 #: kileui.rc:69 #, kde-format msgid "Co&mplete" msgstr "Co&mpletar" #. i18n: ectx: Menu (bullet) #. +> trunk5 #: kileui.rc:74 #, kde-format msgid "&Bullets" msgstr "&Viñetas" #. i18n: ectx: Menu (select) #. +> trunk5 #: kileui.rc:78 widgets/structurewidget.cpp:769 #, kde-format msgid "&Select" msgstr "E&scoller" #. i18n: ectx: Menu (delete) #. +> trunk5 #: kileui.rc:91 #, kde-format msgid "D&elete" msgstr "&Eliminar" #. i18n: ectx: Menu (environment) #. +> trunk5 #: kileui.rc:104 #, kde-format msgid "Environmen&t" msgstr "Ambien&te" #. i18n: ectx: Menu (texgroup) #. +> trunk5 #: kileui.rc:112 #, kde-format msgid "Te&X Group" msgstr "Grupo Te&X" #. i18n: ectx: Menu (view) #. i18n: ectx: Menu (menu_viewer) #. +> trunk5 #: kileui.rc:123 kileui.rc:153 #, kde-format msgid "&View" msgstr "&Vista" #. i18n: ectx: Menu (menu_document_viewer) #. i18n: ectx: property (title), widget (QGroupBox, documentViewerGroupBox) #. +> trunk5 #: kileui.rc:132 kileviewmanager.cpp:1153 widgets/appearanceconfigwidget.ui:55 #: widgets/generalconfigwidget.ui:156 #, kde-format msgid "Document Viewer" msgstr "Visor de documentos" #. i18n: ectx: Menu (menu_build) #. +> trunk5 #: kileui.rc:136 #, kde-format msgid "B&uild" msgstr "&Xerar" #. i18n: ectx: Menu (menu_compile) #. +> trunk5 #: kileui.rc:149 #, kde-format msgid "&Compile" msgstr "&Compilar" #. i18n: ectx: Menu (menu_convert) #. +> trunk5 #: kileui.rc:151 #, kde-format msgid "C&onvert" msgstr "C&onverter" #. i18n: ectx: Menu (menu_other) #. +> trunk5 #: kileui.rc:155 #, kde-format msgid "O&ther" msgstr "Ou&tro" #. i18n: ectx: Menu (menu_project) #. +> trunk5 #: kileui.rc:173 #, kde-format msgid "Pro&ject" msgstr "Pro&xecto" #. i18n: ectx: Menu (menu_latex) #. +> trunk5 #: kileui.rc:195 #, kde-format msgid "LaTe&X" msgstr "LaTe&X" #. i18n: ectx: Menu (menu_preamble) #. +> trunk5 #: kileui.rc:196 #, kde-format msgid "&Preamble" msgstr "&Preámbulo" #. i18n: ectx: Menu (menu_lists) #. +> trunk5 #: kileui.rc:210 #, kde-format msgid "Tables and Lists" msgstr "Táboas e listas" #. i18n: ectx: Menu (menu_sectioning) #. +> trunk5 #: kileui.rc:221 #, kde-format msgid "&Sectioning" msgstr "&Seccións" #. i18n: ectx: Menu (references) #. +> trunk5 #: kileui.rc:232 #, kde-format msgid "&References" msgstr "&Referencias" #. i18n: ectx: Menu (menu_environment) #. +> trunk5 #: kileui.rc:244 #, kde-format msgid "&Environment" msgstr "&Ambiente" #. i18n: ectx: Menu (menu_listenv) #. +> trunk5 #: kileui.rc:255 #, kde-format msgid "&List Environment" msgstr "Ambiente de &lista" #. i18n: ectx: Menu (menu_tabularenv) #. +> trunk5 #: kileui.rc:262 #, kde-format msgid "&Tabular Environment" msgstr "Ambiente &tabular" #. i18n: ectx: Menu (menu_floatenv) #. +> trunk5 #: kileui.rc:273 #, kde-format msgid "&Floating Environment" msgstr "Ambiente de &flutuantes" #. i18n: ectx: Menu (menu_code) #. +> trunk5 #: kileui.rc:277 #, kde-format msgid "&Code Environment" msgstr "Ambiente de &código" #. i18n: ectx: Menu (menu_math) #. +> trunk5 #: kileui.rc:285 #, kde-format msgid "&Math Commands" msgstr "Ordes &matemáticas" #. i18n: ectx: Menu (menu_mathbraces) #. +> trunk5 #: kileui.rc:295 #, kde-format msgid "Braces" msgstr "Chaves" #. i18n: ectx: Menu (menu_mathtext) #. +> trunk5 #: kileui.rc:313 #, kde-format msgid "AMS Text and Boxes" msgstr "Texto e caixas da AMS" #. i18n: ectx: Menu (menu_mathfrac) #. +> trunk5 #: kileui.rc:319 #, kde-format msgid "AMS Fraction" msgstr "Fracción da AMS" #. i18n: ectx: Menu (menu_mathbinom) #. +> trunk5 #: kileui.rc:324 #, kde-format msgid "AMS Binomial Expression" msgstr "Expresión binomial da AMS" #. i18n: ectx: Menu (menu_mathcommands) #. +> trunk5 #: kileui.rc:329 #, kde-format msgid "AMS Arrows" msgstr "Frechas da AMS" #. i18n: ectx: Menu (menu_mathfontstyles) #. +> trunk5 #: kileui.rc:334 #, kde-format msgid "Math &Font Styles" msgstr "Estilos de tipos de &letra matemáticos" #. i18n: ectx: Menu (menu_mathaccents) #. +> trunk5 #: kileui.rc:344 #, kde-format msgid "Math &Accents" msgstr "&Acentos matemáticos" #. i18n: ectx: Menu (menu_mathspaces) #. +> trunk5 #: kileui.rc:356 #, kde-format msgid "Math &Spaces" msgstr "&Espazos matemáticos" #. i18n: ectx: Menu (menu_mathenv) #. +> trunk5 #: kileui.rc:367 #, kde-format msgid "Standard Math &Environments" msgstr "&Ambientes matemáticos estándar" #. i18n: ectx: Menu (menu_mathamsenv) #. +> trunk5 #: kileui.rc:375 #, kde-format msgid "&AMS Math Environments" msgstr "Ambientes matemáticos da &AMS" #. i18n: ectx: Menu (menu_amsenv_align) #. +> trunk5 #: kileui.rc:376 #, kde-format msgid "&Align Environments" msgstr "&Aliñar os ambientes" #. i18n: ectx: Menu (menu_amsenv_center) #. +> trunk5 #: kileui.rc:389 #, kde-format msgid "&Center Environments" msgstr "&Centrar os ambientes" #. i18n: ectx: Menu (menu_amsenv_multiline) #. +> trunk5 #: kileui.rc:395 #, kde-format msgid "Multi &Line Environments" msgstr "Ambientes multi-&liña" #. i18n: ectx: Menu (menu_amsenv_matrix) #. +> trunk5 #: kileui.rc:401 #, kde-format msgid "&Matrix Environments" msgstr "Ambientes de &matrices" #. i18n: ectx: Menu (menu_fontstyles) #. +> trunk5 #: kileui.rc:417 #, kde-format msgid "&Font Styles" msgstr "&Estilos de tipos de letra" #. i18n: ectx: Menu (menu_fontfamily) #. +> trunk5 #: kileui.rc:427 #, kde-format msgid "Font Family" msgstr "Familia do tipo de letra" #. i18n: ectx: Menu (menu_fontseries) #. +> trunk5 #: kileui.rc:432 #, kde-format msgid "Font Series" msgstr "Series de tipos de letra" #. i18n: ectx: Menu (menu_fontshape) #. +> trunk5 #: kileui.rc:436 #, kde-format msgid "Font Shape" msgstr "Formas de tipos de letra" #. i18n: ectx: Menu (menu_spacing) #. +> trunk5 #: kileui.rc:443 #, kde-format msgid "Spa&cing" msgstr "&Espazado" #. i18n: ectx: Menu (menu_breaks) #. +> trunk5 #: kileui.rc:444 #, kde-format msgid "Page- and Linebreaks" msgstr "Quebras de páxina e de liña" #. i18n: ectx: Menu (menu_skips) #. +> trunk5 #: kileui.rc:451 #, kde-format msgid "Space" msgstr "Espazo" #. i18n: ectx: Menu (menu_rubberlength) #. +> trunk5 #: kileui.rc:462 #, kde-format msgid "Rubber Lengths" msgstr "Lonxitudes da goma" #. i18n: ectx: Menu (wizard) #. +> trunk5 #: kileui.rc:480 #, kde-format msgid "&Wizard" msgstr "&Asistente" #. i18n: ectx: Menu (help) #. +> trunk5 #: kileui.rc:507 #, kde-format msgid "&Help" msgstr "A&xuda" #. i18n: ectx: Menu (help_tex) #. +> trunk5 #: kileui.rc:511 #, kde-format msgid "TeX Documentation" msgstr "Documentación de TeX" #. i18n: ectx: ToolBar (mainToolBar) #. +> trunk5 #: kileui.rc:528 #, kde-format msgid "Main" msgstr "Principal" #. i18n: ectx: ToolBar (editToolBar) #. +> trunk5 #: kileui.rc:544 #, kde-format msgid "Edit" msgstr "Editar" #. +> trunk5 #: kileviewmanager.cpp:123 #, kde-format msgid "Show Cursor Position in Viewer" msgstr "Mostrar a posición do cursor no visor" #. +> trunk5 #: kileviewmanager.cpp:127 #, kde-format msgid "Synchronize Cursor Position with Viewer" msgstr "Sincronizar a posición do cursor co visor" #. +> trunk5 #: kileviewmanager.cpp:180 #, kde-format msgid "Paste as LaTe&X" msgstr "Pegar como LaTe&X" #. +> trunk5 #: kileviewmanager.cpp:184 #, kde-format msgid "Convert Selection to &LaTeX" msgstr "Converter a escolla a &LaTeX" #. +> trunk5 #: kileviewmanager.cpp:254 #, kde-format msgid "Show sorted list of opened documents" msgstr "Mostrar unha lista ordenada dos documentos abertos." #. +> trunk5 #: kileviewmanager.cpp:374 #, kde-format msgid "Could not create an editor view." msgstr "Non se puido crear unha vista do editor." #. +> trunk5 #: kileviewmanager.cpp:374 #, kde-format msgid "Fatal Error" msgstr "Erro fatal" #. +> trunk5 #: kileviewmanager.cpp:835 #, kde-format msgid "&QuickPreview Selection" msgstr "Escolla de vista &previa rápida" #. +> trunk5 #: kileviewmanager.cpp:836 #, kde-format msgid "&QuickPreview Environment" msgstr "Ambiente de vista &previa rápida" #. +> trunk5 #: kileviewmanager.cpp:837 #, kde-format msgid "&QuickPreview Math" msgstr "&Vista previa rápida das matemáticas" #. +> trunk5 #: kileviewmanager.cpp:1126 #, kde-format msgid "Print Compiled Document..." msgstr "Imprimir un documento compilado…" #. +> trunk5 #: kileviewmanager.cpp:1132 #, kde-format msgid "Print Preview For Compiled Document..." msgstr "Visión previa do documento compilado…" #. +> trunk5 #: livepreview.cpp:188 #, kde-format msgid "Live Preview for Current Document or Project" msgstr "Previsualización ao vivo do documento ou proxecto actuais" #. +> trunk5 #: livepreview.cpp:193 #, kde-format msgid "Recompile Live Preview" msgstr "Recompilar a previsualización ao vivo" #. +> trunk5 #: livepreview.cpp:198 #, kde-format msgid "Save Compiled Document..." msgstr "Gardar o documento compilado…" #. +> trunk5 #: livepreview.cpp:905 #, kde-format msgid "Some documents could not be saved correctly" msgstr "Non se puido gardar correctamente algúns documentos" #. +> trunk5 #: livepreview.cpp:911 #, kde-format -msgid "The document must have been saved before the live preview can be started" +msgid "" +"The document must have been saved before the live preview can be started" msgstr "Hai que gardar o documentos antes de poder iniciar a vista previa" #. +> trunk5 #: livepreview.cpp:937 #, kde-format msgid "" -"The location of one project item is not relative to the project's base directory\n" +"The location of one project item is not relative to the project's base" +" directory\n" "Live preview for this project has been disabled" -msgstr "O lugar no que está un dos elementos do proxecto non é relativo ao directorio base do proxecto Desactivouse a previsualización ao vivo para este proxecto" +msgstr "" +"O lugar no que está un dos elementos do proxecto non é relativo ao directorio" +" base do proxecto Desactivouse a previsualización ao vivo para este proxecto" #. +> trunk5 #: livepreview.cpp:941 #, kde-format msgid "Failed to create the subdirectory structure" msgstr "Non se puido crear a estrutura do subdirectorio" #. +> trunk5 #: livepreview.cpp:1401 #, kde-format msgid "LivePreview" msgstr "Previsualización ao vivo" #. +> trunk5 #: main.cpp:62 #, kde-format msgid "StandardInput.tex" msgstr "StandardInput.tex" #. +> trunk5 #: main.cpp:107 #, kde-format msgid "KDE Integrated LaTeX Environment" msgstr "Ambiente de LaTeX integrado para KDE" #. +> trunk5 #: main.cpp:109 #, kde-format msgctxt "the parameter is the last copyright year" msgid "by the Kile Team (2003 - %1)" msgstr "polo equipo de Kile (2003-%1)" #. +> trunk5 #: main.cpp:112 #, kde-format msgid "Michel Ludwig" msgstr "Michel Ludwig" #. +> trunk5 #: main.cpp:112 #, kde-format msgid "Project Management/Developer" msgstr "Xestión do proxecto/Desenvolvedor" #. +> trunk5 #: main.cpp:113 #, kde-format msgid "Holger Danielsson" msgstr "Holger Danielsson" #. +> trunk5 #: main.cpp:113 #, kde-format msgid "Developer" msgstr "Desenvolvedor" #. +> trunk5 #: main.cpp:114 #, kde-format msgid "Thomas Braun" msgstr "Thomas Braun" #. +> trunk5 #: main.cpp:114 #, kde-format msgid "Former Developer" msgstr "Antigo desenvolvedor" #. +> trunk5 #: main.cpp:115 #, kde-format msgid "Jeroen Wijnhout" msgstr "Jeroen Wijnhout" #. +> trunk5 #: main.cpp:115 #, kde-format msgid "Former Maintainer/Developer" msgstr "Antigo mantedor/desenvolvedor" #. +> trunk5 #: main.cpp:116 #, kde-format msgid "Brachet Pascal" msgstr "Brachet Pascal" #. +> trunk5 #: main.cpp:118 #, kde-format msgid "Andrius Štikonas" msgstr "Andrius Štikonas" #. +> trunk5 #: main.cpp:118 #, kde-format msgid "Migration from Subversion to Git" msgstr "Migración desde Subversion para Git" #. +> trunk5 #: main.cpp:119 #, kde-format msgid "Simon Martin" msgstr "Simon Martin" #. +> trunk5 #: main.cpp:119 #, kde-format msgid "KConfig XT, Various Improvements and Bug-Fixing" msgstr "KConfig XT, varias melloras e corrección de fallos" #. +> trunk5 #: main.cpp:120 #, kde-format msgid "Roland Schulz" msgstr "Roland Schulz" #. +> trunk5 #: main.cpp:120 #, kde-format msgid "KatePart Integration" msgstr "Integración de KatePart" #. +> trunk5 #: main.cpp:121 #, kde-format msgid "Thorsten Lück" msgstr "Thorsten Lück" #. +> trunk5 #: main.cpp:121 #, kde-format msgid "Log Parsing" msgstr "Interpretación do rexistro" #. +> trunk5 #: main.cpp:122 #, kde-format msgid "Jan-Marek Glogowski" msgstr "Jan-Marek Glogowski" #. +> trunk5 #: main.cpp:122 #, kde-format msgid "Find-in-Files Dialog" msgstr "Diálogo de atopar en ficheiros" #. +> trunk5 #: main.cpp:123 #, kde-format msgid "Jonathan Pechta" msgstr "Jonathan Pechta" #. +> trunk5 #: main.cpp:123 main.cpp:124 #, kde-format msgid "Documentation" msgstr "Documentación" #. +> trunk5 #: main.cpp:124 #, kde-format msgid "Federico Zenith" msgstr "Federico Zenith" #. +> trunk5 #: main.cpp:142 #, kde-format msgid "Jump to line" msgstr "Saltar á liña" #. +> trunk5 #: main.cpp:143 #, kde-format msgid "Start a new Kile mainwindow" msgstr "Iniciar unha nova xanela principal de Kile" #. +> trunk5 #: main.cpp:145 #, kde-format msgid "Files to open / specify '-' to read from standard input" msgstr "Ficheiros para abrir. Indique «-» para ler da entrada estándar." #. +> trunk5 #: main.cpp:176 #, kde-format msgid "" "Kile cannot start as a recent version the Okular library could not be found.\n" "\n" "Please install the Okular library before running Kile." msgstr "" -"Kile non pode iniciarse porque non se puido atopar unha versión recente da biblioteca de Okular.\n" +"Kile non pode iniciarse porque non se puido atopar unha versión recente da" +" biblioteca de Okular.\n" "\n" "Instale a biblioteca de Okular antes de executar Kile." #. +> trunk5 #: main.cpp:178 #, kde-format msgid "Okular library not found" msgstr "Non se atopou a biblioteca de Okular." #. +> trunk5 #: parser/latexparser.cpp:211 parser/latexparser.cpp:239 #, kde-format msgid "Frame" msgstr "Marco" #. +> trunk5 #: parser/latexparser.cpp:254 #, kde-format msgid "Untitled Block" msgstr "Bloque sen título" #. +> trunk5 #: quickpreview.cpp:42 #, kde-format msgid "LaTeX ---> DVI (Okular)" msgstr "LaTeX ---> DVI (Okular)" #. +> trunk5 #: quickpreview.cpp:43 #, kde-format msgid "LaTeX ---> DVI (Document Viewer)" msgstr "LaTeX ---> DVI (Visor de documentos)" #. +> trunk5 #: quickpreview.cpp:44 #, kde-format msgid "LaTeX ---> PS (Okular)" msgstr "LaTeX ---> PS (Okular)" #. +> trunk5 #: quickpreview.cpp:45 #, kde-format msgid "LaTeX ---> PS (Document Viewer)" msgstr "LaTeX ---> PS (Visor de documentos)" #. +> trunk5 #: quickpreview.cpp:46 #, kde-format msgid "PDFLaTeX ---> PDF (Okular)" msgstr "PDFLaTeX ---> PDF (Okular)" #. +> trunk5 #: quickpreview.cpp:47 #, kde-format msgid "PDFLaTeX ---> PDF (Document Viewer)" msgstr "PDFLaTeX ---> PDF (Visor de documentos)" #. +> trunk5 #: quickpreview.cpp:48 #, kde-format msgid "XeLaTeX ---> PDF (Okular)" msgstr "XeLaTeX ---> PDF (Okular)" #. +> trunk5 #: quickpreview.cpp:49 #, kde-format msgid "XeLaTeX ---> PDF (Document Viewer)" msgstr "XeLaTeX ---> PDF (Visor de documentos)" #. +> trunk5 #: quickpreview.cpp:50 #, kde-format msgid "LuaLaTeX ---> PDF (Okular)" msgstr "LuaLaTeX ---> PDF (Okular)" #. +> trunk5 #: quickpreview.cpp:51 #, kde-format msgid "LuaLaTeX ---> PDF (Document Viewer)" msgstr "LuaLaTeX ---> PDF (Visor de documentos)" #. +> trunk5 #: quickpreview.cpp:78 #, kde-format msgid "There is no selection to compile." msgstr "Non hai ningunha selección que compilar." #. +> trunk5 #: quickpreview.cpp:105 #, kde-format msgid "There is no surrounding environment." msgstr "Non hai un ambiente envolvente." #. +> trunk5 #: quickpreview.cpp:115 #, kde-format msgid "This job is only useful with a master document." msgstr "Esta tarefa só é útil cun documento mestre." #. +> trunk5 #: quickpreview.cpp:122 #, kde-format msgid "This is not a subdocument, but the master document." msgstr "Este non é un subdocumento, senón o documento mestre." #. +> trunk5 #: quickpreview.cpp:144 #, kde-format msgid "There is no surrounding mathgroup." msgstr "Non hai grupo matemático envolvente." #. +> trunk5 #: quickpreview.cpp:189 #, kde-format msgid "" "Could not run QuickPreview:\n" "unknown task '%1'" msgstr "" "Non se puido executar a vista previa rápida:\n" "tarefa descoñecida «%1»" #. +> trunk5 #: quickpreview.cpp:201 widgets/previewwidget.cpp:129 #, kde-format -msgid "There is already a preview running that has to be finished to run this one." -msgstr "Xa se está a executar unha previsualización, que deberá rematar para executar esta." +msgid "" +"There is already a preview running that has to be finished to run this one." +msgstr "" +"Xa se está a executar unha previsualización, que deberá rematar para executar" +" esta." #. +> trunk5 #: quickpreview.cpp:207 #, kde-format msgid "There is nothing to compile and preview." msgstr "Non hai nada para compilar e previsualizar." #. +> trunk5 #: quickpreview.cpp:229 quickpreview.cpp:239 quickpreview.cpp:250 #: widgets/previewwidget.cpp:181 #, kde-format msgid "Could not run '%1' for QuickPreview." msgstr "Non se puido executar «%1» para a vista previa rápida." #. +> trunk5 #: quickpreview.cpp:321 #, kde-format msgid "Could not determine the main document." msgstr "Non se puido determinar o documento principal." #. +> trunk5 #: quickpreview.cpp:328 #, kde-format msgid "Could not read the preamble." msgstr "Non se puido ler o preámbulo." #. +> trunk5 #: quickpreview.cpp:368 #, kde-format msgid "Could not find a '\\begin{document}' command." msgstr "Non se puido atopar unha orde «\\begin{document}»." #. +> trunk5 #: quickpreview.cpp:386 widgets/previewwidget.cpp:238 #, kde-format msgid "QuickPreview" msgstr "Vista previa rápida" #. +> trunk5 #: scripting/kilescriptobject.cpp:42 #, kde-format msgid "Script: information" msgstr "Script: información" #. +> trunk5 #: scripting/kilescriptobject.cpp:48 #, kde-format msgid "Script: sorry" msgstr "Script: desculpas" #. +> trunk5 #: scripting/kilescriptobject.cpp:54 #, kde-format msgid "Script: error" msgstr "Script: erro" #. +> trunk5 #: scripting/kilescriptobject.cpp:60 #, kde-format msgid "Script: question" msgstr "Script: pregunta" #. +> trunk5 #: scripting/kilescriptobject.cpp:66 #, kde-format msgid "Script: warning" msgstr "Script: advertencia" #. +> trunk5 #: scripting/kilescriptobject.cpp:116 #, kde-format msgid "Enter Value" msgstr "Insira o valor" #. +> trunk5 #: scripting/kilescriptobject.cpp:119 #, kde-format msgid "Please enter a value" msgstr "Insira un valor" #. +> trunk5 #: scripting/kilescriptobject.cpp:194 #, kde-format msgid "Script '%1.js'" msgstr "Script '%1.js'" #. +> trunk5 #: scripting/kilescriptobject.cpp:213 #, kde-format msgid "File Handling Error: Unable to find the file '%1'" msgstr "Erro na xestión de ficheiros: Non se pode atopar o ficheiro «%1»" #. +> trunk5 #: scripting/kilescriptobject.cpp:233 scripting/kilescriptobject.cpp:290 #, kde-format msgid "Select File to Read" msgstr "Escoller os ficheiros que ler" #. +> trunk5 #: scripting/kilescriptobject.cpp:249 #, kde-format msgid "File Handling Error: Unable to create the output file '%1'" -msgstr "Erro na xestión de ficheiros: Non se pode crear o ficheiro de saída «%1»" +msgstr "" +"Erro na xestión de ficheiros: Non se pode crear o ficheiro de saída «%1»" #. +> trunk5 #: scripting/kilescriptobject.cpp:260 #, kde-format msgid "File Handling Error: Unable to write to the output file '%1'" -msgstr "Erro na xestión de ficheiros: Non se pode escribir no ficheiro de saída «%1»" +msgstr "" +"Erro na xestión de ficheiros: Non se pode escribir no ficheiro de saída «%1»" #. +> trunk5 #: scripting/kilescriptobject.cpp:278 scripting/kilescriptobject.cpp:296 #, kde-format msgid "Save As" msgstr "Gardar como" #. +> trunk5 #: scripting/kilescriptobject.cpp:303 #, kde-format msgid "This action was canceled by the user." msgstr "O usuario cancelou esta acción." #. +> trunk5 #: scripting/script.cpp:204 #, kde-format msgid "Unable to find '%1'" msgstr "Non se pode atopar «%1»" #. +> trunk5 #: scripting/script.cpp:239 scripting/script.cpp:242 #, kde-format msgid "Cursor/Range plugin" msgstr "Complemento Cursor/Intervalo" #. +> trunk5 #: scripting/script.cpp:295 #, kde-format msgid "" "An error has occurred at line %1 during the execution of the script \"%2\":\n" "%3" msgstr "" "Produciuse un erro na liña %1 durante a execución do script «%2»:\n" "%3" #. +> trunk5 #: scripting/script.cpp:296 #, kde-format msgid "Error" msgstr "Erro" #. +> trunk5 #: scriptmanager.cpp:97 #, kde-format -msgid "Version %1 of Kile is at least required to execute the script \"%2\". The execution has been aborted." -msgstr "Requírese a versión %1 de Kile ou máis moderna para executar o script «%2». Interrompeuse a execución." +msgid "" +"Version %1 of Kile is at least required to execute the script \"%2\". The" +" execution has been aborted." +msgstr "" +"Requírese a versión %1 de Kile ou máis moderna para executar o script «%2»." +" Interrompeuse a execución." #. +> trunk5 #: scriptmanager.cpp:97 #, kde-format msgid "Version Error" msgstr "Erro de versión" #. +> trunk5 #: scriptmanager.cpp:105 #, kde-format msgid "Cannot start the script: no view available" msgstr "Non se pode iniciar o script: non hai vista dispoñíbel" #. +> trunk5 #: scriptmanager.cpp:105 #, kde-format msgid "Script Error" msgstr "Erro do script" #. +> trunk5 #: scriptmanager.cpp:451 #, kde-format msgid "Execution of %1" msgstr "Execución de %1" #. +> trunk5 #: templates.cpp:90 #, kde-format msgid "" "Could not find a folder to save %1 to.\n" -"Check whether you have a .kde folder with write permissions in your home folder." +"Check whether you have a .kde folder with write permissions in your home" +" folder." msgstr "" "Non se puido atopar un cartafol no que gardar %1.\n" -"Comprobe que teña un cartafol .kde, con permisos de escritura, no cartafol persoal." +"Comprobe que teña un cartafol .kde, con permisos de escritura, no cartafol" +" persoal." #. +> trunk5 #: templates.cpp:233 #, kde-format msgid "Empty File" msgstr "Ficheiro baleiro" #. +> trunk5 #: templates.cpp:238 #, kde-format msgid "Empty LaTeX File" msgstr "Ficheiro de LaTeX baleiro" #. +> trunk5 #: templates.cpp:243 #, kde-format msgid "Empty BibTeX File" msgstr "Ficheiro de BibTeX baleiro" #. +> trunk5 #: tool_utils.cpp:61 #, kde-format msgctxt " - " msgid "%1 - %2" msgstr "%1 - %2" #. +> trunk5 #: userhelp.cpp:151 #, kde-format msgid "The file '%1' does not exist." msgstr "O ficheiro %1 non existe." #. +> trunk5 #: usermenu/usermenu.cpp:919 #, kde-format msgid "Input Dialog" msgstr "Diálogo de entrada" #. +> trunk5 #: widgets/abbreviationview.cpp:38 #, kde-format msgid "Short" msgstr "Curto" #. +> trunk5 #: widgets/abbreviationview.cpp:38 #, kde-format msgid "Expanded Text" msgstr "Texto expandido" #. i18n: ectx: property (text), widget (QPushButton, m_pshbAdd) #. +> trunk5 #: widgets/abbreviationview.cpp:111 widgets/quicktoolconfigwidget.ui:91 #, kde-format msgid "&Add" msgstr "Eng&adir" #. +> trunk5 #: widgets/abbreviationview.cpp:124 widgets/structurewidget.cpp:770 #, kde-format msgid "&Delete" msgstr "&Eliminar" #. +> trunk5 #: widgets/abbreviationview.cpp:173 #, kde-format msgid "Delete the abbreviation '%1'?" msgstr "Desexa eliminar a abreviatura «%1»?" #. +> trunk5 #: widgets/abbreviationview.cpp:176 #, kde-format msgid "Delete Abbreviation" msgstr "Eliminar a abreviatura" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetAppearanceConfig) #. +> trunk5 #: widgets/appearanceconfigwidget.ui:14 #, kde-format msgid "Appearance Configuration" msgstr "Configuración da aparencia" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ShowFullPathInWindowTitle) #. +> trunk5 #: widgets/appearanceconfigwidget.ui:29 #, kde-format msgid "Show full path in window title" msgstr "Mostrar a ruta completa no título da xanela" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ShowSplashScreen) #. +> trunk5 #: widgets/appearanceconfigwidget.ui:36 #, kde-format msgid "Show splash screen on startup" msgstr "Mostrar a pantalla de benvida ao arrincar" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ShowDocumentViewerInExternalWindow) #. +> trunk5 #: widgets/appearanceconfigwidget.ui:67 #, kde-format msgid "Show in external window" msgstr "Mostrar nunha xanela á parte" #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:53 #, kde-format msgid "TeX/LaTeX" msgstr "TeX/LaTeX" #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:54 #, kde-format msgid "Dictionary" msgstr "Dicionario" #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:57 #, kde-format msgid "Try to place the cursor." msgstr "Intentar situar o cursor." #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:58 #, kde-format msgid "Insert bullets where the user must input data." msgstr "Inserir viñetas onde o usuario deba inserir datos." #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:59 #, kde-format msgid "Also close an environment when an opening command is inserted." msgstr "Pechar tamén un ambiente ao inserir unha orde de apertura." #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:60 #, kde-format -msgid "Directional or popup-based completion of the TeX/LaTeX commands that are contained in the selected completion files." -msgstr "Completado direccional ou baseada en menús emerxentes con ordes TeX/LaTeX que estean contidos nos ficheiros de completado escollidos." +msgid "" +"Directional or popup-based completion of the TeX/LaTeX commands that are" +" contained in the selected completion files." +msgstr "" +"Completado direccional ou baseada en menús emerxentes con ordes TeX/LaTeX que" +" estean contidos nos ficheiros de completado escollidos." #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:61 #, kde-format -msgid "Automatically show a completion list of TeX/LaTeX commands when the word has this length." -msgstr "Mostra automaticamente unha lista de completado da ordes TeX/LaTeX cando a palabra teña este tamaño." +msgid "" +"Automatically show a completion list of TeX/LaTeX commands when the word has" +" this length." +msgstr "" +"Mostra automaticamente unha lista de completado da ordes TeX/LaTeX cando a" +" palabra teña este tamaño." #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:63 #, kde-format msgid "Show abbreviations of the selected completion files in the sidebar" -msgstr "Mostrar as abreviaturas dos ficheiros de completado escollidos na barra lateral" +msgstr "" +"Mostrar as abreviaturas dos ficheiros de completado escollidos na barra" +" lateral" #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:64 #, kde-format -msgid "Directional or popup-based completion of abbreviations that are contained in the selected completion files." -msgstr "Completado direccional ou baseada en menús emerxentes de abreviaturas que estean contidas nos ficheiros de completado escollidos." +msgid "" +"Directional or popup-based completion of abbreviations that are contained in" +" the selected completion files." +msgstr "" +"Completado direccional ou baseada en menús emerxentes de abreviaturas que" +" estean contidas nos ficheiros de completado escollidos." #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:65 #, kde-format msgid "Show LaTeX commands of the selected completion files in the sidebar" -msgstr "Mostrar as ordes de LaTeX dos ficheiros de completado escollidos na barra lateral" +msgstr "" +"Mostrar as ordes de LaTeX dos ficheiros de completado escollidos na barra" +" lateral" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:95 #: widgets/codecompletionconfigwidget.cpp:330 #: widgets/codecompletionconfigwidget.ui:99 #, kde-format msgid "Completion Files" msgstr "Ficheiros de completado" #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:207 #, kde-format msgid "File not found" msgstr "Non se atopou o ficheiro" #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:278 #, kde-format msgid "Wordlist '%1' contains duplicate entries." msgstr "A lista de palabras «%1» contén entradas duplicadas." #. +> trunk5 #: widgets/codecompletionconfigwidget.cpp:278 #, kde-format msgid "Completion" msgstr "Completado" #. i18n: ectx: property (title), widget (QGroupBox, cb_autocomplete) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:23 #, kde-format msgid "Auto completion for &LaTeX markup" msgstr "Completado automático da linguaxe de marcación &LaTeX" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:37 #, kde-format msgid "Threshold:" msgstr "Limiar:" #. i18n: ectx: property (text), widget (QLabel, label_2) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:57 #, kde-format msgid "letters" msgstr "letras" #. i18n: ectx: property (title), widget (QGroupBox, cb_autocompleteabbrev) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:82 #, kde-format msgid "A&uto completion for abbreviations" msgstr "Completado a&utomático das abreviaturas" #. i18n: ectx: property (text), widget (QPushButton, m_addFileButton) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:133 #, kde-format msgid "Add..." msgstr "Engadir…" #. i18n: ectx: property (text), widget (QPushButton, m_removeFileButton) #. i18n: ectx: property (text), widget (QPushButton, m_pbRemove) #. i18n: ectx: property (text), widget (QPushButton, m_pshbRemoveTool) #. i18n: ectx: property (text), widget (QPushButton, m_pshbRemoveConfig) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:140 #: widgets/maintoolconfigwidget.ui:101 widgets/maintoolconfigwidget.ui:222 #: widgets/usermenuconfigwidget.ui:115 #, kde-format msgid "Remove" msgstr "Retirar" #. i18n: ectx: property (text), widget (QCheckBox, cb_showcwlview) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:162 #, kde-format msgid "Show LaTeX commands" msgstr "Mostrar as ordes de LaTeX:" #. i18n: ectx: property (text), widget (QCheckBox, cb_showabbrevview) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:172 #, kde-format msgid "Show abbreviations" msgstr "Mostrar as abreviaturas" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_3) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:182 #, kde-format msgid "Completion Properties" msgstr "Propiedades do completado" #. i18n: ectx: property (text), widget (QCheckBox, cb_setcursor) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:191 #, kde-format msgid "Place cursor" msgstr "Situar o cursor" #. i18n: ectx: property (text), widget (QCheckBox, cb_closeenv) #. +> trunk5 #: widgets/codecompletionconfigwidget.ui:205 #, kde-format msgid "Close environments" msgstr "Pechar os ambientes" #. i18n: ectx: property (windowTitle), widget (QWidget, ConfigCheckerWidget) #. +> trunk5 #: widgets/configcheckerwidget.ui:26 #, kde-format msgid "Performing System Check" msgstr "Estase a facer unha comprobación do sistema" #. i18n: ectx: property (text), widget (QLabel, m_lbChecking) #. +> trunk5 #: widgets/configcheckerwidget.ui:32 #, kde-format msgid "Checking if your TeX system is installed correctly..." msgstr "Estase a comprobar se o sistema TeX está correctamente instalado…" #. i18n: ectx: property (title), widget (QGroupBox, m_grpResults) #. +> trunk5 #: widgets/configcheckerwidget.ui:55 #, kde-format msgid "Results" msgstr "Resultados" #. i18n: ectx: property (title), widget (QGroupBox, m_bgEnv) #. +> trunk5 #: widgets/environmentconfigwidget.ui:32 #, kde-format msgid "Complete Environments" msgstr "Ambientes completos" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_CompleteEnvironment) #. +> trunk5 #: widgets/environmentconfigwidget.ui:41 #, kde-format msgid "Automatically complete \\begin{env} with \\end{env}" msgstr "Completar automaticamente \\begin{env} con \\end{env}" #. i18n: ectx: property (title), widget (QGroupBox, m_bgGraphics) #. +> trunk5 #: widgets/environmentconfigwidget.ui:57 #, kde-format msgid "Automatic Indentation Inside Environments" msgstr "Sangrado automático nos ambientes" #. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_envIndentation) #. +> trunk5 #: widgets/environmentconfigwidget.ui:66 #, kde-format msgid "Enable auto indentation of environments." msgstr "Activar o sangrado automático dos ambientes." #. i18n: ectx: property (text), widget (QCheckBox, kcfg_envIndentation) #. +> trunk5 #: widgets/environmentconfigwidget.ui:69 #, kde-format msgid "Activated" msgstr "Activado" #. i18n: ectx: property (whatsThis), widget (QCheckBox, kcfg_envIndentSpaces) #. +> trunk5 #: widgets/environmentconfigwidget.ui:76 #, kde-format msgid "Use spaces instead of a tabulator to autoindent environments." -msgstr "Empregar espazos no canto do tabulador para sangrar automaticamente os ambientes." +msgstr "" +"Empregar espazos no canto do tabulador para sangrar automaticamente os" +" ambientes." #. i18n: ectx: property (text), widget (QCheckBox, kcfg_envIndentSpaces) #. +> trunk5 #: widgets/environmentconfigwidget.ui:79 #, kde-format msgid "Use spaces instead of tabs to indent" msgstr "Empregar espazos no canto do tabulador para sangrar" #. i18n: ectx: property (text), widget (QLabel, m_lbNumSpaces) #. +> trunk5 #: widgets/environmentconfigwidget.ui:88 #, kde-format msgid "&Number of spaces:" msgstr "&Número de espazos:" #. i18n: ectx: property (whatsThis), widget (QSpinBox, kcfg_envIndentNumSpaces) #. +> trunk5 #: widgets/environmentconfigwidget.ui:129 #, kde-format msgid "Use this number of spaces to autoindent environments." -msgstr "Empregar este número de espazos para sangrar automaticamente os ambientes." +msgstr "" +"Empregar este número de espazos para sangrar automaticamente os ambientes." #. +> trunk5 #: widgets/filebrowserwidget.cpp:118 #, kde-format msgid "Open selected" msgstr "Abrir o escollido" #. +> trunk5 #: widgets/filebrowserwidget.cpp:123 #, kde-format msgid "Show LaTeX Files Only" msgstr "Só mostrar ficheiros LaTeX" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. +> trunk5 #: widgets/filebrowserwidget.cpp:129 widgets/structureviewconfigwidget.ui:128 #, kde-format msgid "Options" msgstr "Opcións" #. i18n: ectx: property (text), widget (QLabel, textLabel2_2) #. +> trunk5 #: widgets/generalconfigwidget.ui:43 #, kde-format msgid "&Default project location:" msgstr "Localización do &proxecto predeterminado:" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_Restore) #. +> trunk5 #: widgets/generalconfigwidget.ui:64 #, kde-format msgid "&Reopen files and projects on startup" msgstr "&Abrir os ficheiros e proxectos ao arrancar" #. i18n: ectx: property (title), widget (QGroupBox, groupBox3) #. +> trunk5 #: widgets/generalconfigwidget.ui:74 #, kde-format msgid "Template Variables" msgstr "Variábeis do modelo" #. i18n: ectx: property (text), widget (QLabel, textLabel3) #. +> trunk5 #: widgets/generalconfigwidget.ui:92 #, kde-format msgid "A&uthor:" msgstr "A&utor:" #. i18n: ectx: property (text), widget (QLabel, textLabel4) #. +> trunk5 #: widgets/generalconfigwidget.ui:105 #, kde-format msgid "Document c&lass options:" msgstr "Opcións da c&lase de documento:" #. i18n: ectx: property (text), widget (QLabel, textLabel5) #. +> trunk5 #: widgets/generalconfigwidget.ui:118 #, kde-format msgid "I&nput encoding:" msgstr "Codificación da e&ntrada:" #. i18n: ectx: property (title), widget (QGroupBox, groupBox4) #. +> trunk5 #: widgets/generalconfigwidget.ui:134 #, kde-format msgid "File Clean-Up Details" msgstr "Detalles da limpeza de ficheiros" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_CleanUpAfterClose) #. +> trunk5 #: widgets/generalconfigwidget.ui:143 #, kde-format msgid "Automatically clean-up files after closing Kile" msgstr "Limpar automaticamente os ficheiros despois de pechar" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_WatchFileForDocumentViewer) #. +> trunk5 #: widgets/generalconfigwidget.ui:165 #, kde-format msgid "Reload document automatically after changes" msgstr "Cargar o ficheiro automaticamente despois dos cambios" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SyncConsoleDirWithTabs) #. +> trunk5 #: widgets/generalconfigwidget.ui:175 #, kde-format msgid "Synchronize the directory shown in the console with the document tabs" -msgstr "Sincronizar o directorio que se mostra na consola coas lapelas do documento" +msgstr "" +"Sincronizar o directorio que se mostra na consola coas lapelas do documento" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_RunLyxServer) #. +> trunk5 #: widgets/generalconfigwidget.ui:182 #, kde-format msgid "Let Kile process LyX commands sent by bibliography editors/viewers" -msgstr "Permitir que Kile procese as ordes de LyX enviadas polos editores/visores de bibliografías" +msgstr "" +"Permitir que Kile procese as ordes de LyX enviadas polos editores/visores de" +" bibliografías" #. i18n: ectx: property (text), widget (QLabel, m_tlResolution) #. +> trunk5 #: widgets/graphicsconfigwidget.ui:29 #, kde-format msgid "&Default resolution:" msgstr "Resolución pre&determinada:" #. i18n: ectx: property (text), widget (QLabel, m_tlResolutionHelp) #. +> trunk5 #: widgets/graphicsconfigwidget.ui:51 #, kde-format msgid "(used when the picture offers no resolution)" msgstr "(emprégase se a imaxe non indica a resolución)" #. i18n: ectx: property (text), widget (QLabel, m_tlBbox) #. +> trunk5 #: widgets/graphicsconfigwidget.ui:61 #, kde-format msgid "Bo&unding box:" msgstr "&Caixa contedora:" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_boundingbox) #. +> trunk5 #: widgets/graphicsconfigwidget.ui:80 #, kde-format msgid "Tr&y to determine from the picture" msgstr "Intentar determinala a partir da &imaxe" #. i18n: ectx: property (text), widget (QLabel, m_tlBBoxHelp) #. +> trunk5 #: widgets/graphicsconfigwidget.ui:93 #, kde-format msgid "(you have to install the ImageMagick package to use this option)" msgstr "(debe instalar o paquete ImageMagick para empregar esta opción)" #. i18n: ectx: property (text), widget (QLabel, m_tlImageMagick) #. +> trunk5 #: widgets/graphicsconfigwidget.ui:103 #, kde-format msgid "ImageMagick:" msgstr "ImageMagick:" #. +> trunk5 #: widgets/helpconfigwidget.cpp:62 #, kde-format msgid "" -"

(La)TeX distributions use various locations for the base directory of the documentation files that they provide.
" +"

(La)TeX distributions use various locations for the base directory of the" +" documentation files that they provide.
" "Here are some suggestions:

" "
    " "
  • Debian: /usr/share/doc/texlive-doc
    • " "
  • Ubuntu: /usr/share/doc/texlive-doc
    • " "
  • OpenSuse: /usr/share/texmf/doc
    • " "
  • TexLive 2009: /usr/share/doc/texlive-doc
    • " "
  • TexLive 2010 (TUG): /usr/local/texlive/2010/texmf-dist/doc
    • " "
  • TexLive 2011 (TUG): /usr/local/texlive/2011/texmf-dist/doc
    • " "
" -"

Additionally, if you use TeXLive 2010 or above, the comprehensive collection of links to documentation topics
" -"that can be found in the top-level file doc.html may be helpful (/usr/local/texlive/2011/doc.html or similar).
" -"You may want to consider placing it in the User Help section of the help menu.

" +"

Additionally, if you use TeXLive 2010 or above, the comprehensive" +" collection of links to documentation topics
" +"that can be found in the top-level file doc.html may be helpful" +" (/usr/local/texlive/2011/doc.html or similar).
" +"You may want to consider placing it in the User Help section of the" +" help menu.

" msgstr "" -"

As distribucións de (La)TeX) empregar lugares distintos como directorio base dos ficheiros de documentación que fornecen.
" +"

As distribucións de (La)TeX) empregar lugares distintos como directorio" +" base dos ficheiros de documentación que fornecen.
" "Velaquí algunhas suxestións:

" "
    " "
  • Debian: /usr/share/doc/texlive-doc
    • " "
  • Ubuntu: /usr/share/doc/texlive-doc
    • " "
  • OpenSuse: /usr/share/texmf/doc
    • " "
  • TexLive 2009: /usr/share/doc/texlive-doc
    • " "
  • TexLive 2010 (TUG): /usr/local/texlive/2010/texmf-dist/doc
    • " "
  • TexLive 2011 (TUG): /usr/local/texlive/2011/texmf-dist/doc
    • " "
" -"

Alén disto, se emprega TeXLive 2010 ou posterior, a colección completa de ligazóns aos temas de documentación
" -"que se poden atopar no ficheiro de nivel superior doc.html poden resultar útiles (/usr/local/texlive/2011/doc.html ou similar).
" -"Debería considerar colocalo na sección Axuda ao usuario do menú de axuda.

" +"

Alén disto, se emprega TeXLive 2010 ou posterior, a colección completa de" +" ligazóns aos temas de documentación
" +"que se poden atopar no ficheiro de nivel superior doc.html poden" +" resultar útiles (/usr/local/texlive/2011/doc.html ou similar)." +"
" +"Debería considerar colocalo na sección Axuda ao usuario do menú de" +" axuda.

" #. +> trunk5 #: widgets/helpconfigwidget.cpp:78 #, kde-format msgid "Location of Documentation Files" msgstr "Localización dos ficheiros da documentación" #. i18n: ectx: property (whatsThis), widget (QLabel, m_lbLocation) #. +> trunk5 #: widgets/helpconfigwidget.ui:28 #, kde-format -msgid "Insert the path to the TeX documentation directory here. For example /usr/share/texmf/doc." -msgstr "Insira aquí a ruta ao directorio coa documentación de TeX. Por exemplo /usr/share/texmf/doc." +msgid "" +"Insert the path to the TeX documentation directory here. For example" +" /usr/share/texmf/doc." +msgstr "" +"Insira aquí a ruta ao directorio coa documentación de TeX. Por exemplo" +" /usr/share/texmf/doc." #. i18n: ectx: property (text), widget (QLabel, m_lbLocation) #. +> trunk5 #: widgets/helpconfigwidget.ui:31 #, kde-format msgid "&Location of TeX documentation:" msgstr "&Localización da documentación de TeX:" #. i18n: ectx: property (text), widget (QPushButton, m_pbInformation) #. +> trunk5 #: widgets/helpconfigwidget.ui:63 #, kde-format msgid "Information" msgstr "Información" #. i18n: ectx: property (title), widget (QGroupBox, m_gbContextHelp) #. +> trunk5 #: widgets/helpconfigwidget.ui:110 #, kde-format msgid "Context Sensitive Help" msgstr "Axuda sensíbel ao contexto" #. i18n: ectx: property (text), widget (QRadioButton, kcfg_kilerefs) #. +> trunk5 #: widgets/helpconfigwidget.ui:119 #, kde-format msgid "Use the &Kile LaTeX reference" msgstr "Empregar a referencia de LaTeX de &Kile" #. i18n: ectx: property (text), widget (QRadioButton, kcfg_latex2erefs) #. +> trunk5 #: widgets/helpconfigwidget.ui:129 #, kde-format msgid "&Use your system's TeXLive documentation" msgstr "&Usar a documentación de TeXLive do sistema" #. i18n: ectx: property (text), widget (QRadioButton, kcfg_texrefs) #. +> trunk5 #: widgets/helpconfigwidget.ui:136 #, kde-format msgid "Use your system's &TeX documentation (older version)" msgstr "Empregar a documentación de &TeX do sistema (versión antiga)" #. i18n: ectx: property (text), widget (QPushButton, m_pbConfigure) #. +> trunk5 #: widgets/helpconfigwidget.ui:179 #, kde-format msgid "Con&figure..." msgstr "&Configurar…" #. i18n: ectx: property (text), widget (QRadioButton, kcfg_embedded) #. +> trunk5 #: widgets/helpconfigwidget.ui:201 #, kde-format msgid "Use &embedded viewer" msgstr "Usar o visor &incorporado" #. i18n: ectx: property (text), widget (QRadioButton, kcfg_external) #. +> trunk5 #: widgets/helpconfigwidget.ui:208 #, kde-format msgid "Show help file in a &separate window" msgstr "Mostrar o ficheiro de axuda nunha &xanela á parte" #. i18n: ectx: property (text), widget (QPushButton, m_pbCommands) #. +> trunk5 #: widgets/latexconfigwidget.ui:37 #, kde-format msgid "Configure..." msgstr "Configurar…" #. i18n: ectx: property (text), widget (QLabel, m_tlCommands) #. +> trunk5 #: widgets/latexconfigwidget.ui:50 #, kde-format msgid "Configure LaTeX environments and commands" msgstr "Configurar os ambientes a ordes de LaTeX" #. i18n: ectx: property (title), widget (QGroupBox, m_bgQuotes) #. +> trunk5 #: widgets/latexconfigwidget.ui:71 #, kde-format msgid "Double Quotes" msgstr "Aspas dobres" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_InsertDoubleQuotes) #. +> trunk5 #: widgets/latexconfigwidget.ui:80 #, kde-format msgid "Automatically insert opening and closing double "es for LaTeX" msgstr "Inserir automaticamente &aspas dobres de abertura e peche de LaTeX" #. i18n: ectx: property (text), widget (QLabel, m_tlType) #. i18n: ectx: property (text), widget (QLabel, m_lbType) #. +> trunk5 #: widgets/latexconfigwidget.ui:89 widgets/maintoolconfigwidget.ui:362 #, kde-format msgid "&Type:" msgstr "&Tipo:" #. i18n: ectx: property (toolTip), widget (QCheckBox, kcfg_InsertSpecialCharacters) #. +> trunk5 #: widgets/latexconfigwidget.ui:142 #, kde-format -msgid "This option will insert the LaTeX equivalent of most special characters that can be typed on a keyboard." -msgstr "Esta opción insire o equivalente en LaTeX da maioría dos caracteres especiais que se poden escribir nun teclado." +msgid "" +"This option will insert the LaTeX equivalent of most special characters that" +" can be typed on a keyboard." +msgstr "" +"Esta opción insire o equivalente en LaTeX da maioría dos caracteres especiais" +" que se poden escribir nun teclado." #. i18n: ectx: property (text), widget (QCheckBox, kcfg_InsertSpecialCharacters) #. +> trunk5 #: widgets/latexconfigwidget.ui:145 #, kde-format -msgid "Automatically insert the LaTeX equivalent of special characters when typing (accents, etc)" -msgstr "Inserir automaticamente o equivalente en LaTeX dos caracteres especiais ao escribir (acentos, etc.)" +msgid "" +"Automatically insert the LaTeX equivalent of special characters when typing" +" (accents, etc)" +msgstr "" +"Inserir automaticamente o equivalente en LaTeX dos caracteres especiais ao" +" escribir (acentos, etc.)" #. i18n: ectx: property (title), widget (QGroupBox, m_bgMathmode) #. +> trunk5 #: widgets/latexconfigwidget.ui:161 #, kde-format msgid "Math mode" msgstr "Modo Matemáticas" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_autoInsertDollar) #. +> trunk5 #: widgets/latexconfigwidget.ui:170 #, kde-format msgid "Auto insert $" msgstr "Inserir $ automaticamente" #. i18n: ectx: property (title), widget (QGroupBox, groupBox5) #. +> trunk5 #: widgets/latexconfigwidget.ui:189 #, kde-format msgid "Environment Variables" msgstr "Variábeis de contorno" #. i18n: ectx: property (text), widget (QLabel, m_tlPath) #. +> trunk5 #: widgets/latexconfigwidget.ui:201 #, kde-format msgid "TE&XINPUTS:" msgstr "ENTRADAS DE TE&XTO:" #. i18n: ectx: property (text), widget (QLabel, m_bibinputpath) #. +> trunk5 #: widgets/latexconfigwidget.ui:220 #, kde-format msgid "BIBINP&UTS:" msgstr "ENTRADAS DE &BIB:" #. i18n: ectx: property (text), widget (QLabel, m_bstinputpath) #. +> trunk5 #: widgets/latexconfigwidget.ui:239 #, kde-format msgid "B&STINPUTS:" msgstr "ENTRADAS DE B&ST:" #. i18n: ectx: property (toolTip), widget (QCheckBox, m_ckRootDoc) #. +> trunk5 #: widgets/latextoolconfigwidget.ui:35 #, kde-format msgid "Check if root document is a LaTeX root before running LaTeX on it" -msgstr "Comprobe se o documento raíz e unha raíz de LaTeX antes de executar LaTeX nel" +msgstr "" +"Comprobe se o documento raíz e unha raíz de LaTeX antes de executar LaTeX nel" #. i18n: ectx: property (text), widget (QCheckBox, m_ckRootDoc) #. +> trunk5 #: widgets/latextoolconfigwidget.ui:38 #, kde-format msgid "Check if &root document" msgstr "Comprobar se é o documento &raíz" #. i18n: ectx: property (toolTip), widget (QCheckBox, m_ckJump) #. +> trunk5 #: widgets/latextoolconfigwidget.ui:45 #, kde-format msgid "Jump to first error in case running LaTeX failed" msgstr "Saltar ao primeiro erro no caso de que falle a execución de LaTeX" #. i18n: ectx: property (text), widget (QCheckBox, m_ckJump) #. +> trunk5 #: widgets/latextoolconfigwidget.ui:48 #, kde-format msgid "&Jump to first error" msgstr "&Saltar ao primeiro erro" #. i18n: ectx: property (toolTip), widget (QCheckBox, m_ckAutoRun) #. +> trunk5 #: widgets/latextoolconfigwidget.ui:55 #, kde-format -msgid "Automatically run Asymptote, BibTeX, MakeIndex and rerun LaTeX when necessary" -msgstr "Executar automaticamente Asymptote, BibTeX, MakeIndex e executar LaTeX de novo cando for preciso" +msgid "" +"Automatically run Asymptote, BibTeX, MakeIndex and rerun LaTeX when necessary" +msgstr "" +"Executar automaticamente Asymptote, BibTeX, MakeIndex e executar LaTeX de" +" novo cando for preciso" #. i18n: ectx: property (text), widget (QCheckBox, m_ckAutoRun) #. +> trunk5 #: widgets/latextoolconfigwidget.ui:58 #, kde-format msgid "Automatically run additional tools" msgstr "Executar automaticamente as ferramentas adicionais" #. i18n: ectx: property (windowTitle), widget (QWidget, KileWidgetLivePreviewConfig) #. +> trunk5 #: widgets/livepreviewconfigwidget.ui:14 #, kde-format msgid "Live Preview Configuration" msgstr "Configuración da previsualización ao vivo" #. i18n: ectx: property (title), widget (QGroupBox, kcfg_livePreviewEnabled) #. +> trunk5 #: widgets/livepreviewconfigwidget.ui:29 #, kde-format msgid "Enable &live preview" msgstr "Activar a previsua&lizar ao vivo" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_previewEnabledForFreshlyOpenedDocuments) #. +> trunk5 #: widgets/livepreviewconfigwidget.ui:41 #, kde-format msgid "Enable live preview for newly-opened documents" msgstr "Activar a previsualización dos documentos abertos recentemente" #. i18n: ectx: property (title), widget (QGroupBox, m_compileBehaviorGroupBox) #. +> trunk5 #: widgets/livepreviewconfigwidget.ui:48 #, kde-format msgid "Compilation Behavior" msgstr "Comportamento da compilación" #. i18n: ectx: property (text), widget (QRadioButton, m_compileDocumentOnSaveRadioButton) #. +> trunk5 #: widgets/livepreviewconfigwidget.ui:54 #, kde-format msgid "Compile doc&uments after saving" msgstr "Compilar os doc&umentos cando se garden" #. i18n: ectx: property (text), widget (QRadioButton, m_compileDocumentOnChangesRadioButton) #. +> trunk5 #: widgets/livepreviewconfigwidget.ui:63 #, kde-format msgid "Compile documents whenever &there are changes after" msgstr "Compilar os documen&tos cando se realice un cambio despois de" #. i18n: ectx: property (suffix), widget (QSpinBox, kcfg_livePreviewCompilationDelay) #. +> trunk5 #: widgets/livepreviewconfigwidget.ui:70 #, kde-format msgid " ms" msgstr " ms" #. +> trunk5 #: widgets/logwidget.cpp:370 #, kde-format msgid "Hide &Bad Boxes" msgstr "Agochar as caixas malas" #. +> trunk5 #: widgets/logwidget.cpp:376 #, kde-format msgid "Hide (La)TeX &Warnings" msgstr "Agochar as &advertencias de (La)TeX" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:45 #, kde-format msgid "Select a tool" msgstr "Escoller unha ferramenta" #. i18n: ectx: property (text), widget (QPushButton, m_pshbNewTool) #. i18n: ectx: property (text), widget (QPushButton, m_pshbNewConfig) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:94 widgets/maintoolconfigwidget.ui:203 #, kde-format msgid "New..." msgstr "Nova…" #. i18n: ectx: property (title), widget (QGroupBox, m_groupBox) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:130 #, kde-format msgid "Choose a configuration for the current tool" msgstr "Escolla unha configuración para esta ferramenta" #. i18n: ectx: property (text), widget (QLabel, m_lbConfig) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:159 #, kde-format msgid "Se&lect:" msgstr "Se&leccionar:" #. i18n: ectx: attribute (title), widget (QWidget, tab1) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:328 #, kde-format msgid "Advanced" msgstr "Avanzada" #. i18n: ectx: property (text), widget (QLabel, m_lbClass) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:385 #, kde-format msgid "C&lass:" msgstr "C&lase:" #. i18n: ectx: property (text), widget (QLabel, m_lbSource) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:408 #, kde-format msgid "Source e&xtension:" msgstr "Extensión da ori&xe:" #. i18n: ectx: property (text), widget (QLabel, m_lbTarget) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:431 #, kde-format msgid "Tar&get extension:" msgstr "Extensión do &destino:" #. i18n: ectx: property (text), widget (QLabel, textLabel1) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:454 #, kde-format msgid "Target &file:" msgstr "&Ficheiro de destino:" #. i18n: ectx: property (text), widget (QLabel, textLabel2) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:480 #, kde-format msgid "&Relative dir:" msgstr "&Directorio relativo:" #. i18n: ectx: property (text), widget (QCheckBox, m_ckClose) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:508 #, kde-format msgid "Close Konsole when tool is finished" msgstr "Pechar Konsole cando remate a ferramenta" #. i18n: ectx: attribute (title), widget (QWidget, TabPage) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:531 #, kde-format msgid "Menu" msgstr "Menú" #. i18n: ectx: property (text), widget (QLabel, m_lbMenu) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:554 #, kde-format msgid "Add &tool to Build menu:" msgstr "Engadir unha ferramen&ta ao menú Construír:" #. i18n: ectx: property (text), widget (QLabel, m_lbIcon) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:577 #, kde-format msgid "&Icon:" msgstr "&Icona:" #. i18n: ectx: property (text), widget (QPushButton, m_pshbDefault) #. +> trunk5 #: widgets/maintoolconfigwidget.ui:636 #, kde-format msgid "Restore Default Tools..." msgstr "&Repor as ferramentas predeterminadas…" #. i18n: ectx: property (text), widget (QLabel, textLabel1) #. +> trunk5 #: widgets/newdocumentwidget.ui:38 #, kde-format msgid "Please select the type of document you want to create:" msgstr "Escolla o tipo de documento que queira crear:" #. i18n: ectx: property (title), widget (QGroupBox, groupBox1) #. +> trunk5 #: widgets/newdocumentwidget.ui:74 #, kde-format msgid "Template" msgstr "Modelo" #. i18n: ectx: property (text), widget (QLabel, textLabel1_2) #. +> trunk5 #: widgets/newdocumentwidget.ui:80 #, kde-format msgid "Please select the template that should be used:" msgstr "Escolla o modelo que deba empregarse:" #. i18n: ectx: property (text), widget (QCheckBox, quickStartWizardCheckBox) #. +> trunk5 #: widgets/newdocumentwidget.ui:93 #, kde-format msgid "Start the Quick Start wizard when creating an empty LaTeX file" -msgstr "Iniciar o asistente de inicio rápido ao crear un ficheiro de LaTeX baleiro" +msgstr "" +"Iniciar o asistente de inicio rápido ao crear un ficheiro de LaTeX baleiro" #. +> trunk5 #: widgets/previewconfigwidget.cpp:50 #, kde-format msgid "Quick Preview in a Separate Window" msgstr "Vista previa rápida noutra xanela" #. +> trunk5 #: widgets/previewconfigwidget.cpp:58 #, kde-format msgid "Select a configuration:" msgstr "Escolla unha configuración:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:68 #, kde-format msgid "Quick Preview in Bottom Bar" msgstr "Vista previa rápida na barra do fondo" #. +> trunk5 #: widgets/previewconfigwidget.cpp:76 #, kde-format msgid "&Resolution:" msgstr "&Resolución:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:78 #, kde-format msgid "dpi" msgstr "ppp" #. +> trunk5 #: widgets/previewconfigwidget.cpp:79 #, kde-format msgid "(allowed values: 30-1000 dpi)" msgstr "(valores permitidos: 30-1000 ppp)" #. +> trunk5 #: widgets/previewconfigwidget.cpp:81 #, kde-format msgid "&Background Color:" msgstr "Cor do &fondo:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:91 #, kde-format msgid "Kile supports three kinds of conversion to png images" msgstr "Kile permite tres tipos de conversión a imaxes png" #. +> trunk5 #: widgets/previewconfigwidget.cpp:92 widgets/previewconfigwidget.cpp:260 #, kde-format msgid "dvi --> png" msgstr "dvi --> png" #. +> trunk5 #: widgets/previewconfigwidget.cpp:92 #, kde-format msgid "(uses dvipng)" msgstr "(emprega dvipng)" #. +> trunk5 #: widgets/previewconfigwidget.cpp:93 widgets/previewconfigwidget.cpp:263 #, kde-format msgid "dvi --> ps --> png" msgstr "dvi --> ps --> png" #. +> trunk5 #: widgets/previewconfigwidget.cpp:93 #, kde-format msgid "(uses dvips/convert)" msgstr "(emprega dvips/convert)" #. +> trunk5 #: widgets/previewconfigwidget.cpp:94 widgets/previewconfigwidget.cpp:264 #, kde-format msgid "pdf --> png" msgstr "pdf --> png" #. +> trunk5 #: widgets/previewconfigwidget.cpp:94 #, kde-format msgid "(uses convert)" msgstr "(emprega convert)" #. +> trunk5 #: widgets/previewconfigwidget.cpp:98 #, kde-format msgid "dvipng:" msgstr "dvipng:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:99 #, kde-format msgid "convert:" msgstr "convert:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:127 #, kde-format msgid "Show preview in bottom bar:" msgstr "Mostrar a vista previa na barra do fondo:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:128 #, kde-format msgid "Conversion to image:" msgstr "Converter en imaxe:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:129 #, kde-format msgid "Selection:" msgstr "Selección:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:130 #, kde-format msgid "Environment:" msgstr "Ambiente:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:131 #, kde-format msgid "Mathgroup:" msgstr "Grupo de matemáticas:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:132 #, kde-format msgid "Subdocument:" msgstr "Subdocumento:" #. +> trunk5 #: widgets/previewconfigwidget.cpp:133 #, kde-format msgid "Not available, opens always in a separate window." msgstr "Non dispoñíbel, abrir sempre noutra xanela." #. i18n: ectx: property (text), widget (QLabel, m_lbCommand) #. +> trunk5 #: widgets/processtoolconfigwidget.ui:37 #, kde-format msgid "Co&mmand:" msgstr "&Orde:" #. i18n: ectx: property (toolTip), widget (QLabel, m_lbOptions) #. +> trunk5 #: widgets/processtoolconfigwidget.ui:80 #, kde-format, no-c-format msgid "" -"\n" -"\n" -"

Consider the file myBestBook.tex with full path /home/archimedes/latex/myBestBook.tex, compiled with pdflatex to myBestBook.pdf.

" +"\n" +"

Consider the file <" +"span style=\" font-style:italic;\">myBestBook.tex with full path /home/archimedes/latex/myBestBook.tex, compiled with pdflatex to myBestBook.pdf.

" "\n" -"

" +"

<" +"/p>" "\n" -"

The variables have the following meanings:

" +"

The variables have" +" the following meanings:

" "\n" -"

%source: filename with suffix but without path <-> myBestBook.tex

" +"

%source: filename with suffix but without path" +" <-> myBestBook.tex

" "\n" -"

%S: filename without suffix and without path <-> myBestBook

" +"

%S: filename without suffix and without path" +" <-> myBestBook

" "\n" -"

%dir_base: path of the source file without filename <-> /home/archimedes/latex

" +"

%dir_base: path of the source file without" +" filename <->" +" /home/archimedes/latex

" "\n" -"

%dir_target: path of the target file without filename, same as %dir_base if no relative path has been set <-> /home/archimedes/latex

" +"

" +"%dir_target: path of the target file" +" without filename, same as %dir_base if no relative path has been set" +" <-> /home/archimedes/latex

" "\n" -"

%target: target filename without path <-> myBestBook.pdf

" +"

%target: target filename without path <-> <" +"span style=\" font-style:italic;\">myBestBook.pdf

" "\n" -"

" +"

" "\n" -"

%res: resolution of the quickpreview action set in configure kile->tools->preview

" +"

%res: resolution of the quickpreview action set in" +" configure kile->tools->preview

" "\n" -"

%AFL: List of all files in a project marked for archiving. Set the archive flag in the \"Files and projects\" sidebar using the context menu.

" +"

%AFL: List of all files in a project marked for" +" archiving. Set the archive flag in the \"Files and projects\" sidebar using" +" the context menu.

" "" msgstr "" -"\n" -"\n" -"

Considere o ficheiro oMeuMellorLibro.tex, cuxa ruta completa é /home/arquimedes/latex/oMeuMellorLibro.tex, compileda con pdflatex a oMeuMellorLibro.pdf.

" +"\n" +"

Considere o" +" ficheiro oMeuMellorLibro.tex," +" cuxa ruta completa é /home/arquimedes/latex/oMeuMellorLibro.tex, compileda con pdflatex a oMeuMellorLibro.pdf.

" "\n" -"

" +"

<" +"/p>" "\n" -"

As variábeis teñen o significado seguinte:

" +"

As variábeis teñen" +" o significado seguinte:

" "\n" -"

%source: nome de ficheiro cun sufixo pero sen a ruta <-> oMeuMellorLibro.tex

" +"

%source: nome de ficheiro cun sufixo pero sen a" +" ruta <-> oMeuMellorLibro.tex

" "\n" -"

%S: nome de ficheiro sen o sufixo nin a ruta <-> oMeuMellorLibro

" +"

%S: nome de ficheiro sen o sufixo nin a ruta" +" <-> oMeuMellorLibro

" "\n" -"

%dir_base: ruta do ficheiro fonte sen o nome de ficheiro <-> /home/archimedes/latex

" +"

%dir_base: ruta do ficheiro fonte sen o nome de" +" ficheiro <->" +" /home/archimedes/latex

" "\n" -"

%dir_target: ruta do ficheiro de destino sen o nome de ficheiro; o mesmo que %dir_base se non se indicou unha ruta relativa <-> /home/archimedes/latex

" +"

" +"%dir_target: ruta do ficheiro de destino" +" sen o nome de ficheiro; o mesmo que %dir_base se non se indicou unha ruta" +" relativa <-> /home/archimedes/latex

" "\n" -"

%target: nome de ficheiro de destino sen a ruta <-> oMeuMellorLibro.pdf

" +"

%target: nome de ficheiro de destino sen a ruta" +" <-> oMeuMellorLibro.pdf

" "\n" -"

" +"

" "\n" -"

%res: resolución da acción de vista rápida indicada en Configurar Kile->Ferramentas->Previsualización

" +"

%res: resolución da acción de vista rápida" +" indicada en Configurar Kile->Ferramentas->Previsualización

" "\n" -"

%AFL: Lista de todos os ficheiros dun proxectos marcados para arquivárense. Indique a bandeira de arquivado na barra lateral «Ficheiros e proxectos» empregando o menú de contexto.

" +"

%AFL: Lista de todos os ficheiros dun proxectos" +" marcados para arquivárense. Indique a bandeira de arquivado na barra lateral" +" «Ficheiros e proxectos» empregando o menú de contexto.

" "" #. i18n: ectx: property (text), widget (QLabel, m_lbOptions) #. +> trunk5 #: widgets/processtoolconfigwidget.ui:83 #, kde-format msgid "Options:" msgstr "Opcións:" #. +> trunk5 #: widgets/projectview.cpp:243 #, kde-format msgid "Files & Projects" msgstr "Ficheiros e proxectos" #. +> trunk5 #: widgets/projectview.cpp:243 #, kde-format msgid "Include in Archive" msgstr "Incluír no arquivo" #. +> trunk5 #: widgets/projectview.cpp:451 #, kde-format msgid "Project File" msgstr "Ficheiro de proxecto" #. +> trunk5 #: widgets/projectview.cpp:454 #, kde-format msgid "Packages" msgstr "Paquetes" #. +> trunk5 #: widgets/projectview.cpp:457 #, kde-format msgid "Images" msgstr "Imaxes" #. +> trunk5 #: widgets/projectview.cpp:791 #, kde-format msgid "&Open With" msgstr "&Abrir con" #. +> trunk5 #: widgets/projectview.cpp:803 widgets/structurewidget.cpp:796 #, kde-format msgid "Other..." msgstr "Outro…" #. +> trunk5 #: widgets/projectview.cpp:809 #, kde-format msgid "&Open" msgstr "&Abrir" #. +> trunk5 #: widgets/projectview.cpp:812 #, kde-format msgid "&Save" msgstr "&Gardar" #. +> trunk5 #: widgets/projectview.cpp:822 #, kde-format msgid "&Add to Project" msgstr "&Engadir ao proxecto" #. +> trunk5 #: widgets/projectview.cpp:832 #, kde-format msgid "&Include in Archive" msgstr "&Incluír no arquivo" #. +> trunk5 #: widgets/projectview.cpp:841 #, kde-format msgid "&Remove From Project" msgstr "&Retirar do proxecto" #. +> trunk5 #: widgets/projectview.cpp:849 #, kde-format msgid "A&dd Files..." msgstr "Enga&dir ficheiros…" #. +> trunk5 #: widgets/projectview.cpp:865 widgets/projectview.cpp:868 #, kde-format msgid "&Close" msgstr "&Pechar" #. +> trunk5 #: widgets/quicktoolconfigwidget.cpp:61 #, kde-format msgid "Current Default (%1)" msgstr "Predeterminado actual (%1)" #. +> trunk5 #: widgets/quicktoolconfigwidget.cpp:64 #, kde-format msgid "Current Default" msgstr "Predeterminado actual" #. i18n: ectx: property (text), widget (QLabel, m_lbTool) #. +> trunk5 #: widgets/quicktoolconfigwidget.ui:27 #, kde-format msgid "Tool:" msgstr "Ferramenta:" #. i18n: ectx: property (text), widget (QLabel, m_lbConfig) #. +> trunk5 #: widgets/quicktoolconfigwidget.ui:53 #, kde-format msgid "Configuration:" msgstr "Configuración:" #. i18n: ectx: property (text), widget (QPushButton, m_pshbUp) #. +> trunk5 #: widgets/quicktoolconfigwidget.ui:117 #, kde-format msgid "&Up" msgstr "&Subir" #. i18n: ectx: property (text), widget (QPushButton, m_pshbDown) #. +> trunk5 #: widgets/quicktoolconfigwidget.ui:130 #, kde-format msgid "&Down" msgstr "&Baixar" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_ScriptingEnabled) #. +> trunk5 #: widgets/scriptingconfigwidget.ui:33 #, kde-format msgid "Enable &scripting" msgstr "Activar o &scripting" #. i18n: ectx: property (title), widget (QGroupBox, executionTimeLimitGroupBox) #. +> trunk5 #: widgets/scriptingconfigwidget.ui:52 #, kde-format msgid "Execution Time Limit" msgstr "Límite de tempo da execución" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_TimeLimitEnabled) #. +> trunk5 #: widgets/scriptingconfigwidget.ui:67 #, kde-format msgid "&Limit the execution time of scripts" msgstr "&Limitar o tempo de execución dos scripts" #. i18n: ectx: property (text), widget (QLabel, textLabel1) #. +> trunk5 #: widgets/scriptingconfigwidget.ui:85 #, kde-format msgid "&Time limit (seconds):" msgstr "&Límite de tempo (segundos):" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:75 #, kde-format msgid "Run Selected Script" msgstr "Executar o script escollido" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:81 #, kde-format msgid "Create New Script" msgstr "Crear un script novo" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:87 #, kde-format msgid "Open Selected Script in Editor" msgstr "Abrir no editor o script escollido" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:93 #, kde-format msgid "Configure Key Sequence" msgstr "Configurar a secuencia de teclas" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:99 #, kde-format msgid "Remove Key Sequence" msgstr "Retirar a secuencia de teclas" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:105 #, kde-format msgid "Refresh List" msgstr "Actualizar a lista" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:115 #, kde-format msgid "Script Name" msgstr "Nome do script" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:116 #, kde-format msgid "Sequence" msgstr "Secuencia" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:219 #, kde-format msgid "The sequence \"%1\" is already assigned to the action \"%2\"" msgstr "A secuencia «%1» xa está asignada á acción «%2»" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:220 #: widgets/scriptsmanagementwidget.cpp:224 #: widgets/scriptsmanagementwidget.cpp:228 #, kde-format msgid "Sequence Already Assigned" msgstr "A secuencia xa está asignada" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:223 #, kde-format -msgid "The sequence \"%1\" is a subsequence of \"%2\", which is already assigned to the action \"%3\"" -msgstr "A secuencia «%1» é unha subsecuencia de «%2», que xa está asignada á acción «%3»" +msgid "" +"The sequence \"%1\" is a subsequence of \"%2\", which is already assigned to" +" the action \"%3\"" +msgstr "" +"A secuencia «%1» é unha subsecuencia de «%2», que xa está asignada á acción «" +"%3»" #. +> trunk5 #: widgets/scriptsmanagementwidget.cpp:227 #, kde-format msgid "The shorter sequence \"%1\" is already assigned to the action \"%2\"" msgstr "A secuencia máis curta «%1» xa está asignada á acción «%2»" #. +> trunk5 #: widgets/statisticswidget.cpp:44 #, kde-format msgid "Characters" msgstr "Caracteres" #. +> trunk5 #: widgets/statisticswidget.cpp:51 #, kde-format msgid "Words and numbers:" msgstr "Palabras e números:" #. +> trunk5 #: widgets/statisticswidget.cpp:52 #, kde-format msgid "LaTeX commands and environments:" msgstr "Ordes e ambientes de LaTeX:" #. +> trunk5 #: widgets/statisticswidget.cpp:53 #, kde-format msgid "Punctuation, delimiter and whitespaces:" msgstr "Puntuación, delimitadores e espazos en branco:" #. +> trunk5 #: widgets/statisticswidget.cpp:54 #, kde-format msgid "Total characters:" msgstr "Caracteres totais:" #. +> trunk5 #: widgets/statisticswidget.cpp:83 #, kde-format msgid "Strings" msgstr "Cadeas" #. +> trunk5 #: widgets/statisticswidget.cpp:90 #, kde-format msgid "Words:" msgstr "Palabras:" #. +> trunk5 #: widgets/statisticswidget.cpp:91 #, kde-format msgid "LaTeX commands:" msgstr "Ordes de LaTeX:" #. +> trunk5 #: widgets/statisticswidget.cpp:92 #, kde-format msgid "LaTeX environments:" msgstr "Ambientes de LaTeX:" #. +> trunk5 #: widgets/statisticswidget.cpp:93 #, kde-format msgid "Total strings:" msgstr "Cadeas totais:" #. +> trunk5 #: widgets/statusbar.cpp:70 #, kde-format msgid "Line: %1 Col: %2" msgstr "Liña: %1 Columna: %2" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:38 #, kde-format msgid "Expansion Level" msgstr "Nivel de expansión" #. i18n: ectx: property (text), widget (QLabel, textLabel2) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:52 #, kde-format msgid "&Default value" msgstr "Valor pre&determinado" #. i18n: ectx: property (text), widget (QLabel, textLabel2_2) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:112 #, kde-format msgid "(&1=part, 2=chapter, 3=section, 4=subsection, 5=subsubsection, ...)" msgstr "(&1=parte, 2=capítulo, 3=sección, 4=subsección, 5=subsubsección …)" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowLabels) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:137 #, kde-format msgid "Show &labels" msgstr "Mostrar as &etiquetas" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvOpenLabels) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:144 #, kde-format msgid "&Open labels item" msgstr "Abrir o elemento de &etiquetas" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowReferences) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:151 #, kde-format msgid "Show undefined references" msgstr "Mostrar as referencias non definidas" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvOpenReferences) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:158 #, kde-format msgid "Open references item" msgstr "Abrir o elemento de referencias" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowBibitems) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:165 #, kde-format msgid "Show bibitems" msgstr "Mostrar os elementos bibliográficos" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvOpenBibitems) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:172 #, kde-format msgid "Open bibitems item" msgstr "Abrir o elemento bibliográfico" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowTodo) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:179 #, kde-format msgid "Show TODO/FIXME" msgstr "Mostrar os comentarios PENDENTE e CORRIXIR" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvOpenTodo) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:186 #, kde-format msgid "Open TODO/FIXME" msgstr "Abrir os comentarios PENDENTE e CORRIXIR" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowFloats) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:193 #, kde-format msgid "Show figure and table en&vironments" msgstr "&Mostrar os ambientes de figuras e táboas" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowGraphics) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:200 #, kde-format msgid "Show graphic files" msgstr "Mostrar os ficheiros de gráficos" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowInputFiles) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:207 #, kde-format msgid "Show input files" msgstr "Mostrar os ficheiros de entrada" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_SvShowSectioningLabels) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:217 #, kde-format msgid "No extra section for labels" msgstr "Non hai sección seguinte para as etiquetas" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:229 #, kde-format msgid "Default Graphic Extension:" msgstr "Extensión gráfica predeterminada:" #. i18n: ectx: property (toolTip), widget (QComboBox, kcfg_SvDefaultGraphicExt) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:236 #, kde-format msgid "Extension to use for graphic files without extensions" msgstr "Extensión para empregar cos ficheiros gráficos sen extensión" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_SvDefaultGraphicExt) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:243 #, kde-format msgid "eps" msgstr "eps" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_SvDefaultGraphicExt) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:248 #, kde-format msgid "pdf" msgstr "pdf" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_SvDefaultGraphicExt) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:253 #, kde-format msgid "png" msgstr "png" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_SvDefaultGraphicExt) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:258 #, kde-format msgid "jpg" msgstr "jpg" #. i18n: ectx: property (text), item, widget (QComboBox, kcfg_SvDefaultGraphicExt) #. +> trunk5 #: widgets/structureviewconfigwidget.ui:263 #, kde-format msgid "tif" msgstr "tif" #. +> trunk5 #: widgets/structurewidget.cpp:101 #, kde-format msgid "" "Click left to jump to the line. A double click will open\n" " a text file or a graphics file. When a label is assigned\n" "to this item, it will be shown when the mouse is over\n" "this item. Items for a graphics file or an assigned label\n" "also offer a context menu (right mouse button)." msgstr "" "Prema o botón esquerdo para saltar para a liña.\n" "Se fai duplo-click abrirá un ficheiro de texto ou unha imaxe.\n" "Cando o elemento teña asignada unha lenda, ha mostrarse\n" "cando o rato pase por riba deste elemento. Os elementos dun\n" "ficheiro gráfico ou dunha etiqueta ofrecen tamén\n" "un menú contextual (menú do botón dereito)." #. +> trunk5 #: widgets/structurewidget.cpp:117 #, kde-format msgctxt "structure view entry: title (line)" msgid "%1 (line %2)" msgstr "%1 (liña %2)" #. +> trunk5 #: widgets/structurewidget.cpp:125 #, kde-format msgid "Label: %1" msgstr "Etiqueta: %1" #. +> trunk5 #: widgets/structurewidget.cpp:159 #, kde-format msgid "No \"structure data\" to display." msgstr "Non hai «datos da estrutura» que mostrar." #. +> trunk5 #: widgets/structurewidget.cpp:332 #, kde-format msgid "BibTeX References" msgstr "Referencias de BibTeX" #. +> trunk5 #: widgets/structurewidget.cpp:336 #, kde-format msgid "Undefined References" msgstr "Referencias non definidas" #. +> trunk5 #: widgets/structurewidget.cpp:340 #, kde-format msgid "TODO" msgstr "PENDENTE" #. +> trunk5 #: widgets/structurewidget.cpp:344 #, kde-format msgid "FIXME" msgstr "CORRIXIR" #. +> trunk5 #: widgets/structurewidget.cpp:505 #, kde-format msgid "Cannot create a list view item: no parent found." msgstr "Non se pode crear o elemento da vista en lista: non se atopou o pai." #. +> trunk5 #: widgets/structurewidget.cpp:686 #, kde-format -msgid "No extension specified for graphic file. Using .%1 from Project settings." -msgstr "Non se indicou ningunha extensión para o ficheiro de gráficos. Emprégase .%1, segundo as opcións do proxecto." +msgid "" +"No extension specified for graphic file. Using .%1 from Project settings." +msgstr "" +"Non se indicou ningunha extensión para o ficheiro de gráficos. Emprégase .%1," +" segundo as opcións do proxecto." #. +> trunk5 #: widgets/structurewidget.cpp:687 #, kde-format -msgid "No extension specified for graphic file. Using .%1 from global Structure View settings." -msgstr "Non se indicou ningunha extensión para o ficheiro de gráficos. Emprégase .%1, segundo as opcións de vista global da estrutura." +msgid "" +"No extension specified for graphic file. Using .%1 from global Structure" +" View settings." +msgstr "" +"Non se indicou ningunha extensión para o ficheiro de gráficos. Emprégase .%1," +" segundo as opcións de vista global da estrutura." #. +> trunk5 #: widgets/structurewidget.cpp:688 #, kde-format msgid "File extension not specified" msgstr "Non indicou ningunha extensión de ficheiro" #. +> trunk5 #: widgets/structurewidget.cpp:733 #, kde-format msgid "" -"Cannot find the included file. The file does not exist, is not readable or Kile is unable to determine the correct path to it. The filename causing this error was: %1.\n" +"Cannot find the included file. The file does not exist, is not readable or" +" Kile is unable to determine the correct path to it. The filename causing" +" this error was: %1.\n" "Do you want to create this file?" msgstr "" -"Non se pode atopar o ficheiro incluído. O ficheiro non existe, non é lexíbel ou Kile non pode determinar a ruta correcta para el. O ficheiro que produciu este erro é: %1.\n" +"Non se pode atopar o ficheiro incluído. O ficheiro non existe, non é lexíbel" +" ou Kile non pode determinar a ruta correcta para el. O ficheiro que produciu" +" este erro é: %1.\n" "Quere crear este ficheiro?" #. +> trunk5 #: widgets/structurewidget.cpp:733 #, kde-format msgid "Cannot Find File" msgstr "Non se pode atopar o ficheiro" #. +> trunk5 #: widgets/structurewidget.cpp:765 #, kde-format msgid "Cu&t" msgstr "Cor&tar" #. +> trunk5 #: widgets/structurewidget.cpp:766 #, kde-format msgid "&Copy" msgstr "&Copiar" #. +> trunk5 #: widgets/structurewidget.cpp:767 #, kde-format msgid "&Paste below" msgstr "&Pegar en baixo" #. +> trunk5 #: widgets/structurewidget.cpp:772 #, kde-format msgid "C&omment" msgstr "C&omentar" #. +> trunk5 #: widgets/structurewidget.cpp:774 #, kde-format msgid "Run QuickPreview" msgstr "Executar a previsualización rápida" #. +> trunk5 #: widgets/structurewidget.cpp:801 #, kde-format msgid "Insert Label" msgstr "Inserir unha etiqueta" #. +> trunk5 #: widgets/structurewidget.cpp:802 #, kde-format msgid "As &reference" msgstr "Como &referencia" #. +> trunk5 #: widgets/structurewidget.cpp:803 #, kde-format msgid "As &page reference" msgstr "Como referencia a unha &páxina" #. +> trunk5 #: widgets/structurewidget.cpp:804 #, kde-format msgid "Only the &label" msgstr "&Só a etiqueta" #. +> trunk5 #: widgets/structurewidget.cpp:806 #, kde-format msgid "Copy Label to Clipboard" msgstr "Copiar a etiqueta ao portapapeis" #. +> trunk5 #: widgets/structurewidget.cpp:807 #, kde-format msgid "As reference" msgstr "Como referencia" #. +> trunk5 #: widgets/structurewidget.cpp:808 #, kde-format msgid "As page reference" msgstr "Como referencia á páxina" #. +> trunk5 #: widgets/structurewidget.cpp:809 #, kde-format msgid "Only the label" msgstr "Só a etiqueta" #. +> trunk5 #: widgets/symbolview.cpp:207 #, kde-format msgid "Command: %1" msgstr "Orde: %1" #. +> trunk5 #: widgets/symbolview.cpp:209 #, kde-format msgid "" "
" "Unicode: %1" msgstr "" "
" "Unicode: %1" #. +> trunk5 #: widgets/symbolview.cpp:237 #, kde-format msgid "Required Package: %2" msgid_plural "Required Packages: %2" msgstr[0] "Paquete requirido: %2" msgstr[1] "Paquetes requiridos: %2" #. +> trunk5 #: widgets/symbolview.cpp:241 #, kde-format msgid "Comment: %1" msgstr "Comentario: %1" #. i18n: ectx: property (title), widget (QGroupBox, groupBox) #. +> trunk5 #: widgets/symbolviewconfigwidget.ui:28 #, kde-format msgid "Most Frequently Used Symbols" msgstr "Os símbolos utilizados máis a miúdo" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_displayMFUS) #. +> trunk5 #: widgets/symbolviewconfigwidget.ui:37 #, kde-format msgid "Display the vie&w" msgstr "Mostrar a &vista" #. i18n: ectx: property (text), widget (QLabel, textLabel1) #. +> trunk5 #: widgets/symbolviewconfigwidget.ui:46 #, kde-format msgid "Number of symbols to show" msgstr "Número de símbolos que mostrar:" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_clearMFUS) #. +> trunk5 #: widgets/symbolviewconfigwidget.ui:84 #, kde-format msgid "&Clear the list of symbols when closing Kile" msgstr "&Limpar a lista dos símbolos cando se peche Kile" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. +> trunk5 #: widgets/symbolviewconfigwidget.ui:94 #, kde-format msgid "Unicode" msgstr "Unicode" #. i18n: ectx: property (text), widget (QCheckBox, kcfg_symbolViewUTF8) #. +> trunk5 #: widgets/symbolviewconfigwidget.ui:103 #, kde-format msgid "Insert Unicode representation of the selected symbol (when available)" -msgstr "Inserir a representación en Unicode do símbolo escollido (cando estiver dispoñíbel)" +msgstr "" +"Inserir a representación en Unicode do símbolo escollido (cando estiver" +" dispoñíbel)" #. +> trunk5 #: widgets/toolconfigwidget.cpp:110 #, kde-format msgid "Run Outside of Kile" msgstr "Executar fóra de Kile" #. +> trunk5 #: widgets/toolconfigwidget.cpp:111 #, kde-format msgid "Run in Konsole" msgstr "Executar no Konsole" #. +> trunk5 #: widgets/toolconfigwidget.cpp:112 #, kde-format msgid "Use Document Viewer" msgstr "Usar o visor de documentos" #. +> trunk5 #: widgets/toolconfigwidget.cpp:113 #, kde-format msgid "Run Sequence of Tools" msgstr "Executar unha secuencia de ferramentas" #. +> trunk5 #: widgets/toolconfigwidget.cpp:160 #, kde-format msgid "Use the \"Advanced\" tab to configure this tool." msgstr "Empregue a lapela «Avanzada» para configurar esta ferramenta." #. +> trunk5 #: widgets/toolconfigwidget.cpp:171 #, kde-format msgid "" "Unknown tool type; your configuration data is malformed.\n" "Perhaps it is a good idea to restore the default settings." msgstr "" "O tipo da ferramenta é descoñecido, a súa configuración está mal formada.\n" "Quizais sexa boa idea restaurar as opcións predeterminadas." #. +> trunk5 #: widgets/toolconfigwidget.cpp:224 #, kde-format msgid "" "All your tool settings will be overwritten with the default settings.\n" "Are you sure you want to continue?" msgstr "" -"A súa configuración de ferramentas sobrescribirase coa configuración predeterminada.\n" +"A súa configuración de ferramentas sobrescribirase coa configuración" +" predeterminada.\n" "Seguro que quere continuar?" #. +> trunk5 #: widgets/toolconfigwidget.cpp:338 #, kde-format msgid "Choose a configuration for the tool %1" msgstr "Escolla unha configuración para a ferramenta %1" #. +> trunk5 #: widgets/toolconfigwidget.cpp:408 #, kde-format msgid "New Configuration" msgstr "Nova configuración" #. +> trunk5 #: widgets/toolconfigwidget.cpp:408 #, kde-format msgid "Enter new configuration name:" msgstr "Insira o nome da nova configuración:" #. +> trunk5 #: widgets/toolconfigwidget.cpp:435 #, kde-format msgid "Are you sure you want to remove the tool %1?" msgstr "Seguro que quere retirar a utilidade %1?" #. +> trunk5 #: widgets/toolconfigwidget.cpp:465 #, kde-format msgid "Are you sure that you want to remove this configuration?" msgstr "Está seguro de que quere retirar esta configuración?" #. +> trunk5 #: widgets/toolconfigwidget.cpp:479 #, kde-format msgid "You need at least one configuration for each tool." msgstr "Precisa polo menos unha configuración para cada utilidade." #. +> trunk5 #: widgets/toolconfigwidget.cpp:479 #, kde-format msgid "Cannot Remove Configuration" msgstr "Non se pode retirar a configuración" #. +> trunk5 #: widgets/usermenuconfigwidget.cpp:89 #, kde-format msgid "no file installed" msgstr "non hai ningún ficheiro instalado" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: widgets/usermenuconfigwidget.ui:40 #, kde-format msgid "Installed menu file:" msgstr "Ficheiro de menú instalado:" #. i18n: ectx: property (text), widget (QLabel, m_usermenuFile) #. +> trunk5 #: widgets/usermenuconfigwidget.ui:69 #, kde-format msgid "File " msgstr "Ficheiro" #. i18n: ectx: property (title), widget (QGroupBox, groupBox_2) #. +> trunk5 #: widgets/usermenuconfigwidget.ui:149 #, kde-format msgid "Location" msgstr "Lugar" #. i18n: ectx: property (text), widget (QRadioButton, m_rbLaTeXMenuLocation) #. +> trunk5 #: widgets/usermenuconfigwidget.ui:161 #, kde-format msgid "Show &the user menu in the LaTeX menu" msgstr "Mos&trar o menú do usuario no menú de LaTeX" #. i18n: ectx: property (text), widget (QRadioButton, m_rbStandAloneMenuLocation) #. +> trunk5 #: widgets/usermenuconfigwidget.ui:177 #, kde-format msgid "Show the &user menu in the menu bar" msgstr "Mostrar o menú do &usuario na barra de menú" Index: trunk/l10n-support/gl/summit/messages/frameworks/kdelibs4support.po =================================================================== --- trunk/l10n-support/gl/summit/messages/frameworks/kdelibs4support.po (revision 1557103) +++ trunk/l10n-support/gl/summit/messages/frameworks/kdelibs4support.po (revision 1557104) @@ -1,15562 +1,15763 @@ # translation of kdelibs4.po to galician # Copyright (C) YEAR This_file_is_part_of_KDE # This file is distributed under the same license as the PACKAGE package. +# # mvillarino , 2007, 2008, 2009. # Marce Villarino , 2008, 2009. # marce villarino , 2009. # marce villarino , 2009. # Marce Villarino , 2009, 2010. # Xosé , 2010. # Marce Villarino , 2011, 2014. # Adrián Chaves Fernández , 2015, 2017. # Adrián Chaves (Gallaecio) , 2017, 2018, 2019. -# msgid "" msgstr "" "Project-Id-Version: kdelibs4\n" "Report-Msgid-Bugs-To: https://bugs.kde.org\n" "POT-Creation-Date: 2019-09-18 10:05+0200\n" -"PO-Revision-Date: 2019-11-17 09:57+0100\n" +"PO-Revision-Date: 2019-11-28 00:38+0100\n" "Last-Translator: Adrián Chaves (Gallaecio) \n" "Language-Team: Galician \n" "Language: gl\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=n != 1;\n" -"X-Generator: Lokalize 20.03.70\n" +"X-Generator: Lokalize 19.08.3\n" #. +> trunk5 #, kde-format msgctxt "NAME OF TRANSLATORS" msgid "Your names" msgstr "Xabi García, Marce Villarino" #. +> trunk5 #, kde-format msgctxt "EMAIL OF TRANSLATORS" msgid "Your emails" msgstr "xabigf@gmx.net, mvillarino@users.sourceforge.net" #. +> trunk5 #, kde-format msgctxt "color" msgid "AliceBlue" msgstr "Branco azulado" #. +> trunk5 #, kde-format msgctxt "color" msgid "AntiqueWhite" msgstr "Branco rosáceo" #. +> trunk5 #, kde-format msgctxt "color" msgid "AntiqueWhite1" msgstr "Branco rosáceo 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "AntiqueWhite2" msgstr "Branco rosáceo 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "AntiqueWhite3" msgstr "Branco rosáceo 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "AntiqueWhite4" msgstr "Branco rosáceo 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "BlanchedAlmond" msgstr "Branco améndoa" #. +> trunk5 #, kde-format msgctxt "color" msgid "BlueViolet" msgstr "Azul violeta" #. +> trunk5 #, kde-format msgctxt "color" msgid "CadetBlue" msgstr "Azul cadete" #. +> trunk5 #, kde-format msgctxt "color" msgid "CadetBlue1" msgstr "Azul cadete 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "CadetBlue2" msgstr "Azul cadete 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "CadetBlue3" msgstr "Azul cadete 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "CadetBlue4" msgstr "Azul cadete 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "CornflowerBlue" msgstr "Azul aciano" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkBlue" msgstr "Azul escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkCyan" msgstr "Cian escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGoldenrod" msgstr "Ámbar escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGoldenrod1" msgstr "Ámbar escuro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGoldenrod2" msgstr "Ámbar escuro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGoldenrod3" msgstr "Ámbar escuro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGoldenrod4" msgstr "Ámbar escuro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGray" msgstr "Gris escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGreen" msgstr "Verde escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkGrey" msgstr "Gris escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkKhaki" msgstr "Caqui escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkMagenta" msgstr "Maxenta escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOliveGreen" msgstr "Verde oliva escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOliveGreen1" msgstr "Verde oliva escuro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOliveGreen2" msgstr "Verde oliva escuro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOliveGreen3" msgstr "Verde oliva escuro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOliveGreen4" msgstr "Verde oliva escuro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrange" msgstr "Laranxa escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrange1" msgstr "Laranxa escuro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrange2" msgstr "Laranxa escuro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrange3" msgstr "Laranxa escuro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrange4" msgstr "Laranxa escuro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrchid" msgstr "Orquídea escura" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrchid1" msgstr "Orquídea escura 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrchid2" msgstr "Orquídea escura 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrchid3" msgstr "Orquídea escura 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkOrchid4" msgstr "Orquídea escura 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkRed" msgstr "Vermello escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSalmon" msgstr "Salmón escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSeaGreen" msgstr "Verde mariño escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSeaGreen1" msgstr "Verde mariño escuro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSeaGreen2" msgstr "Verde mariño escuro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSeaGreen3" msgstr "Verde mariño escuro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSeaGreen4" msgstr "Verde mariño escuro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSlateBlue" msgstr "Azul lousa escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSlateGray" msgstr "Gris lousa escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSlateGray1" msgstr "Gris lousa escuro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSlateGray2" msgstr "Gris lousa escuro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSlateGray3" msgstr "Gris lousa escuro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSlateGray4" msgstr "Gris lousa escuro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkSlateGrey" msgstr "Agrisado lousa escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkTurquoise" msgstr "Turquesa escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DarkViolet" msgstr "Violeta escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepPink" msgstr "Rosa escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepPink1" msgstr "Rosa escuro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepPink2" msgstr "Rosa escuro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepPink3" msgstr "Rosa escuro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepPink4" msgstr "Rosa escuro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepSkyBlue" msgstr "Azul celeste escuro" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepSkyBlue1" msgstr "Azul celeste escuro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepSkyBlue2" msgstr "Azul celeste escuro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepSkyBlue3" msgstr "Azul celeste escuro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DeepSkyBlue4" msgstr "Azul celeste escuro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "DimGray" msgstr "Gris tebra" #. +> trunk5 #, kde-format msgctxt "color" msgid "DimGrey" msgstr "Gris tebra" #. +> trunk5 #, kde-format msgctxt "color" msgid "DodgerBlue" msgstr "Azul Dodgers" #. +> trunk5 #, kde-format msgctxt "color" msgid "DodgerBlue1" msgstr "Azul Dodgers 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "DodgerBlue2" msgstr "Azul Dodgers 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "DodgerBlue3" msgstr "Azul Dodgers 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "DodgerBlue4" msgstr "Azul Dodgers 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "FloralWhite" msgstr "Branco floral" #. +> trunk5 #, kde-format msgctxt "color" msgid "ForestGreen" msgstr "Verde bosque" #. +> trunk5 #, kde-format msgctxt "color" msgid "GhostWhite" msgstr "Branco pantasma" #. +> trunk5 #, kde-format msgctxt "color" msgid "GreenYellow" msgstr "Verde amarelo" #. +> trunk5 #, kde-format msgctxt "color" msgid "HotPink" msgstr "Rosa cálido" #. +> trunk5 #, kde-format msgctxt "color" msgid "HotPink1" msgstr "Rosa cálido 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "HotPink2" msgstr "Rosa cálido 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "HotPink3" msgstr "Rosa cálido 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "HotPink4" msgstr "Rosa cálido 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "IndianRed" msgstr "Vermello indio" #. +> trunk5 #, kde-format msgctxt "color" msgid "IndianRed1" msgstr "Vermello indio 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "IndianRed2" msgstr "Vermello indio 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "IndianRed3" msgstr "Vermello indio 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "IndianRed4" msgstr "Vermello indio 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LavenderBlush" msgstr "Branco lavanda" #. +> trunk5 #, kde-format msgctxt "color" msgid "LavenderBlush1" msgstr "Branco lavanda 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LavenderBlush2" msgstr "Branco lavanda 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LavenderBlush3" msgstr "Branco lavanda 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LavenderBlush4" msgstr "Branco lavanda 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LawnGreen" msgstr "Verde herba" #. +> trunk5 #, kde-format msgctxt "color" msgid "LemonChiffon" msgstr "Polpa de limón" #. +> trunk5 #, kde-format msgctxt "color" msgid "LemonChiffon1" msgstr "Polpa de limón 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LemonChiffon2" msgstr "Polpa de limón 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LemonChiffon3" msgstr "Polpa de limón 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LemonChiffon4" msgstr "Polpa de limón 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightBlue" msgstr "Azul claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightBlue1" msgstr "Azul claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightBlue2" msgstr "Azul claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightBlue3" msgstr "Azul claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightBlue4" msgstr "Azul claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightCoral" msgstr "Coral claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightCyan" msgstr "Cian claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightCyan1" msgstr "Cian claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightCyan2" msgstr "Cian claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightCyan3" msgstr "Cian claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightCyan4" msgstr "Cian claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGoldenrod" msgstr "Ámbar claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGoldenrod1" msgstr "Ámbar claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGoldenrod2" msgstr "Ámbar claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGoldenrod3" msgstr "Ámbar claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGoldenrod4" msgstr "Ámbar claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGoldenrodYellow" msgstr "Ámbar amarelo claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGray" msgstr "Gris claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGreen" msgstr "Verde claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightGrey" msgstr "Gris claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightPink" msgstr "Rosa claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightPink1" msgstr "Rosa claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightPink2" msgstr "Rosa claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightPink3" msgstr "Rosa claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightPink4" msgstr "Rosa claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSalmon" msgstr "Salmón claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSalmon1" msgstr "Salmón claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSalmon2" msgstr "Salmón claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSalmon3" msgstr "Salmón claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSalmon4" msgstr "Salmón claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSeaGreen" msgstr "Verde mar claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSkyBlue" msgstr "Azul celeste claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSkyBlue1" msgstr "Azul celeste claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSkyBlue2" msgstr "Azul celeste claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSkyBlue3" msgstr "Azul celeste claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSkyBlue4" msgstr "Azul celeste claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSlateBlue" msgstr "Azul lousa claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSlateGray" msgstr "Gris lousa claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSlateGrey" msgstr "Gris lousa claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSteelBlue" msgstr "Azul aceiro claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSteelBlue1" msgstr "Azul aceiro claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSteelBlue2" msgstr "Azul aceiro claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSteelBlue3" msgstr "Azul aceiro claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightSteelBlue4" msgstr "Azul aceiro claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightYellow" msgstr "Amarelo claro" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightYellow1" msgstr "Amarelo claro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightYellow2" msgstr "Amarelo claro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightYellow3" msgstr "Amarelo claro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "LightYellow4" msgstr "Amarelo claro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "LimeGreen" msgstr "Verde lima" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumAquamarine" msgstr "Augamariña medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumBlue" msgstr "Azul medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumOrchid" msgstr "Orquídea medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumOrchid1" msgstr "Orquídea medio 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumOrchid2" msgstr "Orquídea medio 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumOrchid3" msgstr "Orquídea medio 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumOrchid4" msgstr "Orquídea medio 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumPurple" msgstr "Púrpura medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumPurple1" msgstr "Púrpura medio 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumPurple2" msgstr "Púrpura medio 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumPurple3" msgstr "Púrpura medio 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumPurple4" msgstr "Púrpura medio 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumSeaGreen" msgstr "Verde mariño medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumSlateBlue" msgstr "Azul lousa medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumSpringGreen" msgstr "Verde primavera medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumTurquoise" msgstr "Turquesa medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MediumVioletRed" msgstr "Vermello violeta medio" #. +> trunk5 #, kde-format msgctxt "color" msgid "MidnightBlue" msgstr "Azul medianoite" #. +> trunk5 #, kde-format msgctxt "color" msgid "MintCream" msgstr "Crema de menta" #. +> trunk5 #, kde-format msgctxt "color" msgid "MistyRose" msgstr "Rosa pastel" #. +> trunk5 #, kde-format msgctxt "color" msgid "MistyRose1" msgstr "Rosa pastel 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "MistyRose2" msgstr "Rosa pastel 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "MistyRose3" msgstr "Rosa pastel 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "MistyRose4" msgstr "Rosa pastel 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "NavajoWhite" msgstr "Cacahuete" #. +> trunk5 #, kde-format msgctxt "color" msgid "NavajoWhite1" msgstr "Cacahuete 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "NavajoWhite2" msgstr "Cacahuete 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "NavajoWhite3" msgstr "Cacahuete 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "NavajoWhite4" msgstr "Cacahuete 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "NavyBlue" msgstr "Azul mariño" #. +> trunk5 #, kde-format msgctxt "color" msgid "OldLace" msgstr "Fume alaranxado" #. +> trunk5 #, kde-format msgctxt "color" msgid "OliveDrab" msgstr "Gris oliva" #. +> trunk5 #, kde-format msgctxt "color" msgid "OliveDrab1" msgstr "Gris oliva 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "OliveDrab2" msgstr "Gris oliva 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "OliveDrab3" msgstr "Gris oliva 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "OliveDrab4" msgstr "Gris oliva 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "OrangeRed" msgstr "Laranxa vermello" #. +> trunk5 #, kde-format msgctxt "color" msgid "OrangeRed1" msgstr "Laranxa vermello 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "OrangeRed2" msgstr "Laranxa vermello 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "OrangeRed3" msgstr "Laranxa vermello 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "OrangeRed4" msgstr "Laranxa vermello 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleGoldenrod" msgstr "Ámbar pálido" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleGreen" msgstr "Verde pálido" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleGreen1" msgstr "Verde pálido 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleGreen2" msgstr "Verde pálido 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleGreen3" msgstr "Verde pálido 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleGreen4" msgstr "Verde pálido 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleTurquoise" msgstr "Turquesa pálido" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleTurquoise1" msgstr "Turquesa pálido 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleTurquoise2" msgstr "Turquesa pálido 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleTurquoise3" msgstr "Turquesa pálido 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleTurquoise4" msgstr "Turquesa pálido 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleVioletRed" msgstr "Vermello violeta pálido" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleVioletRed1" msgstr "Vermello violeta pálido 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleVioletRed2" msgstr "Vermello violeta pálido 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleVioletRed3" msgstr "Vermello violeta pálido 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "PaleVioletRed4" msgstr "Vermello violeta pálido 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "PapayaWhip" msgstr "Crema de papaia" #. +> trunk5 #, kde-format msgctxt "color" msgid "PeachPuff" msgstr "Polpa de pésego" #. +> trunk5 #, kde-format msgctxt "color" msgid "PeachPuff1" msgstr "Polpa de pésego 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "PeachPuff2" msgstr "Polpa de pésego 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "PeachPuff3" msgstr "Polpa de pésego 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "PeachPuff4" msgstr "Polpa de pésego 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "PowderBlue" msgstr "Azul po" #. +> trunk5 #, kde-format msgctxt "color" msgid "RosyBrown" msgstr "Marrón rosáceo" #. +> trunk5 #, kde-format msgctxt "color" msgid "RosyBrown1" msgstr "Marrón rosáceo 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "RosyBrown2" msgstr "Marrón rosáceo 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "RosyBrown3" msgstr "Marrón rosáceo 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "RosyBrown4" msgstr "Marrón rosáceo 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "RoyalBlue" msgstr "Azul real" #. +> trunk5 #, kde-format msgctxt "color" msgid "RoyalBlue1" msgstr "Azul real 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "RoyalBlue2" msgstr "Azul real 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "RoyalBlue3" msgstr "Azul real 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "RoyalBlue4" msgstr "Azul real 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "SaddleBrown" msgstr "Marrón coiro" #. +> trunk5 #, kde-format msgctxt "color" msgid "SandyBrown" msgstr "Marrón arroxado" #. +> trunk5 #, kde-format msgctxt "color" msgid "SeaGreen" msgstr "Verde mar" #. +> trunk5 #, kde-format msgctxt "color" msgid "SeaGreen1" msgstr "Verde mar 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "SeaGreen2" msgstr "Verde mar 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "SeaGreen3" msgstr "Verde mar 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "SeaGreen4" msgstr "Verde mar 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "SkyBlue" msgstr "Celeste" #. +> trunk5 #, kde-format msgctxt "color" msgid "SkyBlue1" msgstr "Celeste 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "SkyBlue2" msgstr "Celeste 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "SkyBlue3" msgstr "Celeste 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "SkyBlue4" msgstr "Celeste 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateBlue" msgstr "Azul lousa" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateBlue1" msgstr "Azul lousa 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateBlue2" msgstr "Azul lousa 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateBlue3" msgstr "Azul lousa 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateBlue4" msgstr "Azul lousa 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateGray" msgstr "Gris lousa" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateGray1" msgstr "Gris lousa 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateGray2" msgstr "Gris lousa 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateGray3" msgstr "Gris lousa 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateGray4" msgstr "Gris lousa 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "SlateGrey" msgstr "Gris lousa" #. +> trunk5 #, kde-format msgctxt "color" msgid "SpringGreen" msgstr "Verde primavera" #. +> trunk5 #, kde-format msgctxt "color" msgid "SpringGreen1" msgstr "Verde primavera 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "SpringGreen2" msgstr "Verde primavera 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "SpringGreen3" msgstr "Verde primavera 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "SpringGreen4" msgstr "Verde primavera 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "SteelBlue" msgstr "Azul aceiro" #. +> trunk5 #, kde-format msgctxt "color" msgid "SteelBlue1" msgstr "Azul aceiro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "SteelBlue2" msgstr "Azul aceiro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "SteelBlue3" msgstr "Azul aceiro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "SteelBlue4" msgstr "Azul aceiro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "VioletRed" msgstr "Vermello violeta" #. +> trunk5 #, kde-format msgctxt "color" msgid "VioletRed1" msgstr "Vermello violeta 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "VioletRed2" msgstr "Vermello violeta 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "VioletRed3" msgstr "Vermello violeta 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "VioletRed4" msgstr "Vermello violeta 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "WhiteSmoke" msgstr "Branco fume" #. +> trunk5 #, kde-format msgctxt "color" msgid "YellowGreen" msgstr "Verde amarelo" #. +> trunk5 #, kde-format msgctxt "color" msgid "aquamarine" msgstr "Augamariña" #. +> trunk5 #, kde-format msgctxt "color" msgid "aquamarine1" msgstr "Augamariña 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "aquamarine2" msgstr "Augamariña 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "aquamarine3" msgstr "Augamariña 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "aquamarine4" msgstr "Augamariña 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "azure" msgstr "azur" #. +> trunk5 #, kde-format msgctxt "color" msgid "azure1" msgstr "azur 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "azure2" msgstr "azur 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "azure3" msgstr "azur 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "azure4" msgstr "azur 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "beige" msgstr "beixe" #. +> trunk5 #, kde-format msgctxt "color" msgid "bisque" msgstr "rosa caranguexo" #. +> trunk5 #, kde-format msgctxt "color" msgid "bisque1" msgstr "rosa caranguexo 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "bisque2" msgstr "rosa caranguexo 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "bisque3" msgstr "rosa caranguexo 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "bisque4" msgstr "rosa caranguexo 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "black" msgstr "negro" #. +> trunk5 #, kde-format msgctxt "color" msgid "blue" msgstr "azul" #. +> trunk5 #, kde-format msgctxt "color" msgid "blue1" msgstr "azul 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "blue2" msgstr "azul 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "blue3" msgstr "azul 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "blue4" msgstr "azul 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "brown" msgstr "marrón" #. +> trunk5 #, kde-format msgctxt "color" msgid "brown1" msgstr "marrón 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "brown2" msgstr "marrón 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "brown3" msgstr "marrón 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "brown4" msgstr "marrón 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "burlywood" msgstr "castaño" #. +> trunk5 #, kde-format msgctxt "color" msgid "burlywood1" msgstr "castaño 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "burlywood2" msgstr "castaño 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "burlywood3" msgstr "castaño 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "burlywood4" msgstr "castaño 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "chartreuse" msgstr "chartreuse" #. +> trunk5 #, kde-format msgctxt "color" msgid "chartreuse1" msgstr "chartreuse 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "chartreuse2" msgstr "chartreuse 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "chartreuse3" msgstr "chartreuse 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "chartreuse4" msgstr "chartreuse 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "chocolate" msgstr "chocolate" #. +> trunk5 #, kde-format msgctxt "color" msgid "chocolate1" msgstr "chocolate 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "chocolate2" msgstr "chocolate 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "chocolate3" msgstr "chocolate 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "chocolate4" msgstr "chocolate 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "coral" msgstr "coral" #. +> trunk5 #, kde-format msgctxt "color" msgid "coral1" msgstr "coral 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "coral2" msgstr "coral 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "coral3" msgstr "coral 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "coral4" msgstr "coral 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "cornsilk" msgstr "millo sedoso" #. +> trunk5 #, kde-format msgctxt "color" msgid "cornsilk1" msgstr "millo sedoso 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "cornsilk2" msgstr "millo sedoso 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "cornsilk3" msgstr "millo sedoso 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "cornsilk4" msgstr "millo sedoso 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "cyan" msgstr "cian" #. +> trunk5 #, kde-format msgctxt "color" msgid "cyan1" msgstr "cian 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "cyan2" msgstr "cian 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "cyan3" msgstr "cian 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "cyan4" msgstr "cian 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "firebrick" msgstr "ladrillo refractario" #. +> trunk5 #, kde-format msgctxt "color" msgid "firebrick1" msgstr "ladrillo refractario 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "firebrick2" msgstr "ladrillo refractario 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "firebrick3" msgstr "ladrillo refractario 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "firebrick4" msgstr "ladrillo refractario 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "gainsboro" msgstr "aluminio" #. +> trunk5 #, kde-format msgctxt "color" msgid "gold" msgstr "ouro" #. +> trunk5 #, kde-format msgctxt "color" msgid "gold1" msgstr "ouro 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "gold2" msgstr "ouro 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "gold3" msgstr "ouro 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "gold4" msgstr "ouro 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "goldenrod" msgstr "ámbar" #. +> trunk5 #, kde-format msgctxt "color" msgid "goldenrod1" msgstr "ámbar 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "goldenrod2" msgstr "ámbar 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "goldenrod3" msgstr "ámbar 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "goldenrod4" msgstr "ámbar 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "green" msgstr "verde" #. +> trunk5 #, kde-format msgctxt "color" msgid "green1" msgstr "verde 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "green2" msgstr "verde 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "green3" msgstr "verde 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "green4" msgstr "verde 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "honeydew" msgstr "melón" #. +> trunk5 #, kde-format msgctxt "color" msgid "honeydew1" msgstr "melón 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "honeydew2" msgstr "melón 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "honeydew3" msgstr "melón 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "honeydew4" msgstr "melón 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "ivory" msgstr "almafí" #. +> trunk5 #, kde-format msgctxt "color" msgid "ivory1" msgstr "almafí 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "ivory2" msgstr "almafí 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "ivory3" msgstr "almafí 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "ivory4" msgstr "almafí 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "khaki" msgstr "caqui" #. +> trunk5 #, kde-format msgctxt "color" msgid "khaki1" msgstr "caqui 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "khaki2" msgstr "caqui 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "khaki3" msgstr "caqui 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "khaki4" msgstr "caqui 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "lavender" msgstr "lavanda" #. +> trunk5 #, kde-format msgctxt "color" msgid "linen" msgstr "liño" #. +> trunk5 #, kde-format msgctxt "color" msgid "magenta" msgstr "maxenta" #. +> trunk5 #, kde-format msgctxt "color" msgid "magenta1" msgstr "maxenta 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "magenta2" msgstr "maxenta 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "magenta3" msgstr "maxenta 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "magenta4" msgstr "maxenta 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "maroon" msgstr "granate" #. +> trunk5 #, kde-format msgctxt "color" msgid "maroon1" msgstr "granate 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "maroon2" msgstr "granate 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "maroon3" msgstr "granate 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "maroon4" msgstr "granate 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "moccasin" msgstr "améndoa torrada" #. +> trunk5 #, kde-format msgctxt "color" msgid "navy" msgstr "mariño" #. +> trunk5 #, kde-format msgctxt "color" msgid "orange" msgstr "laranxa" #. +> trunk5 #, kde-format msgctxt "color" msgid "orange1" msgstr "laranxa 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "orange2" msgstr "laranxa 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "orange3" msgstr "laranxa 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "orange4" msgstr "laranxa 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "orchid" msgstr "orquídea" #. +> trunk5 #, kde-format msgctxt "color" msgid "orchid1" msgstr "orquídea 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "orchid2" msgstr "orquídea 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "orchid3" msgstr "orquídea 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "orchid4" msgstr "orquídea 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "peru" msgstr "perú" #. +> trunk5 #, kde-format msgctxt "color" msgid "pink" msgstr "rosa" #. +> trunk5 #, kde-format msgctxt "color" msgid "pink1" msgstr "rosa 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "pink2" msgstr "rosa 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "pink3" msgstr "rosa 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "pink4" msgstr "rosa 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "plum" msgstr "ameixa" #. +> trunk5 #, kde-format msgctxt "color" msgid "plum1" msgstr "ameixa 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "plum2" msgstr "ameixa 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "plum3" msgstr "ameixa 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "plum4" msgstr "ameixa 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "purple" msgstr "púrpura" #. +> trunk5 #, kde-format msgctxt "color" msgid "purple1" msgstr "púrpura 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "purple2" msgstr "púrpura 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "purple3" msgstr "púrpura 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "purple4" msgstr "púrpura 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "red" msgstr "vermello" #. +> trunk5 #, kde-format msgctxt "color" msgid "red1" msgstr "vermello 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "red2" msgstr "vermello 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "red3" msgstr "vermello 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "red4" msgstr "vermello 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "salmon" msgstr "salmón" #. +> trunk5 #, kde-format msgctxt "color" msgid "salmon1" msgstr "salmón 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "salmon2" msgstr "salmón 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "salmon3" msgstr "salmón 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "salmon4" msgstr "salmón 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "seashell" msgstr "nácara" #. +> trunk5 #, kde-format msgctxt "color" msgid "seashell1" msgstr "nácara 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "seashell2" msgstr "nácara 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "seashell3" msgstr "nácara 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "seashell4" msgstr "nácara 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "sienna" msgstr "siena" #. +> trunk5 #, kde-format msgctxt "color" msgid "sienna1" msgstr "siena 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "sienna2" msgstr "siena 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "sienna3" msgstr "siena 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "sienna4" msgstr "siena 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "snow" msgstr "neve" #. +> trunk5 #, kde-format msgctxt "color" msgid "snow1" msgstr "neve 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "snow2" msgstr "neve 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "snow3" msgstr "neve 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "snow4" msgstr "neve 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "tan" msgstr "bronceado" #. +> trunk5 #, kde-format msgctxt "color" msgid "tan1" msgstr "bronceado 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "tan2" msgstr "bronceado 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "tan3" msgstr "bronceado 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "tan4" msgstr "bronceado 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "thistle" msgstr "morado" #. +> trunk5 #, kde-format msgctxt "color" msgid "thistle1" msgstr "cardo 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "thistle2" msgstr "cardo 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "thistle3" msgstr "cardo 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "thistle4" msgstr "cardo 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "tomato" msgstr "tomate" #. +> trunk5 #, kde-format msgctxt "color" msgid "tomato1" msgstr "tomate 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "tomato2" msgstr "tomate 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "tomato3" msgstr "tomate 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "tomato4" msgstr "tomate 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "turquoise" msgstr "turquesa" #. +> trunk5 #, kde-format msgctxt "color" msgid "turquoise1" msgstr "turquesa 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "turquoise2" msgstr "turquesa 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "turquoise3" msgstr "turquesa 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "turquoise4" msgstr "turquesa 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "violet" msgstr "violeta" #. +> trunk5 #, kde-format msgctxt "color" msgid "wheat" msgstr "trigo" #. +> trunk5 #, kde-format msgctxt "color" msgid "wheat1" msgstr "trigo 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "wheat2" msgstr "trigo 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "wheat3" msgstr "trigo 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "wheat4" msgstr "trigo 4" #. +> trunk5 #, kde-format msgctxt "color" msgid "white" msgstr "branco" #. +> trunk5 #, kde-format msgctxt "color" msgid "yellow" msgstr "amarelo" #. +> trunk5 #, kde-format msgctxt "color" msgid "yellow1" msgstr "amarelo 1" #. +> trunk5 #, kde-format msgctxt "color" msgid "yellow2" msgstr "amarelo 2" #. +> trunk5 #, kde-format msgctxt "color" msgid "yellow3" msgstr "amarelo 3" #. +> trunk5 #, kde-format msgctxt "color" msgid "yellow4" msgstr "amarelo 4" #. +> trunk5 #: kdebugdialog/kdebugdialog.cpp:43 kdebugdialog/klistdebugdialog.cpp:37 #, kde-format msgid "Debug Settings" msgstr "Configuración de depuración" #. +> trunk5 #: kdebugdialog/kdebugdialog.cpp:58 #, kde-format msgid "File" msgstr "Ficheiro" #. +> trunk5 #: kdebugdialog/kdebugdialog.cpp:59 #, kde-format msgid "Message Box" msgstr "Área da mensaxe" #. +> trunk5 #: kdebugdialog/kdebugdialog.cpp:60 #, kde-format msgid "Shell" msgstr "Intérprete de ordes" #. +> trunk5 #: kdebugdialog/kdebugdialog.cpp:61 #, kde-format msgid "Syslog" msgstr "Syslog" #. +> trunk5 #: kdebugdialog/kdebugdialog.cpp:62 #, kde-format msgid "None" msgstr "Ningún" #. i18n: ectx: property (title), widget (QGroupBox, pInfoGroup) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:48 #, kde-format msgid "Information" msgstr "Información" #. i18n: ectx: property (text), widget (QLabel, label_2) #. i18n: ectx: property (text), widget (QLabel, label_8) #. i18n: ectx: property (text), widget (QLabel, label_4) #. i18n: ectx: property (text), widget (QLabel, label_6) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:54 kdebugdialog/kdebugdialog.ui:89 #: kdebugdialog/kdebugdialog.ui:151 kdebugdialog/kdebugdialog.ui:186 #, kde-format msgid "Output to:" msgstr "Saída a:" #. i18n: ectx: property (text), widget (QLabel, label_3) #. i18n: ectx: property (text), widget (QLabel, label_9) #. i18n: ectx: property (text), widget (QLabel, label_5) #. i18n: ectx: property (text), widget (QLabel, label_7) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:67 kdebugdialog/kdebugdialog.ui:102 #: kdebugdialog/kdebugdialog.ui:164 kdebugdialog/kdebugdialog.ui:199 #, kde-format msgid "Filename:" msgstr "Nome do ficheiro:" #. i18n: ectx: property (title), widget (QGroupBox, pErrorGroup) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:83 #, kde-format msgid "Error" msgstr "Erro" #. i18n: ectx: property (text), widget (QCheckBox, pAbortFatal) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:118 #, kde-format msgid "Abort on fatal errors" msgstr "Interromper cando se produzan erros fatais" #. i18n: ectx: property (text), widget (QCheckBox, m_disableAll2) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:138 kdebugdialog/klistdebugdialog.cpp:77 #, kde-format msgid "Disable all debug output" msgstr "Desactivar toda a saída de depuración" #. i18n: ectx: property (title), widget (QGroupBox, pWarnGroup) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:145 #, kde-format msgid "Warning" msgstr "Aviso" #. i18n: ectx: property (title), widget (QGroupBox, pFatalGroup) #. +> trunk5 #: kdebugdialog/kdebugdialog.ui:180 #, kde-format msgid "Fatal Error" msgstr "Erro fatal" #. +> trunk5 #: kdebugdialog/klistdebugdialog.cpp:68 #, kde-format msgid "&Select All" msgstr "Escoller &todo" #. +> trunk5 #: kdebugdialog/klistdebugdialog.cpp:69 #, kde-format msgid "&Deselect All" msgstr "&Anular toda a selección" #. +> trunk5 #: kdebugdialog/main.cpp:100 #, kde-format msgid "KDebugDialog" msgstr "KDebugDialog" #. +> trunk5 #: kdebugdialog/main.cpp:101 #, kde-format msgid "A dialog box for setting preferences for debug output" -msgstr "Unha diálogo para estabelecer as preferencias para a depuración da saída" +msgstr "" +"Unha diálogo para estabelecer as preferencias para a depuración da saída" #. +> trunk5 #: kdebugdialog/main.cpp:102 #, kde-format msgid "Copyright 1999-2009, David Faure " msgstr "© 1999-2009 David Faure " #. +> trunk5 #: kdebugdialog/main.cpp:103 #, kde-format msgid "David Faure" msgstr "David Faure" #. +> trunk5 #: kdebugdialog/main.cpp:103 #, kde-format msgid "Maintainer" msgstr "Mantedor" #. +> trunk5 #: kdebugdialog/main.cpp:108 #, kde-format msgid "Show the fully-fledged dialog instead of the default list dialog" -msgstr "Mostrar o diálogo completamente detallado no canto do diálogo predeterminado" +msgstr "" +"Mostrar o diálogo completamente detallado no canto do diálogo predeterminado" #. +> trunk5 #: kdebugdialog/main.cpp:109 #, kde-format msgid "Turn area on" msgstr "Acender a área" #. +> trunk5 #: kdebugdialog/main.cpp:110 #, kde-format msgid "Turn area off" msgstr "Apagar a área" #. +> trunk5 #: kdecore/k3resolver.cpp:534 kdecore/netsupp.cpp:868 #, kde-format msgid "no error" msgstr "sen erro" #. +> trunk5 #: kdecore/k3resolver.cpp:535 #, kde-format msgid "requested family not supported for this host name" msgstr "a familia pedida non está admitida por este nome de servidor" #. +> trunk5 #: kdecore/k3resolver.cpp:536 kdecore/netsupp.cpp:870 #, kde-format msgid "temporary failure in name resolution" msgstr "fallo temporal na resolución do nome" #. +> trunk5 #: kdecore/k3resolver.cpp:537 kdecore/netsupp.cpp:872 #, kde-format msgid "non-recoverable failure in name resolution" msgstr "fallo non recuperábel na resolución do nome" #. +> trunk5 #: kdecore/k3resolver.cpp:538 #, kde-format msgid "invalid flags" msgstr "bandeiras incorrectas" #. +> trunk5 #: kdecore/k3resolver.cpp:539 kdecore/netsupp.cpp:874 #, kde-format msgid "memory allocation failure" msgstr "fallo de reserva de memoria" #. +> trunk5 #: kdecore/k3resolver.cpp:540 kdecore/netsupp.cpp:876 #, kde-format msgid "name or service not known" msgstr "nome de servizo descoñecido" #. +> trunk5 #: kdecore/k3resolver.cpp:541 #, kde-format msgid "requested family not supported" msgstr "a familia pedida non está admitida" #. +> trunk5 #: kdecore/k3resolver.cpp:542 #, kde-format msgid "requested service not supported for this socket type" msgstr "o servizo pedido non está admitido por este tipo de socket" #. +> trunk5 #: kdecore/k3resolver.cpp:543 #, kde-format msgid "requested socket type not supported" msgstr "o tipo de socket pedido non está admitido" #. +> trunk5 #: kdecore/k3resolver.cpp:544 #, kde-format msgid "unknown error" msgstr "erro descoñecido" #. +> trunk5 #: kdecore/k3resolver.cpp:546 #, kde-format msgctxt "1: the i18n'ed system error code, from errno" msgid "system error: %1" msgstr "erro do sistema: %1" #. +> trunk5 #: kdecore/k3resolver.cpp:557 #, kde-format msgid "request was canceled" msgstr "cancelouse a solicitude" #. +> trunk5 #: kdecore/k3socketaddress.cpp:631 #, kde-format msgctxt "1: the unknown socket address family number" msgid "Unknown family %1" msgstr "Familia %1 descoñecida" #. +> trunk5 #: kdecore/k3socketbase.cpp:215 #, kde-format msgctxt "Socket error code NoError" msgid "no error" msgstr "sen erro" #. +> trunk5 #: kdecore/k3socketbase.cpp:220 #, kde-format msgctxt "Socket error code LookupFailure" msgid "name lookup has failed" msgstr "fallou a resolución do nome" #. +> trunk5 #: kdecore/k3socketbase.cpp:225 #, kde-format msgctxt "Socket error code AddressInUse" msgid "address already in use" msgstr "o enderezo xa está a usarse" #. +> trunk5 #: kdecore/k3socketbase.cpp:230 #, kde-format msgctxt "Socket error code AlreadyBound" msgid "socket is already bound" msgstr "o socket xa está asociado" #. +> trunk5 #: kdecore/k3socketbase.cpp:235 #, kde-format msgctxt "Socket error code AlreadyCreated" msgid "socket is already created" msgstr "o socket xa está creado" #. +> trunk5 #: kdecore/k3socketbase.cpp:240 #, kde-format msgctxt "Socket error code NotBound" msgid "socket is not bound" msgstr "o socket non está asociado" #. +> trunk5 #: kdecore/k3socketbase.cpp:245 #, kde-format msgctxt "Socket error code NotCreated" msgid "socket has not been created" msgstr "o socket non se creou" #. +> trunk5 #: kdecore/k3socketbase.cpp:250 #, kde-format msgctxt "Socket error code WouldBlock" msgid "operation would block" msgstr "a operación bloquearía" #. +> trunk5 #: kdecore/k3socketbase.cpp:255 #, kde-format msgctxt "Socket error code ConnectionRefused" msgid "connection actively refused" msgstr "conexión rexeitada activamente" #. +> trunk5 #: kdecore/k3socketbase.cpp:260 #, kde-format msgctxt "Socket error code ConnectionTimedOut" msgid "connection timed out" msgstr "a conexión esgotou o tempo de agarda" #. +> trunk5 #: kdecore/k3socketbase.cpp:265 #, kde-format msgctxt "Socket error code InProgress" msgid "operation is already in progress" msgstr "a operación xa está en marcha" #. +> trunk5 #: kdecore/k3socketbase.cpp:270 #, kde-format msgctxt "Socket error code NetFailure" msgid "network failure occurred" msgstr "ocorreu un fallo na rede" #. +> trunk5 #: kdecore/k3socketbase.cpp:275 #, kde-format msgctxt "Socket error code NotSupported" msgid "operation is not supported" msgstr "a operación non está admitida" #. +> trunk5 #: kdecore/k3socketbase.cpp:280 #, kde-format msgctxt "Socket error code Timeout" msgid "timed operation timed out" msgstr "a operación cronometrada esgotou o tempo" #. +> trunk5 #: kdecore/k3socketbase.cpp:285 #, kde-format msgctxt "Socket error code UnknownError" msgid "an unknown/unexpected error has happened" msgstr "ocorreu un erro descoñecido/inesperado" #. +> trunk5 #: kdecore/k3socketbase.cpp:290 #, kde-format msgctxt "Socket error code RemotelyDisconnected" msgid "remote host closed connection" msgstr "a máquina remota pechou a conexión" #. +> trunk5 #: kdecore/k4aboutdata.cpp:267 #, kde-format msgid "" "No licensing terms for this program have been specified.\n" "Please check the documentation or the source for any\n" "licensing terms.\n" msgstr "" "Non se especificou a licenza deste programa.\n" "Comprobe se os termos da licenza están definidos na\n" "documentación ou no código fonte.\n" #. +> trunk5 #: kdecore/k4aboutdata.cpp:273 #, kde-format msgid "This program is distributed under the terms of the %1." msgstr "Este programa distribúese baixo os termos da licenza %1." #. +> trunk5 #: kdecore/k4aboutdata.cpp:297 #, kde-format msgctxt "@item license (short name)" msgid "GPL v2" msgstr "GPL v2" #. +> trunk5 #: kdecore/k4aboutdata.cpp:298 #, kde-format msgctxt "@item license" msgid "GNU General Public License Version 2" msgstr "Licenza Pública Xeral de GNU, Versión 2" #. +> trunk5 #: kdecore/k4aboutdata.cpp:301 #, kde-format msgctxt "@item license (short name)" msgid "LGPL v2" msgstr "LGPL v2" #. +> trunk5 #: kdecore/k4aboutdata.cpp:302 #, kde-format msgctxt "@item license" msgid "GNU Lesser General Public License Version 2" msgstr "Licenza Pública Xeral Menor de GNU, Versión 2" #. +> trunk5 #: kdecore/k4aboutdata.cpp:305 #, kde-format msgctxt "@item license (short name)" msgid "BSD License" msgstr "Licenza BSD" #. +> trunk5 #: kdecore/k4aboutdata.cpp:306 #, kde-format msgctxt "@item license" msgid "BSD License" msgstr "Licenza BSD" #. +> trunk5 #: kdecore/k4aboutdata.cpp:309 #, kde-format msgctxt "@item license (short name)" msgid "Artistic License" msgstr "Licenza artística" #. +> trunk5 #: kdecore/k4aboutdata.cpp:310 #, kde-format msgctxt "@item license" msgid "Artistic License" msgstr "Licenza artística" #. +> trunk5 #: kdecore/k4aboutdata.cpp:313 #, kde-format msgctxt "@item license (short name)" msgid "QPL v1.0" msgstr "QPL v1.0" #. +> trunk5 #: kdecore/k4aboutdata.cpp:314 #, kde-format msgctxt "@item license" msgid "Q Public License" msgstr "Licenza pública Q" #. +> trunk5 #: kdecore/k4aboutdata.cpp:317 #, kde-format msgctxt "@item license (short name)" msgid "GPL v3" msgstr "GPL v3" #. +> trunk5 #: kdecore/k4aboutdata.cpp:318 #, kde-format msgctxt "@item license" msgid "GNU General Public License Version 3" msgstr "Licenza Pública Xeral de GNU, Versión 3" #. +> trunk5 #: kdecore/k4aboutdata.cpp:321 #, kde-format msgctxt "@item license (short name)" msgid "LGPL v3" msgstr "LGPL v3" #. +> trunk5 #: kdecore/k4aboutdata.cpp:322 #, kde-format msgctxt "@item license" msgid "GNU Lesser General Public License Version 3" msgstr "Licenza Pública Xeral Menor de GNU, Versión 3" #. +> trunk5 #: kdecore/k4aboutdata.cpp:326 #, kde-format msgctxt "@item license" msgid "Custom" msgstr "Personalizada" #. +> trunk5 #: kdecore/k4aboutdata.cpp:329 #, kde-format msgctxt "@item license" msgid "Not specified" msgstr "Non especificada" #. +> trunk5 #: kdecore/k4aboutdata.cpp:891 #, kde-format msgctxt "replace this with information about your translation team" msgid "" -"

KDE is translated into many languages thanks to the work of the translation teams all over the world.

" -"

For more information on KDE internationalization visit http://l10n.kde.org

" +"

KDE is translated into many languages thanks to the work of the" +" translation teams all over the world.

" +"

For more information on KDE internationalization visit http://l10n.kde.org

" msgstr "" -"

KDE está traducido a moitos idiomas grazas ao traballo dos equipos de tradución de todo o mundo.

" -"

Para máis información sobre a internacionalización de KDE visite http://l10n.kde.org

" +"

KDE está traducido a moitos idiomas grazas ao traballo dos equipos de" +" tradución de todo o mundo.

" +"

Para máis información sobre a internacionalización de KDE visite http://l10n.kde.org

" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:108 #, kde-format msgctxt "@item Calendar system" msgid "Gregorian" msgstr "Gregoriano" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:110 #, kde-format msgctxt "@item Calendar system" msgid "Coptic" msgstr "Copto" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:112 #, kde-format msgctxt "@item Calendar system" msgid "Ethiopian" msgstr "Etíope" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:114 #, kde-format msgctxt "@item Calendar system" msgid "Hebrew" msgstr "Hebreo" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:116 #, kde-format msgctxt "@item Calendar system" msgid "Islamic / Hijri (Civil)" msgstr "Islámico / Hijri (Civil)" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:118 #, kde-format msgctxt "@item Calendar system" msgid "Indian National" msgstr "Nacional da India" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:120 #, kde-format msgctxt "@item Calendar system" msgid "Jalali" msgstr "Jalali" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:122 #, kde-format msgctxt "@item Calendar system" msgid "Japanese" msgstr "Xaponés" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:124 #, kde-format msgctxt "@item Calendar system" msgid "Julian" msgstr "Xuliano" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:126 #, kde-format msgctxt "@item Calendar system" msgid "Taiwanese" msgstr "Taiwanés" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:128 #, kde-format msgctxt "@item Calendar system" msgid "Thai" msgstr "Tailandés" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:131 #, kde-format msgctxt "@item Calendar system" msgid "Invalid Calendar Type" msgstr "Tipo incorrecto de calendario" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:1495 #, kde-format msgctxt "Negative symbol as used for year numbers, e.g. -5 = 5 BC" msgid "-" msgstr "-" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:1532 kdecore/klocale_kde.cpp:2208 #: kio/kfilemetadataprovider.cpp:199 #, kde-format msgid "Today" msgstr "Hoxe" #. +> trunk5 #: kdecore/kcalendarsystem.cpp:1534 kdecore/klocale_kde.cpp:2211 #: kio/kfilemetadataprovider.cpp:202 #, kde-format msgid "Yesterday" msgstr "Onte" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:45 #, kde-format msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, LongFormat" msgid "Anno Martyrum" msgstr "Era Diocleciana (Anno Diocletiani)" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:46 #, kde-format msgctxt "Calendar Era: Coptic Era of Martyrs, years > 0, ShortFormat" msgid "AM" msgstr "AD" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:47 #, kde-format -msgctxt "(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" +msgctxt "" +"(kdedt-format) Coptic, AM, full era year format used for %EY, e.g. 2000 AM" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:153 #, kde-format msgctxt "Coptic month 1 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:155 #, kde-format msgctxt "Coptic month 2 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:157 #, kde-format msgctxt "Coptic month 3 - KLocale::NarrowName" msgid "H" msgstr "H" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:159 #, kde-format msgctxt "Coptic month 4 - KLocale::NarrowName" msgid "K" msgstr "K" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:161 #, kde-format msgctxt "Coptic month 5 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:163 #, kde-format msgctxt "Coptic month 6 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:165 #, kde-format msgctxt "Coptic month 7 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:167 #, kde-format msgctxt "Coptic month 8 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:169 #, kde-format msgctxt "Coptic month 9 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:171 #, kde-format msgctxt "Coptic month 10 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:173 #, kde-format msgctxt "Coptic month 11 - KLocale::NarrowName" msgid "E" msgstr "E" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:175 #, kde-format msgctxt "Coptic month 12 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:177 #, kde-format msgctxt "Coptic month 13 - KLocale::NarrowName" msgid "K" msgstr "K" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:186 #, kde-format msgctxt "Coptic month 1 - KLocale::ShortName Possessive" msgid "of Tho" msgstr "de Tho" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:188 #, kde-format msgctxt "Coptic month 2 - KLocale::ShortName Possessive" msgid "of Pao" msgstr "de Pao" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:190 #, kde-format msgctxt "Coptic month 3 - KLocale::ShortName Possessive" msgid "of Hat" msgstr "de Hat" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:192 #, kde-format msgctxt "Coptic month 4 - KLocale::ShortName Possessive" msgid "of Kia" msgstr "de Kia" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:194 #, kde-format msgctxt "Coptic month 5 - KLocale::ShortName Possessive" msgid "of Tob" msgstr "de Tob" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:196 #, kde-format msgctxt "Coptic month 6 - KLocale::ShortName Possessive" msgid "of Mes" msgstr "de Mes" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:198 #, kde-format msgctxt "Coptic month 7 - KLocale::ShortName Possessive" msgid "of Par" msgstr "de Par" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:200 #, kde-format msgctxt "Coptic month 8 - KLocale::ShortName Possessive" msgid "of Pam" msgstr "de Pam" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:202 #, kde-format msgctxt "Coptic month 9 - KLocale::ShortName Possessive" msgid "of Pas" msgstr "de Pas" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:204 #, kde-format msgctxt "Coptic month 10 - KLocale::ShortName Possessive" msgid "of Pan" msgstr "de Pan" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:206 #, kde-format msgctxt "Coptic month 11 - KLocale::ShortName Possessive" msgid "of Epe" msgstr "de Epe" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:208 #, kde-format msgctxt "Coptic month 12 - KLocale::ShortName Possessive" msgid "of Meo" msgstr "de Meo" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:210 #, kde-format msgctxt "Coptic month 13 - KLocale::ShortName Possessive" msgid "of Kou" msgstr "de Kou" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:219 #, kde-format msgctxt "Coptic month 1 - KLocale::ShortName" msgid "Tho" msgstr "Tho" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:221 #, kde-format msgctxt "Coptic month 2 - KLocale::ShortName" msgid "Pao" msgstr "Pao" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:223 #, kde-format msgctxt "Coptic month 3 - KLocale::ShortName" msgid "Hat" msgstr "Hat" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:225 #, kde-format msgctxt "Coptic month 4 - KLocale::ShortName" msgid "Kia" msgstr "Kia" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:227 #, kde-format msgctxt "Coptic month 5 - KLocale::ShortName" msgid "Tob" msgstr "Tob" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:229 #, kde-format msgctxt "Coptic month 6 - KLocale::ShortName" msgid "Mes" msgstr "Mes" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:231 #, kde-format msgctxt "Coptic month 7 - KLocale::ShortName" msgid "Par" msgstr "Par" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:233 #, kde-format msgctxt "Coptic month 8 - KLocale::ShortName" msgid "Pam" msgstr "Pam" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:235 #, kde-format msgctxt "Coptic month 9 - KLocale::ShortName" msgid "Pas" msgstr "Pas" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:237 #, kde-format msgctxt "Coptic month 10 - KLocale::ShortName" msgid "Pan" msgstr "Pan" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:239 #, kde-format msgctxt "Coptic month 11 - KLocale::ShortName" msgid "Epe" msgstr "Epe" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:241 #, kde-format msgctxt "Coptic month 12 - KLocale::ShortName" msgid "Meo" msgstr "Meo" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:243 #, kde-format msgctxt "Coptic month 12 - KLocale::ShortName" msgid "Kou" msgstr "Kou" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:252 #, kde-format msgctxt "Coptic month 1 - KLocale::LongName Possessive" msgid "of Thoout" msgstr "de Thoout" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:254 #, kde-format msgctxt "Coptic month 2 - KLocale::LongName Possessive" msgid "of Paope" msgstr "de Paope" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:256 #, kde-format msgctxt "Coptic month 3 - KLocale::LongName Possessive" msgid "of Hathor" msgstr "de Hathor" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:258 #, kde-format msgctxt "Coptic month 4 - KLocale::LongName Possessive" msgid "of Kiahk" msgstr "de Kiahk" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:260 #, kde-format msgctxt "Coptic month 5 - KLocale::LongName Possessive" msgid "of Tobe" msgstr "de Tobe" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:262 #, kde-format msgctxt "Coptic month 6 - KLocale::LongName Possessive" msgid "of Meshir" msgstr "de Meshir" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:264 #, kde-format msgctxt "Coptic month 7 - KLocale::LongName Possessive" msgid "of Paremhotep" msgstr "de Paremhotep" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:266 #, kde-format msgctxt "Coptic month 8 - KLocale::LongName Possessive" msgid "of Parmoute" msgstr "de Parmoute" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:268 #, kde-format msgctxt "Coptic month 9 - KLocale::LongName Possessive" msgid "of Pashons" msgstr "de Pashons" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:270 #, kde-format msgctxt "Coptic month 10 - KLocale::LongName Possessive" msgid "of Paone" msgstr "de Paone" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:272 #, kde-format msgctxt "Coptic month 11 - KLocale::LongName Possessive" msgid "of Epep" msgstr "de Epep" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:274 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName Possessive" msgid "of Mesore" msgstr "de Mesore" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:276 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName Possessive" msgid "of Kouji nabot" msgstr "de Kouji nabot" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:285 #, kde-format msgctxt "Coptic month 1 - KLocale::LongName" msgid "Thoout" msgstr "Thoout" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:287 #, kde-format msgctxt "Coptic month 2 - KLocale::LongName" msgid "Paope" msgstr "Paope" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:289 #, kde-format msgctxt "Coptic month 3 - KLocale::LongName" msgid "Hathor" msgstr "Hathor" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:291 #, kde-format msgctxt "Coptic month 4 - KLocale::LongName" msgid "Kiahk" msgstr "Kiahk" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:293 #, kde-format msgctxt "Coptic month 5 - KLocale::LongName" msgid "Tobe" msgstr "Tobe" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:295 #, kde-format msgctxt "Coptic month 6 - KLocale::LongName" msgid "Meshir" msgstr "Meshir" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:297 #, kde-format msgctxt "Coptic month 7 - KLocale::LongName" msgid "Paremhotep" msgstr "Paremhotep" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:299 #, kde-format msgctxt "Coptic month 8 - KLocale::LongName" msgid "Parmoute" msgstr "Parmoute" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:301 #, kde-format msgctxt "Coptic month 9 - KLocale::LongName" msgid "Pashons" msgstr "Pashons" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:303 #, kde-format msgctxt "Coptic month 10 - KLocale::LongName" msgid "Paone" msgstr "Paone" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:305 #, kde-format msgctxt "Coptic month 11 - KLocale::LongName" msgid "Epep" msgstr "Epep" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:307 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName" msgid "Mesore" msgstr "Mesore" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:309 #, kde-format msgctxt "Coptic month 12 - KLocale::LongName" msgid "Kouji nabot" msgstr "Kouji nabot" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:324 #, kde-format msgctxt "Coptic weekday 1 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:326 #, kde-format msgctxt "Coptic weekday 2 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:328 #, kde-format msgctxt "Coptic weekday 3 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:330 #, kde-format msgctxt "Coptic weekday 4 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:332 #, kde-format msgctxt "Coptic weekday 5 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:334 #, kde-format msgctxt "Coptic weekday 6 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:336 #, kde-format msgctxt "Coptic weekday 7 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:345 #, kde-format msgctxt "Coptic weekday 1 - KLocale::ShortName" msgid "Pes" msgstr "Pes" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:347 #, kde-format msgctxt "Coptic weekday 2 - KLocale::ShortName" msgid "Psh" msgstr "Psh" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:349 #, kde-format msgctxt "Coptic weekday 3 - KLocale::ShortName" msgid "Pef" msgstr "Pef" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:351 #, kde-format msgctxt "Coptic weekday 4 - KLocale::ShortName" msgid "Pti" msgstr "Pti" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:353 #, kde-format msgctxt "Coptic weekday 5 - KLocale::ShortName" msgid "Pso" msgstr "Pso" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:355 #, kde-format msgctxt "Coptic weekday 6 - KLocale::ShortName" msgid "Psa" msgstr "Psa" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:357 #, kde-format msgctxt "Coptic weekday 7 - KLocale::ShortName" msgid "Tky" msgstr "Tky" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:365 #, kde-format msgctxt "Coptic weekday 1 - KLocale::LongName" msgid "Pesnau" msgstr "Pesnau" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:367 #, kde-format msgctxt "Coptic weekday 2 - KLocale::LongName" msgid "Pshoment" msgstr "Pshoment" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:369 #, kde-format msgctxt "Coptic weekday 3 - KLocale::LongName" msgid "Peftoou" msgstr "Peftoou" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:371 #, kde-format msgctxt "Coptic weekday 4 - KLocale::LongName" msgid "Ptiou" msgstr "Ptiou" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:373 #, kde-format msgctxt "Coptic weekday 5 - KLocale::LongName" msgid "Psoou" msgstr "Psoou" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:375 #, kde-format msgctxt "Coptic weekday 6 - KLocale::LongName" msgid "Psabbaton" msgstr "Psabbaton" #. +> trunk5 #: kdecore/kcalendarsystemcoptic.cpp:377 #, kde-format msgctxt "Coptic weekday 7 - KLocale::LongName" msgid "Tkyriakē" msgstr "Tkyriakē" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:50 #, kde-format msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, LongFormat" msgid "Amata Mehrat" msgstr "Amata Mehrat" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:51 #, kde-format msgctxt "Calendar Era: Ethiopian Incarnation Era, years > 0, ShortFormat" msgid "AM" msgstr "AM" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:52 #, kde-format -msgctxt "(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" +msgctxt "" +"(kdedt-format) Ethiopian, AM, full era year format used for %EY, e.g. 2000 AM" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:66 #, kde-format msgctxt "Ethiopian month 1 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:68 #, kde-format msgctxt "Ethiopian month 2 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:70 #, kde-format msgctxt "Ethiopian month 3 - KLocale::NarrowName" msgid "H" msgstr "H" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:72 #, kde-format msgctxt "Ethiopian month 4 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:74 #, kde-format msgctxt "Ethiopian month 5 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:76 #, kde-format msgctxt "Ethiopian month 6 - KLocale::NarrowName" msgid "Y" msgstr "Y" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:78 #, kde-format msgctxt "Ethiopian month 7 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:80 #, kde-format msgctxt "Ethiopian month 8 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:82 #, kde-format msgctxt "Ethiopian month 9 - KLocale::NarrowName" msgid "G" msgstr "G" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:84 #, kde-format msgctxt "Ethiopian month 10 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:86 #, kde-format msgctxt "Ethiopian month 11 - KLocale::NarrowName" msgid "H" msgstr "H" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:88 #, kde-format msgctxt "Ethiopian month 12 - KLocale::NarrowName" msgid "N" msgstr "N" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:90 #, kde-format msgctxt "Ethiopian month 13 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:99 #, kde-format msgctxt "Ethiopian month 1 - KLocale::ShortName Possessive" msgid "of Mes" msgstr "de Mes" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:101 #, kde-format msgctxt "Ethiopian month 2 - KLocale::ShortName Possessive" msgid "of Teq" msgstr "de Teq" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:103 #, kde-format msgctxt "Ethiopian month 3 - KLocale::ShortName Possessive" msgid "of Hed" msgstr "de Hed" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:105 #, kde-format msgctxt "Ethiopian month 4 - KLocale::ShortName Possessive" msgid "of Tah" msgstr "de Tah" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:107 #, kde-format msgctxt "Ethiopian month 5 - KLocale::ShortName Possessive" msgid "of Ter" msgstr "de Ter" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:109 #, kde-format msgctxt "Ethiopian month 6 - KLocale::ShortName Possessive" msgid "of Yak" msgstr "de Yak" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:111 #, kde-format msgctxt "Ethiopian month 7 - KLocale::ShortName Possessive" msgid "of Mag" msgstr "de Mag" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:113 #, kde-format msgctxt "Ethiopian month 8 - KLocale::ShortName Possessive" msgid "of Miy" msgstr "de Miy" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:115 #, kde-format msgctxt "Ethiopian month 9 - KLocale::ShortName Possessive" msgid "of Gen" msgstr "de Gen" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:117 #, kde-format msgctxt "Ethiopian month 10 - KLocale::ShortName Possessive" msgid "of Sen" msgstr "de Sen" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:119 #, kde-format msgctxt "Ethiopian month 11 - KLocale::ShortName Possessive" msgid "of Ham" msgstr "de Ham" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:121 #, kde-format msgctxt "Ethiopian month 12 - KLocale::ShortName Possessive" msgid "of Neh" msgstr "de Neh" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:123 #, kde-format msgctxt "Ethiopian month 13 - KLocale::ShortName Possessive" msgid "of Pag" msgstr "de Pag" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:132 #, kde-format msgctxt "Ethiopian month 1 - KLocale::ShortName" msgid "Mes" msgstr "Mes" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:134 #, kde-format msgctxt "Ethiopian month 2 - KLocale::ShortName" msgid "Teq" msgstr "Teq" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:136 #, kde-format msgctxt "Ethiopian month 3 - KLocale::ShortName" msgid "Hed" msgstr "Hed" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:138 #, kde-format msgctxt "Ethiopian month 4 - KLocale::ShortName" msgid "Tah" msgstr "Tah" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:140 #, kde-format msgctxt "Ethiopian month 5 - KLocale::ShortName" msgid "Ter" msgstr "Ter" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:142 #, kde-format msgctxt "Ethiopian month 6 - KLocale::ShortName" msgid "Yak" msgstr "Yak" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:144 #, kde-format msgctxt "Ethiopian month 7 - KLocale::ShortName" msgid "Mag" msgstr "Mag" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:146 #, kde-format msgctxt "Ethiopian month 8 - KLocale::ShortName" msgid "Miy" msgstr "Miy" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:148 #, kde-format msgctxt "Ethiopian month 9 - KLocale::ShortName" msgid "Gen" msgstr "Gen" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:150 #, kde-format msgctxt "Ethiopian month 10 - KLocale::ShortName" msgid "Sen" msgstr "Sen" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:152 #, kde-format msgctxt "Ethiopian month 11 - KLocale::ShortName" msgid "Ham" msgstr "Ham" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:154 #, kde-format msgctxt "Ethiopian month 12 - KLocale::ShortName" msgid "Neh" msgstr "Neh" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:156 #, kde-format msgctxt "Ethiopian month 13 - KLocale::ShortName" msgid "Pag" msgstr "Pag" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:165 #, kde-format msgctxt "Ethiopian month 1 - KLocale::LongName Possessive" msgid "of Meskerem" msgstr "de Meskerem" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:167 #, kde-format msgctxt "Ethiopian month 2 - KLocale::LongName Possessive" msgid "of Tequemt" msgstr "de Tequemt" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:169 #, kde-format msgctxt "Ethiopian month 3 - KLocale::LongName Possessive" msgid "of Hedar" msgstr "de Hedar" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:171 #, kde-format msgctxt "Ethiopian month 4 - KLocale::LongName Possessive" msgid "of Tahsas" msgstr "de Tahsas" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:173 #, kde-format msgctxt "Ethiopian month 5 - KLocale::LongName Possessive" msgid "of Ter" msgstr "de Ter" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:175 #, kde-format msgctxt "Ethiopian month 6 - KLocale::LongName Possessive" msgid "of Yakatit" msgstr "de Yakatit" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:177 #, kde-format msgctxt "Ethiopian month 7 - KLocale::LongName Possessive" msgid "of Magabit" msgstr "de Magabit" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:179 #, kde-format msgctxt "Ethiopian month 8 - KLocale::LongName Possessive" msgid "of Miyazya" msgstr "de Miyazya" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:181 #, kde-format msgctxt "Ethiopian month 9 - KLocale::LongName Possessive" msgid "of Genbot" msgstr "de Genbot" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:183 #, kde-format msgctxt "Ethiopian month 10 - KLocale::LongName Possessive" msgid "of Sene" msgstr "de Sene" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:185 #, kde-format msgctxt "Ethiopian month 11 - KLocale::LongName Possessive" msgid "of Hamle" msgstr "de Hamle" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:187 #, kde-format msgctxt "Ethiopian month 12 - KLocale::LongName Possessive" msgid "of Nehase" msgstr "de Nehase" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:189 #, kde-format msgctxt "Ethiopian month 13 - KLocale::LongName Possessive" msgid "of Pagumen" msgstr "de Pagumen" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:198 #, kde-format msgctxt "Ethiopian month 1 - KLocale::LongName" msgid "Meskerem" msgstr "Meskerem" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:200 #, kde-format msgctxt "Ethiopian month 2 - KLocale::LongName" msgid "Tequemt" msgstr "Tequemt" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:202 #, kde-format msgctxt "Ethiopian month 3 - KLocale::LongName" msgid "Hedar" msgstr "Hedar" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:204 #, kde-format msgctxt "Ethiopian month 4 - KLocale::LongName" msgid "Tahsas" msgstr "Tahsas" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:206 #, kde-format msgctxt "Ethiopian month 5 - KLocale::LongName" msgid "Ter" msgstr "Ter" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:208 #, kde-format msgctxt "Ethiopian month 6 - KLocale::LongName" msgid "Yakatit" msgstr "Yakatit" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:210 #, kde-format msgctxt "Ethiopian month 7 - KLocale::LongName" msgid "Magabit" msgstr "Magabit" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:212 #, kde-format msgctxt "Ethiopian month 8 - KLocale::LongName" msgid "Miyazya" msgstr "Miyazya" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:214 #, kde-format msgctxt "Ethiopian month 9 - KLocale::LongName" msgid "Genbot" msgstr "Genbot" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:216 #, kde-format msgctxt "Ethiopian month 10 - KLocale::LongName" msgid "Sene" msgstr "Sene" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:218 #, kde-format msgctxt "Ethiopian month 11 - KLocale::LongName" msgid "Hamle" msgstr "Hamle" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:220 #, kde-format msgctxt "Ethiopian month 12 - KLocale::LongName" msgid "Nehase" msgstr "Nehase" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:222 #, kde-format msgctxt "Ethiopian month 13 - KLocale::LongName" msgid "Pagumen" msgstr "Pagumen" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:236 #, kde-format msgctxt "Ethiopian weekday 1 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:238 #, kde-format msgctxt "Ethiopian weekday 2 - KLocale::NarrowName " msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:240 #, kde-format msgctxt "Ethiopian weekday 3 - KLocale::NarrowName " msgid "R" msgstr "R" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:242 #, kde-format msgctxt "Ethiopian weekday 4 - KLocale::NarrowName " msgid "H" msgstr "H" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:244 #, kde-format msgctxt "Ethiopian weekday 5 - KLocale::NarrowName " msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:246 #, kde-format msgctxt "Ethiopian weekday 6 - KLocale::NarrowName " msgid "Q" msgstr "Q" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:248 #, kde-format msgctxt "Ethiopian weekday 7 - KLocale::NarrowName " msgid "E" msgstr "E" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:257 #, kde-format msgctxt "Ethiopian weekday 1 - KLocale::ShortName" msgid "Seg" msgstr "Seg" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:259 #, kde-format msgctxt "Ethiopian weekday 2 - KLocale::ShortName" msgid "Mak" msgstr "Mak" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:261 #, kde-format msgctxt "Ethiopian weekday 3 - KLocale::ShortName" msgid "Rob" msgstr "Rob" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:263 #, kde-format msgctxt "Ethiopian weekday 4 - KLocale::ShortName" msgid "Ham" msgstr "Ham" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:265 #, kde-format msgctxt "Ethiopian weekday 5 - KLocale::ShortName" msgid "Arb" msgstr "Arb" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:267 #, kde-format msgctxt "Ethiopian weekday 6 - KLocale::ShortName" msgid "Qed" msgstr "Qed" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:269 #, kde-format msgctxt "Ethiopian weekday 7 - KLocale::ShortName" msgid "Ehu" msgstr "Ehu" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:276 #, kde-format msgctxt "Ethiopian weekday 1 - KLocale::LongName" msgid "Segno" msgstr "Segno" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:278 #, kde-format msgctxt "Ethiopian weekday 2 - KLocale::LongName" msgid "Maksegno" msgstr "Maksegno" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:280 #, kde-format msgctxt "Ethiopian weekday 3 - KLocale::LongName" msgid "Rob" msgstr "Rob" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:282 #, kde-format msgctxt "Ethiopian weekday 4 - KLocale::LongName" msgid "Hamus" msgstr "Hamus" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:284 #, kde-format msgctxt "Ethiopian weekday 5 - KLocale::LongName" msgid "Arb" msgstr "Arb" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:286 #, kde-format msgctxt "Ethiopian weekday 6 - KLocale::LongName" msgid "Qedame" msgstr "Qedame" #. +> trunk5 #: kdecore/kcalendarsystemethiopian.cpp:288 #, kde-format msgctxt "Ethiopian weekday 7 - KLocale::LongName" msgid "Ehud" msgstr "Ehud" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:53 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years < 0, LongFormat" msgid "Before Common Era" msgstr "Antes da Era Común" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:54 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years < 0, ShortFormat" msgid "BCE" msgstr "AEC" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:56 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years < 0, LongFormat" msgid "Before Christ" msgstr "Antes de Cristo" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:57 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years < 0, ShortFormat" msgid "BC" msgstr "AC" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:59 #, kde-format -msgctxt "(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" +msgctxt "" +"(kdedt-format) Gregorian, BC, full era year format used for %EY, e.g. 2000 BC" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:63 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years > 0, LongFormat" msgid "Common Era" msgstr "Era Común" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:64 #, kde-format msgctxt "Calendar Era: Gregorian Common Era, years > 0, ShortFormat" msgid "CE" msgstr "EC" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:66 #: kdecore/kcalendarsystemjapanese.cpp:57 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years > 0, LongFormat" msgid "Anno Domini" msgstr "Anno Domini" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:67 #: kdecore/kcalendarsystemjapanese.cpp:58 #, kde-format msgctxt "Calendar Era: Gregorian Christian Era, years > 0, ShortFormat" msgid "AD" msgstr "AD" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:69 #: kdecore/kcalendarsystemjapanese.cpp:59 #, kde-format -msgctxt "(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" +msgctxt "" +"(kdedt-format) Gregorian, AD, full era year format used for %EY, e.g. 2000 AD" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:138 #, kde-format msgctxt "Gregorian month 1 - KLocale::NarrowName" msgid "J" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:140 #, kde-format msgctxt "Gregorian month 2 - KLocale::NarrowName" msgid "F" msgstr "F" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:142 #, kde-format msgctxt "Gregorian month 3 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:144 #, kde-format msgctxt "Gregorian month 4 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:146 #, kde-format msgctxt "Gregorian month 5 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:148 #, kde-format msgctxt "Gregorian month 6 - KLocale::NarrowName" msgid "J" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:150 #, kde-format msgctxt "Gregorian month 7 - KLocale::NarrowName" msgid "J" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:152 #, kde-format msgctxt "Gregorian month 8 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:154 #, kde-format msgctxt "Gregorian month 9 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:156 #, kde-format msgctxt "Gregorian month 10 - KLocale::NarrowName" msgid "O" msgstr "O" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:158 #, kde-format msgctxt "Gregorian month 11 - KLocale::NarrowName" msgid "N" msgstr "N" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:160 #, kde-format msgctxt "Gregorian month 12 - KLocale::NarrowName" msgid "D" msgstr "D" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:169 #, kde-format msgctxt "Gregorian month 1 - KLocale::ShortName Possessive" msgid "of Jan" msgstr "de xan" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:171 #, kde-format msgctxt "Gregorian month 2 - KLocale::ShortName Possessive" msgid "of Feb" msgstr "de feb" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:173 #, kde-format msgctxt "Gregorian month 3 - KLocale::ShortName Possessive" msgid "of Mar" msgstr "de mar" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:175 #, kde-format msgctxt "Gregorian month 4 - KLocale::ShortName Possessive" msgid "of Apr" msgstr "de abr" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:177 #, kde-format msgctxt "Gregorian month 5 - KLocale::ShortName Possessive" msgid "of May" msgstr "de mai" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:179 #, kde-format msgctxt "Gregorian month 6 - KLocale::ShortName Possessive" msgid "of Jun" msgstr "de xuñ" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:181 #, kde-format msgctxt "Gregorian month 7 - KLocale::ShortName Possessive" msgid "of Jul" msgstr "de xul" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:183 #, kde-format msgctxt "Gregorian month 8 - KLocale::ShortName Possessive" msgid "of Aug" msgstr "de ago" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:185 #, kde-format msgctxt "Gregorian month 9 - KLocale::ShortName Possessive" msgid "of Sep" msgstr "de set" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:187 #, kde-format msgctxt "Gregorian month 10 - KLocale::ShortName Possessive" msgid "of Oct" msgstr "de out" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:189 #, kde-format msgctxt "Gregorian month 11 - KLocale::ShortName Possessive" msgid "of Nov" msgstr "de nov" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:191 #, kde-format msgctxt "Gregorian month 12 - KLocale::ShortName Possessive" msgid "of Dec" msgstr "de dec" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:200 #, kde-format msgctxt "Gregorian month 1 - KLocale::ShortName" msgid "Jan" msgstr "xan" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:202 #, kde-format msgctxt "Gregorian month 2 - KLocale::ShortName" msgid "Feb" msgstr "feb" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:204 #, kde-format msgctxt "Gregorian month 3 - KLocale::ShortName" msgid "Mar" msgstr "mar" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:206 #, kde-format msgctxt "Gregorian month 4 - KLocale::ShortName" msgid "Apr" msgstr "abr" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:208 #, kde-format msgctxt "Gregorian month 5 - KLocale::ShortName" msgid "May" msgstr "mai" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:210 #, kde-format msgctxt "Gregorian month 6 - KLocale::ShortName" msgid "Jun" msgstr "xun" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:212 #, kde-format msgctxt "Gregorian month 7 - KLocale::ShortName" msgid "Jul" msgstr "xul" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:214 #, kde-format msgctxt "Gregorian month 8 - KLocale::ShortName" msgid "Aug" msgstr "ago" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:216 #, kde-format msgctxt "Gregorian month 9 - KLocale::ShortName" msgid "Sep" msgstr "set" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:218 #, kde-format msgctxt "Gregorian month 10 - KLocale::ShortName" msgid "Oct" msgstr "out" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:220 #, kde-format msgctxt "Gregorian month 11 - KLocale::ShortName" msgid "Nov" msgstr "nov" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:222 #, kde-format msgctxt "Gregorian month 12 - KLocale::ShortName" msgid "Dec" msgstr "dec" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:231 #, kde-format msgctxt "Gregorian month 1 - KLocale::LongName Possessive" msgid "of January" msgstr "de xaneiro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:233 #, kde-format msgctxt "Gregorian month 2 - KLocale::LongName Possessive" msgid "of February" msgstr "de febreiro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:235 #, kde-format msgctxt "Gregorian month 3 - KLocale::LongName Possessive" msgid "of March" msgstr "de marzo" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:237 #, kde-format msgctxt "Gregorian month 4 - KLocale::LongName Possessive" msgid "of April" msgstr "de abril" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:239 #, kde-format msgctxt "Gregorian month 5 - KLocale::LongName Possessive" msgid "of May" msgstr "de maio" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:241 #, kde-format msgctxt "Gregorian month 6 - KLocale::LongName Possessive" msgid "of June" msgstr "de xuño" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:243 #, kde-format msgctxt "Gregorian month 7 - KLocale::LongName Possessive" msgid "of July" msgstr "de xullo" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:245 #, kde-format msgctxt "Gregorian month 8 - KLocale::LongName Possessive" msgid "of August" msgstr "de agosto" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:247 #, kde-format msgctxt "Gregorian month 9 - KLocale::LongName Possessive" msgid "of September" msgstr "de setembro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:249 #, kde-format msgctxt "Gregorian month 10 - KLocale::LongName Possessive" msgid "of October" msgstr "de outubro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:251 #, kde-format msgctxt "Gregorian month 11 - KLocale::LongName Possessive" msgid "of November" msgstr "de novembro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:253 #, kde-format msgctxt "Gregorian month 12 - KLocale::LongName Possessive" msgid "of December" msgstr "de decembro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:262 #, kde-format msgctxt "Gregorian month 1 - KLocale::LongName" msgid "January" msgstr "Xaneiro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:264 #, kde-format msgctxt "Gregorian month 2 - KLocale::LongName" msgid "February" msgstr "Febreiro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:266 #, kde-format msgctxt "Gregorian month 3 - KLocale::LongName" msgid "March" msgstr "Marzo" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:268 #, kde-format msgctxt "Gregorian month 4 - KLocale::LongName" msgid "April" msgstr "Abril" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:270 #, kde-format msgctxt "Gregorian month 5 - KLocale::LongName" msgid "May" msgstr "Maio" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:272 #, kde-format msgctxt "Gregorian month 6 - KLocale::LongName" msgid "June" msgstr "Xuño" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:274 #, kde-format msgctxt "Gregorian month 7 - KLocale::LongName" msgid "July" msgstr "Xullo" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:276 #, kde-format msgctxt "Gregorian month 8 - KLocale::LongName" msgid "August" msgstr "Agosto" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:278 #, kde-format msgctxt "Gregorian month 9 - KLocale::LongName" msgid "September" msgstr "Setembro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:280 #, kde-format msgctxt "Gregorian month 10 - KLocale::LongName" msgid "October" msgstr "Outubro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:282 #, kde-format msgctxt "Gregorian month 11 - KLocale::LongName" msgid "November" msgstr "Novembro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:284 #, kde-format msgctxt "Gregorian month 12 - KLocale::LongName" msgid "December" msgstr "Decembro" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:297 #: kdecore/kcalendarsystemhebrew.cpp:807 #, kde-format msgctxt "Gregorian weekday 1 - KLocale::NarrowName " msgid "M" msgstr "L" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:299 #: kdecore/kcalendarsystemhebrew.cpp:809 #, kde-format msgctxt "Gregorian weekday 2 - KLocale::NarrowName " msgid "T" msgstr "Ma" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:301 #: kdecore/kcalendarsystemhebrew.cpp:811 #, kde-format msgctxt "Gregorian weekday 3 - KLocale::NarrowName " msgid "W" msgstr "Me" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:303 #: kdecore/kcalendarsystemhebrew.cpp:813 #, kde-format msgctxt "Gregorian weekday 4 - KLocale::NarrowName " msgid "T" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:305 #: kdecore/kcalendarsystemhebrew.cpp:815 #, kde-format msgctxt "Gregorian weekday 5 - KLocale::NarrowName " msgid "F" msgstr "V" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:307 #: kdecore/kcalendarsystemhebrew.cpp:817 #, kde-format msgctxt "Gregorian weekday 6 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:309 #: kdecore/kcalendarsystemhebrew.cpp:819 #, kde-format msgctxt "Gregorian weekday 7 - KLocale::NarrowName " msgid "S" msgstr "D" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:318 #: kdecore/kcalendarsystemhebrew.cpp:828 #, kde-format msgctxt "Gregorian weekday 1 - KLocale::ShortName" msgid "Mon" msgstr "Lun" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:320 #: kdecore/kcalendarsystemhebrew.cpp:830 #, kde-format msgctxt "Gregorian weekday 2 - KLocale::ShortName" msgid "Tue" msgstr "Mar" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:322 #: kdecore/kcalendarsystemhebrew.cpp:832 #, kde-format msgctxt "Gregorian weekday 3 - KLocale::ShortName" msgid "Wed" msgstr "Mér" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:324 #: kdecore/kcalendarsystemhebrew.cpp:834 #, kde-format msgctxt "Gregorian weekday 4 - KLocale::ShortName" msgid "Thu" msgstr "Xov" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:326 #: kdecore/kcalendarsystemhebrew.cpp:836 #, kde-format msgctxt "Gregorian weekday 5 - KLocale::ShortName" msgid "Fri" msgstr "Ven" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:328 #: kdecore/kcalendarsystemhebrew.cpp:838 #, kde-format msgctxt "Gregorian weekday 6 - KLocale::ShortName" msgid "Sat" msgstr "Sáb" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:330 #: kdecore/kcalendarsystemhebrew.cpp:840 #, kde-format msgctxt "Gregorian weekday 7 - KLocale::ShortName" msgid "Sun" msgstr "Dom" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:337 #: kdecore/kcalendarsystemhebrew.cpp:847 #, kde-format msgctxt "Gregorian weekday 1 - KLocale::LongName" msgid "Monday" msgstr "Luns" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:339 #: kdecore/kcalendarsystemhebrew.cpp:849 #, kde-format msgctxt "Gregorian weekday 2 - KLocale::LongName" msgid "Tuesday" msgstr "Martes" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:341 #: kdecore/kcalendarsystemhebrew.cpp:851 #, kde-format msgctxt "Gregorian weekday 3 - KLocale::LongName" msgid "Wednesday" msgstr "Mércores" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:343 #: kdecore/kcalendarsystemhebrew.cpp:853 #, kde-format msgctxt "Gregorian weekday 4 - KLocale::LongName" msgid "Thursday" msgstr "Xoves" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:345 #: kdecore/kcalendarsystemhebrew.cpp:855 #, kde-format msgctxt "Gregorian weekday 5 - KLocale::LongName" msgid "Friday" msgstr "Venres" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:347 #: kdecore/kcalendarsystemhebrew.cpp:857 #, kde-format msgctxt "Gregorian weekday 6 - KLocale::LongName" msgid "Saturday" msgstr "Sábado" #. +> trunk5 #: kdecore/kcalendarsystemgregorian.cpp:349 #: kdecore/kcalendarsystemhebrew.cpp:859 #, kde-format msgctxt "Gregorian weekday 7 - KLocale::LongName" msgid "Sunday" msgstr "Domingo" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:281 #, kde-format msgctxt "Calendar Era: Hebrew Era, years > 0, LongFormat" msgid "Anno Mundi" msgstr "Anno Mundi" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:282 #, kde-format msgctxt "Calendar Era: Hebrew Era, years > 0, ShortFormat" msgid "AM" msgstr "AM" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:283 #, kde-format -msgctxt "(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" +msgctxt "" +"(kdedt-format) Hebrew, AM, full era year format used for %EY, e.g. 2000 AM" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:625 #, kde-format msgctxt "Hebrew month 1 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:627 #, kde-format msgctxt "Hebrew month 2 - KLocale::NarrowName" msgid "H" msgstr "H" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:629 #, kde-format msgctxt "Hebrew month 3 - KLocale::NarrowName" msgid "K" msgstr "K" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:631 #, kde-format msgctxt "Hebrew month 4 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:633 #, kde-format msgctxt "Hebrew month 5 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:635 #, kde-format msgctxt "Hebrew month 6 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:637 #, kde-format msgctxt "Hebrew month 7 - KLocale::NarrowName" msgid "N" msgstr "N" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:639 #, kde-format msgctxt "Hebrew month 8 - KLocale::NarrowName" msgid "I" msgstr "I" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:641 #, kde-format msgctxt "Hebrew month 9 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:643 #, kde-format msgctxt "Hebrew month 10 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:645 #, kde-format msgctxt "Hebrew month 11 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:647 #, kde-format msgctxt "Hebrew month 12 - KLocale::NarrowName" msgid "E" msgstr "E" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:649 #, kde-format msgctxt "Hebrew month 13 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:651 #, kde-format msgctxt "Hebrew month 14 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:660 #, kde-format msgctxt "Hebrew month 1 - KLocale::ShortName Possessive" msgid "of Tis" msgstr "de Tis" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:662 #, kde-format msgctxt "Hebrew month 2 - KLocale::ShortName Possessive" msgid "of Hes" msgstr "de Hes" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:664 #, kde-format msgctxt "Hebrew month 3 - KLocale::ShortName Possessive" msgid "of Kis" msgstr "de Kis" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:666 #, kde-format msgctxt "Hebrew month 4 - KLocale::ShortName Possessive" msgid "of Tev" msgstr "de Tev" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:668 #, kde-format msgctxt "Hebrew month 5 - KLocale::ShortName Possessive" msgid "of Shv" msgstr "de Shv" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:670 #, kde-format msgctxt "Hebrew month 6 - KLocale::ShortName Possessive" msgid "of Ada" msgstr "de Ada" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:672 #, kde-format msgctxt "Hebrew month 7 - KLocale::ShortName Possessive" msgid "of Nis" msgstr "de Nis" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:674 #, kde-format msgctxt "Hebrew month 8 - KLocale::ShortName Possessive" msgid "of Iya" msgstr "de Iya" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:676 #, kde-format msgctxt "Hebrew month 9 - KLocale::ShortName Possessive" msgid "of Siv" msgstr "de Siv" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:678 #, kde-format msgctxt "Hebrew month 10 - KLocale::ShortName Possessive" msgid "of Tam" msgstr "de Tam" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:680 #, kde-format msgctxt "Hebrew month 11 - KLocale::ShortName Possessive" msgid "of Av" msgstr "de Av" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:682 #, kde-format msgctxt "Hebrew month 12 - KLocale::ShortName Possessive" msgid "of Elu" msgstr "de Elu" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:684 #, kde-format msgctxt "Hebrew month 13 - KLocale::ShortName Possessive" msgid "of Ad1" msgstr "de Ad1" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:686 #, kde-format msgctxt "Hebrew month 14 - KLocale::ShortName Possessive" msgid "of Ad2" msgstr "de Ad2" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:695 #, kde-format msgctxt "Hebrew month 1 - KLocale::ShortName" msgid "Tis" msgstr "Tis" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:697 #, kde-format msgctxt "Hebrew month 2 - KLocale::ShortName" msgid "Hes" msgstr "Hes" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:699 #, kde-format msgctxt "Hebrew month 3 - KLocale::ShortName" msgid "Kis" msgstr "Kis" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:701 #, kde-format msgctxt "Hebrew month 4 - KLocale::ShortName" msgid "Tev" msgstr "Tev" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:703 #, kde-format msgctxt "Hebrew month 5 - KLocale::ShortName" msgid "Shv" msgstr "Shv" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:705 #, kde-format msgctxt "Hebrew month 6 - KLocale::ShortName" msgid "Ada" msgstr "Ada" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:707 #, kde-format msgctxt "Hebrew month 7 - KLocale::ShortName" msgid "Nis" msgstr "Nis" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:709 #, kde-format msgctxt "Hebrew month 8 - KLocale::ShortName" msgid "Iya" msgstr "Iya" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:711 #, kde-format msgctxt "Hebrew month 9 - KLocale::ShortName" msgid "Siv" msgstr "Siv" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:713 #, kde-format msgctxt "Hebrew month 10 - KLocale::ShortName" msgid "Tam" msgstr "Tam" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:715 #, kde-format msgctxt "Hebrew month 11 - KLocale::ShortName" msgid "Av" msgstr "Av" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:717 #, kde-format msgctxt "Hebrew month 12 - KLocale::ShortName" msgid "Elu" msgstr "Elu" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:719 #, kde-format msgctxt "Hebrew month 13 - KLocale::ShortName" msgid "Ad1" msgstr "Ad1" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:721 #, kde-format msgctxt "Hebrew month 14 - KLocale::ShortName" msgid "Ad2" msgstr "Ad2" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:730 #, kde-format msgctxt "Hebrew month 1 - KLocale::LongName Possessive" msgid "of Tishrey" msgstr "de Tishrey" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:732 #, kde-format msgctxt "Hebrew month 2 - KLocale::LongName Possessive" msgid "of Heshvan" msgstr "de Heshvan" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:734 #, kde-format msgctxt "Hebrew month 3 - KLocale::LongName Possessive" msgid "of Kislev" msgstr "de Kislev" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:736 #, kde-format msgctxt "Hebrew month 4 - KLocale::LongName Possessive" msgid "of Tevet" msgstr "de Tevet" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:738 #, kde-format msgctxt "Hebrew month 5 - KLocale::LongName Possessive" msgid "of Shvat" msgstr "de Shvat" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:740 #, kde-format msgctxt "Hebrew month 6 - KLocale::LongName Possessive" msgid "of Adar" msgstr "de Adar" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:742 #, kde-format msgctxt "Hebrew month 7 - KLocale::LongName Possessive" msgid "of Nisan" msgstr "de Nisan" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:744 #, kde-format msgctxt "Hebrew month 8 - KLocale::LongName Possessive" msgid "of Iyar" msgstr "de Iyar" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:746 #, kde-format msgctxt "Hebrew month 9 - KLocale::LongName Possessive" msgid "of Sivan" msgstr "de Sivan" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:748 #, kde-format msgctxt "Hebrew month 10 - KLocale::LongName Possessive" msgid "of Tamuz" msgstr "de Tamuz" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:750 #, kde-format msgctxt "Hebrew month 11 - KLocale::LongName Possessive" msgid "of Av" msgstr "de Av" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:752 #, kde-format msgctxt "Hebrew month 12 - KLocale::LongName Possessive" msgid "of Elul" msgstr "de Elul" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:754 #, kde-format msgctxt "Hebrew month 13 - KLocale::LongName Possessive" msgid "of Adar I" msgstr "de Adar I" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:756 #, kde-format msgctxt "Hebrew month 14 - KLocale::LongName Possessive" msgid "of Adar II" msgstr "de Adar II" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:765 #, kde-format msgctxt "Hebrew month 1 - KLocale::LongName" msgid "Tishrey" msgstr "Tishrey" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:767 #, kde-format msgctxt "Hebrew month 2 - KLocale::LongName" msgid "Heshvan" msgstr "Heshvan" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:769 #, kde-format msgctxt "Hebrew month 3 - KLocale::LongName" msgid "Kislev" msgstr "Kislev" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:771 #, kde-format msgctxt "Hebrew month 4 - KLocale::LongName" msgid "Tevet" msgstr "Tevet" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:773 #, kde-format msgctxt "Hebrew month 5 - KLocale::LongName" msgid "Shvat" msgstr "Shvat" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:775 #, kde-format msgctxt "Hebrew month 6 - KLocale::LongName" msgid "Adar" msgstr "Adar" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:777 #, kde-format msgctxt "Hebrew month 7 - KLocale::LongName" msgid "Nisan" msgstr "Nisan" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:779 #, kde-format msgctxt "Hebrew month 8 - KLocale::LongName" msgid "Iyar" msgstr "Iyar" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:781 #, kde-format msgctxt "Hebrew month 9 - KLocale::LongName" msgid "Sivan" msgstr "Sivan" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:783 #, kde-format msgctxt "Hebrew month 10 - KLocale::LongName" msgid "Tamuz" msgstr "Tamuz" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:785 #, kde-format msgctxt "Hebrew month 11 - KLocale::LongName" msgid "Av" msgstr "Av" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:787 #, kde-format msgctxt "Hebrew month 12 - KLocale::LongName" msgid "Elul" msgstr "Elul" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:789 #, kde-format msgctxt "Hebrew month 13 - KLocale::LongName" msgid "Adar I" msgstr "Adar I" #. +> trunk5 #: kdecore/kcalendarsystemhebrew.cpp:791 #, kde-format msgctxt "Hebrew month 14 - KLocale::LongName" msgid "Adar II" msgstr "Adar II" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:66 #, kde-format msgctxt "Calendar Era: Indian National Saka Era, years > 0, LongFormat" msgid "Saka Era" msgstr "Era Saka" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:67 #, kde-format msgctxt "Calendar Era: Indian National Saka Era, years > 0, ShortFormat" msgid "SE" msgstr "ES" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:68 #, kde-format -msgctxt "(kdedt-format) Indian National, SE, full era year format used for %EY, e.g. 2000 SE" +msgctxt "" +"(kdedt-format) Indian National, SE, full era year format used for %EY, e.g." +" 2000 SE" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:158 #, kde-format msgctxt "Indian National month 1 - KLocale::NarrowName" msgid "C" msgstr "C" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:160 #, kde-format msgctxt "Indian National month 2 - KLocale::NarrowName" msgid "V" msgstr "V" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:162 #, kde-format msgctxt "Indian National month 3 - KLocale::NarrowName" msgid "J" msgstr "J" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:164 #, kde-format msgctxt "Indian National month 4 - KLocale::NarrowName" msgid "Ā" msgstr "Ā" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:166 #, kde-format msgctxt "Indian National month 5 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:168 #, kde-format msgctxt "Indian National month 6 - KLocale::NarrowName" msgid "B" msgstr "B" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:170 #, kde-format msgctxt "Indian National month 7 - KLocale::NarrowName" msgid "Ā" msgstr "Ā" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:172 #, kde-format msgctxt "Indian National month 8 - KLocale::NarrowName" msgid "K" msgstr "K" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:174 #, kde-format msgctxt "Indian National month 9 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:176 #, kde-format msgctxt "Indian National month 10 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:178 #, kde-format msgctxt "Indian National month 11 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:180 #, kde-format msgctxt "Indian National month 12 - KLocale::NarrowName" msgid "P" msgstr "P" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:189 #, kde-format msgctxt "Indian National month 1 - KLocale::ShortName Possessive" msgid "of Cha" msgstr "de Cha" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:191 #, kde-format msgctxt "Indian National month 2 - KLocale::ShortName Possessive" msgid "of Vai" msgstr "de Vai" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:193 #, kde-format msgctxt "Indian National month 3 - KLocale::ShortName Possessive" msgid "of Jya" msgstr "de Jya" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:195 #, kde-format msgctxt "Indian National month 4 - KLocale::ShortName Possessive" msgid "of Āsh" msgstr "de Āsh" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:197 #, kde-format msgctxt "Indian National month 5 - KLocale::ShortName Possessive" msgid "of Shr" msgstr "de Shr" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:199 #, kde-format msgctxt "Indian National month 6 - KLocale::ShortName Possessive" msgid "of Bhā" msgstr "de Bhā" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:201 #, kde-format msgctxt "Indian National month 7 - KLocale::ShortName Possessive" msgid "of Āsw" msgstr "de Āsw" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:203 #, kde-format msgctxt "Indian National month 8 - KLocale::ShortName Possessive" msgid "of Kār" msgstr "de Kār" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:205 #, kde-format msgctxt "Indian National month 9 - KLocale::ShortName Possessive" msgid "of Agr" msgstr "de Agr" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:207 #, kde-format msgctxt "Indian National month 10 - KLocale::ShortName Possessive" msgid "of Pau" msgstr "de Pau" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:209 #, kde-format msgctxt "Indian National month 11 - KLocale::ShortName Possessive" msgid "of Māg" msgstr "de Māg" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:211 #, kde-format msgctxt "Indian National month 12 - KLocale::ShortName Possessive" msgid "of Phā" msgstr "de Phā" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:220 #, kde-format msgctxt "Indian National month 1 - KLocale::ShortName" msgid "Cha" msgstr "Cha" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:222 #, kde-format msgctxt "Indian National month 2 - KLocale::ShortName" msgid "Vai" msgstr "Vai" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:224 #, kde-format msgctxt "Indian National month 3 - KLocale::ShortName" msgid "Jya" msgstr "Jya" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:226 #, kde-format msgctxt "Indian National month 4 - KLocale::ShortName" msgid "Āsh" msgstr "Āsh" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:228 #, kde-format msgctxt "Indian National month 5 - KLocale::ShortName" msgid "Shr" msgstr "Shr" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:230 #, kde-format msgctxt "Indian National month 6 - KLocale::ShortName" msgid "Bhā" msgstr "Bhā" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:232 #, kde-format msgctxt "Indian National month 7 - KLocale::ShortName" msgid "Āsw" msgstr "Āsw" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:234 #, kde-format msgctxt "Indian National month 8 - KLocale::ShortName" msgid "Kār" msgstr "Kār" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:236 #, kde-format msgctxt "Indian National month 9 - KLocale::ShortName" msgid "Agr" msgstr "Agr" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:238 #, kde-format msgctxt "Indian National month 10 - KLocale::ShortName" msgid "Pau" msgstr "Pau" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:240 #, kde-format msgctxt "Indian National month 11 - KLocale::ShortName" msgid "Māg" msgstr "Māg" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:242 #, kde-format msgctxt "Indian National month 12 - KLocale::ShortName" msgid "Phā" msgstr "Phā" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:251 #, kde-format msgctxt "Indian National month 1 - KLocale::LongName Possessive" msgid "of Chaitra" msgstr "de Chaitra" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:253 #, kde-format msgctxt "Indian National month 2 - KLocale::LongName Possessive" msgid "of Vaishākh" msgstr "de Vaishākh" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:255 #, kde-format msgctxt "Indian National month 3 - KLocale::LongName Possessive" msgid "of Jyaishtha" msgstr "de Jyaishtha" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:257 #, kde-format msgctxt "Indian National month 4 - KLocale::LongName Possessive" msgid "of Āshādha" msgstr "de Āshādha" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:259 #, kde-format msgctxt "Indian National month 5 - KLocale::LongName Possessive" msgid "of Shrāvana" msgstr "de Shrāvana" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:261 #, kde-format msgctxt "Indian National month 6 - KLocale::LongName Possessive" msgid "of Bhādrapad" msgstr "de Bhādrapad" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:263 #, kde-format msgctxt "Indian National month 7 - KLocale::LongName Possessive" msgid "of Āshwin" msgstr "de Āshwin" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:265 #, kde-format msgctxt "Indian National month 8 - KLocale::LongName Possessive" msgid "of Kārtik" msgstr "de Kārtik" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:267 #, kde-format msgctxt "Indian National month 9 - KLocale::LongName Possessive" msgid "of Agrahayana" msgstr "de Agrahayana" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:269 #, kde-format msgctxt "Indian National month 10 - KLocale::LongName Possessive" msgid "of Paush" msgstr "de Paush" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:271 #, kde-format msgctxt "Indian National month 11 - KLocale::LongName Possessive" msgid "of Māgh" msgstr "de Māgh" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:273 #, kde-format msgctxt "Indian National month 12 - KLocale::LongName Possessive" msgid "of Phālgun" msgstr "de Phālgun" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:282 #, kde-format msgctxt "Indian National month 1 - KLocale::LongName" msgid "Chaitra" msgstr "Chaitra" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:284 #, kde-format msgctxt "Indian National month 2 - KLocale::LongName" msgid "Vaishākh" msgstr "Vaishākh" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:286 #, kde-format msgctxt "Indian National month 3 - KLocale::LongName" msgid "Jyaishtha" msgstr "Jyaishtha" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:288 #, kde-format msgctxt "Indian National month 4 - KLocale::LongName" msgid "Āshādha" msgstr "Āshādha" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:290 #, kde-format msgctxt "Indian National month 5 - KLocale::LongName" msgid "Shrāvana" msgstr "Shrāvana" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:292 #, kde-format msgctxt "Indian National month 6 - KLocale::LongName" msgid "Bhādrapad" msgstr "Bhādrapad" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:294 #, kde-format msgctxt "Indian National month 7 - KLocale::LongName" msgid "Āshwin" msgstr "Āshwin" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:296 #, kde-format msgctxt "Indian National month 8 - KLocale::LongName" msgid "Kārtik" msgstr "Kārtik" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:298 #, kde-format msgctxt "Indian National month 9 - KLocale::LongName" msgid "Agrahayana" msgstr "Agrahayana" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:300 #, kde-format msgctxt "Indian National month 10 - KLocale::LongName" msgid "Paush" msgstr "Paush" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:302 #, kde-format msgctxt "Indian National month 11 - KLocale::LongName" msgid "Māgh" msgstr "Māgh" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:304 #, kde-format msgctxt "Indian National month 12 - KLocale::LongName" msgid "Phālgun" msgstr "Phālgun" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:317 #, kde-format msgctxt "Indian National weekday 1 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:319 #, kde-format msgctxt "Indian National weekday 2 - KLocale::NarrowName " msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:321 #, kde-format msgctxt "Indian National weekday 3 - KLocale::NarrowName " msgid "B" msgstr "B" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:323 #, kde-format msgctxt "Indian National weekday 4 - KLocale::NarrowName " msgid "G" msgstr "G" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:325 #, kde-format msgctxt "Indian National weekday 5 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:327 #, kde-format msgctxt "Indian National weekday 6 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:329 #, kde-format msgctxt "Indian National weekday 7 - KLocale::NarrowName " msgid "R" msgstr "R" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:338 #, kde-format msgctxt "Indian National weekday 1 - KLocale::ShortName" msgid "Som" msgstr "Som" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:340 #, kde-format msgctxt "Indian National weekday 2 - KLocale::ShortName" msgid "Mañ" msgstr "Mañ" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:342 #, kde-format msgctxt "Indian National weekday 3 - KLocale::ShortName" msgid "Bud" msgstr "Bud" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:344 #, kde-format msgctxt "Indian National weekday 4 - KLocale::ShortName" msgid "Gur" msgstr "Gur" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:346 #, kde-format msgctxt "Indian National weekday 5 - KLocale::ShortName" msgid "Suk" msgstr "Suk" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:348 #, kde-format msgctxt "Indian National weekday 6 - KLocale::ShortName" msgid "San" msgstr "San" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:350 #, kde-format msgctxt "Indian National weekday 7 - KLocale::ShortName" msgid "Rav" msgstr "Rav" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:357 #, kde-format msgctxt "Indian National weekday 1 - KLocale::LongName" msgid "Somavãra" msgstr "Somavãra" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:359 #, kde-format msgctxt "Indian National weekday 2 - KLocale::LongName" msgid "Mañgalvã" msgstr "Mañgalvã" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:361 #, kde-format msgctxt "Indian National weekday 3 - KLocale::LongName" msgid "Budhavãra" msgstr "Budhavãra" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:363 #, kde-format msgctxt "Indian National weekday 4 - KLocale::LongName" msgid "Guruvãra" msgstr "Guruvãra" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:365 #, kde-format msgctxt "Indian National weekday 5 - KLocale::LongName" msgid "Sukravãra" msgstr "Sukravãra" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:367 #, kde-format msgctxt "Indian National weekday 6 - KLocale::LongName" msgid "Sanivãra" msgstr "Sanivãra" #. +> trunk5 #: kdecore/kcalendarsystemindiannational.cpp:369 #, kde-format msgctxt "Indian National weekday 7 - KLocale::LongName" msgid "Raviãra" msgstr "Raviãra" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:66 #, kde-format msgctxt "Calendar Era: Hijri Islamic Era, years > 0, LongFormat" msgid "Anno Hegirae" msgstr "Ano da Héxira" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:67 #, kde-format msgctxt "Calendar Era: Hijri Islamic Era, years > 0, ShortFormat" msgid "AH" msgstr "AH" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:68 #, kde-format -msgctxt "(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" +msgctxt "" +"(kdedt-format) Hijri, AH, full era year format used for %EY, e.g. 2000 AH" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:166 #, kde-format msgctxt "Hijri month 1 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:168 #, kde-format msgctxt "Hijri month 2 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:170 #, kde-format msgctxt "Hijri month 3 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:172 #, kde-format msgctxt "Hijri month 4 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:174 #, kde-format msgctxt "Hijri month 5 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:176 #, kde-format msgctxt "Hijri month 6 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:178 #, kde-format msgctxt "Hijri month 7 - KLocale::NarrowName" msgid "R" msgstr "R" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:180 #, kde-format msgctxt "Hijri month 8 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:182 #, kde-format msgctxt "Hijri month 9 - KLocale::NarrowName" msgid "R" msgstr "R" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:184 #, kde-format msgctxt "Hijri month 10 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:186 #, kde-format msgctxt "Hijri month 11 - KLocale::NarrowName" msgid "Q" msgstr "Q" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:188 #, kde-format msgctxt "Hijri month 12 - KLocale::NarrowName" msgid "H" msgstr "H" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:197 #, kde-format msgctxt "Hijri month 1 - KLocale::ShortName Possessive" msgid "of Muh" msgstr "de Muh" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:199 #, kde-format msgctxt "Hijri month 2 - KLocale::ShortName Possessive" msgid "of Saf" msgstr "de Saf" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:201 #, kde-format msgctxt "Hijri month 3 - KLocale::ShortName Possessive" msgid "of R.A" msgstr "de R.A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:203 #, kde-format msgctxt "Hijri month 4 - KLocale::ShortName Possessive" msgid "of R.T" msgstr "de R.T" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:205 #, kde-format msgctxt "Hijri month 5 - KLocale::ShortName Possessive" msgid "of J.A" msgstr "de J.A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:207 #, kde-format msgctxt "Hijri month 6 - KLocale::ShortName Possessive" msgid "of J.T" msgstr "de J.T" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:209 #, kde-format msgctxt "Hijri month 7 - KLocale::ShortName Possessive" msgid "of Raj" msgstr "de Raj" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:211 #, kde-format msgctxt "Hijri month 8 - KLocale::ShortName Possessive" msgid "of Sha" msgstr "de Sha" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:213 #, kde-format msgctxt "Hijri month 9 - KLocale::ShortName Possessive" msgid "of Ram" msgstr "de Ram" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:215 #, kde-format msgctxt "Hijri month 10 - KLocale::ShortName Possessive" msgid "of Shw" msgstr "de Shw" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:217 #, kde-format msgctxt "Hijri month 11 - KLocale::ShortName Possessive" msgid "of Qid" msgstr "de Qid" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:219 #, kde-format msgctxt "Hijri month 12 - KLocale::ShortName Possessive" msgid "of Hij" msgstr "de Hij" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:228 #, kde-format msgctxt "Hijri month 1 - KLocale::ShortName" msgid "Muh" msgstr "Muh" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:230 #, kde-format msgctxt "Hijri month 2 - KLocale::ShortName" msgid "Saf" msgstr "Saf" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:232 #, kde-format msgctxt "Hijri month 3 - KLocale::ShortName" msgid "R.A" msgstr "R.A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:234 #, kde-format msgctxt "Hijri month 4 - KLocale::ShortName" msgid "R.T" msgstr "R.T" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:236 #, kde-format msgctxt "Hijri month 5 - KLocale::ShortName" msgid "J.A" msgstr "J.A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:238 #, kde-format msgctxt "Hijri month 6 - KLocale::ShortName" msgid "J.T" msgstr "J.T" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:240 #, kde-format msgctxt "Hijri month 7 - KLocale::ShortName" msgid "Raj" msgstr "Raj" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:242 #, kde-format msgctxt "Hijri month 8 - KLocale::ShortName" msgid "Sha" msgstr "Sha" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:244 #, kde-format msgctxt "Hijri month 9 - KLocale::ShortName" msgid "Ram" msgstr "Ram" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:246 #, kde-format msgctxt "Hijri month 10 - KLocale::ShortName" msgid "Shw" msgstr "Shw" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:248 #, kde-format msgctxt "Hijri month 11 - KLocale::ShortName" msgid "Qid" msgstr "Qid" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:250 #, kde-format msgctxt "Hijri month 12 - KLocale::ShortName" msgid "Hij" msgstr "Hij" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:259 #, kde-format msgctxt "Hijri month 1 - KLocale::LongName Possessive" msgid "of Muharram" msgstr "de Muharram" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:261 #, kde-format msgctxt "Hijri month 2 - KLocale::LongName Possessive" msgid "of Safar" msgstr "de Safar" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:263 #, kde-format msgctxt "Hijri month 3 - KLocale::LongName Possessive" msgid "of Rabi` al-Awal" msgstr "de Rabi` al-Awal" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:265 #, kde-format msgctxt "Hijri month 4 - KLocale::LongName Possessive" msgid "of Rabi` al-Thaani" msgstr "de Rabi` al-Thaani" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:267 #, kde-format msgctxt "Hijri month 5 - KLocale::LongName Possessive" msgid "of Jumaada al-Awal" msgstr "de Jumaada al-Awal" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:269 #, kde-format msgctxt "Hijri month 6 - KLocale::LongName Possessive" msgid "of Jumaada al-Thaani" msgstr "de Jumaada al-Thaani" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:271 #, kde-format msgctxt "Hijri month 7 - KLocale::LongName Possessive" msgid "of Rajab" msgstr "de Rajab" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:273 #, kde-format msgctxt "Hijri month 8 - KLocale::LongName Possessive" msgid "of Sha`ban" msgstr "de Sha`ban" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:275 #, kde-format msgctxt "Hijri month 9 - KLocale::LongName Possessive" msgid "of Ramadan" msgstr "de Ramadán" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:277 #, kde-format msgctxt "Hijri month 10 - KLocale::LongName Possessive" msgid "of Shawwal" msgstr "de Shawwal" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:279 #, kde-format msgctxt "Hijri month 11 - KLocale::LongName Possessive" msgid "of Thu al-Qi`dah" msgstr "de Thu al-Qi`dah" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:281 #, kde-format msgctxt "Hijri month 12 - KLocale::LongName Possessive" msgid "of Thu al-Hijjah" msgstr "de Thu al-Hijjah" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:290 #, kde-format msgctxt "Hijri month 1 - KLocale::LongName" msgid "Muharram" msgstr "Muharram" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:292 #, kde-format msgctxt "Hijri month 2 - KLocale::LongName" msgid "Safar" msgstr "Safar" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:294 #, kde-format msgctxt "Hijri month 3 - KLocale::LongName" msgid "Rabi` al-Awal" msgstr "Rabi` al-Awal" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:296 #, kde-format msgctxt "Hijri month 4 - KLocale::LongName" msgid "Rabi` al-Thaani" msgstr "Rabi` al-Thaani" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:298 #, kde-format msgctxt "Hijri month 5 - KLocale::LongName" msgid "Jumaada al-Awal" msgstr "Jumaada al-Awal" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:300 #, kde-format msgctxt "Hijri month 6 - KLocale::LongName" msgid "Jumaada al-Thaani" msgstr "Jumaada al-Thaani" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:302 #, kde-format msgctxt "Hijri month 7 - KLocale::LongName" msgid "Rajab" msgstr "Rajab" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:304 #, kde-format msgctxt "Hijri month 8 - KLocale::LongName" msgid "Sha`ban" msgstr "Sha`ban" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:306 #, kde-format msgctxt "Hijri month 9 - KLocale::LongName" msgid "Ramadan" msgstr "Ramadán" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:308 #, kde-format msgctxt "Hijri month 10 - KLocale::LongName" msgid "Shawwal" msgstr "Shawwal" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:310 #, kde-format msgctxt "Hijri month 11 - KLocale::LongName" msgid "Thu al-Qi`dah" msgstr "Thu al-Qi`dah" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:312 #, kde-format msgctxt "Hijri month 12 - KLocale::LongName" msgid "Thu al-Hijjah" msgstr "Thu al-Hijjah" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:325 #, kde-format msgctxt "Hijri weekday 1 - KLocale::NarrowName " msgid "I" msgstr "I" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:327 #, kde-format msgctxt "Hijri weekday 2 - KLocale::NarrowName " msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:329 #, kde-format msgctxt "Hijri weekday 3 - KLocale::NarrowName " msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:331 #, kde-format msgctxt "Hijri weekday 4 - KLocale::NarrowName " msgid "K" msgstr "K" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:333 #, kde-format msgctxt "Hijri weekday 5 - KLocale::NarrowName " msgid "J" msgstr "J" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:335 #, kde-format msgctxt "Hijri weekday 6 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:337 #, kde-format msgctxt "Hijri weekday 7 - KLocale::NarrowName " msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:346 #, kde-format msgctxt "Hijri weekday 1 - KLocale::ShortName" msgid "Ith" msgstr "Ith" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:348 #, kde-format msgctxt "Hijri weekday 2 - KLocale::ShortName" msgid "Thl" msgstr "Thl" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:350 #, kde-format msgctxt "Hijri weekday 3 - KLocale::ShortName" msgid "Arb" msgstr "Arb" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:352 #, kde-format msgctxt "Hijri weekday 4 - KLocale::ShortName" msgid "Kha" msgstr "Kha" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:354 #, kde-format msgctxt "Hijri weekday 5 - KLocale::ShortName" msgid "Jum" msgstr "Jum" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:356 #, kde-format msgctxt "Hijri weekday 6 - KLocale::ShortName" msgid "Sab" msgstr "Sab" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:358 #, kde-format msgctxt "Hijri weekday 7 - KLocale::ShortName" msgid "Ahd" msgstr "AHD" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:365 #, kde-format msgctxt "Hijri weekday 1 - KLocale::LongName" msgid "Yaum al-Ithnain" msgstr "Yaum al-Ithnain" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:367 #, kde-format msgctxt "Hijri weekday 2 - KLocale::LongName" msgid "Yau al-Thulatha" msgstr "Yau al-Thulatha" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:369 #, kde-format msgctxt "Hijri weekday 3 - KLocale::LongName" msgid "Yaum al-Arbi'a" msgstr "Yaum al-Arbi'a" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:371 #, kde-format msgctxt "Hijri weekday 4 - KLocale::LongName" msgid "Yaum al-Khamees" msgstr "Yaum al-Khamees" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:373 #, kde-format msgctxt "Hijri weekday 5 - KLocale::LongName" msgid "Yaum al-Jumma" msgstr "Yaum al-Jumma" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:375 #, kde-format msgctxt "Hijri weekday 6 - KLocale::LongName" msgid "Yaum al-Sabt" msgstr "Yaum al-Sabt" #. +> trunk5 #: kdecore/kcalendarsystemislamiccivil.cpp:377 #, kde-format msgctxt "Hijri weekday 7 - KLocale::LongName" msgid "Yaum al-Ahad" msgstr "Yaum al-Ahad" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:74 #, kde-format msgctxt "Calendar Era: Jalali Islamic Era, years > 0, LongFormat" msgid "Anno Persico" msgstr "Calendario persa" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:75 #, kde-format msgctxt "Calendar Era: Jalali Islamic Era, years > 0, ShortFormat" msgid "AP" msgstr "AP" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:76 #, kde-format -msgctxt "(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" +msgctxt "" +"(kdedt-format) Jalali, AP, full era year format used for %EY, e.g. 2000 AP" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:172 #, kde-format msgctxt "Jalali month 1 - KLocale::NarrowName" msgid "F" msgstr "F" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:174 #, kde-format msgctxt "Jalali month 2 - KLocale::NarrowName" msgid "O" msgstr "O" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:176 #, kde-format msgctxt "Jalali month 3 - KLocale::NarrowName" msgid "K" msgstr "K" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:178 #, kde-format msgctxt "Jalali month 4 - KLocale::NarrowName" msgid "T" msgstr "T" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:180 #, kde-format msgctxt "Jalali month 5 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:182 #, kde-format msgctxt "Jalali month 6 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:184 #, kde-format msgctxt "Jalali month 7 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:186 #, kde-format msgctxt "Jalali month 8 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:188 #, kde-format msgctxt "Jalali month 9 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:190 #, kde-format msgctxt "Jalali month 10 - KLocale::NarrowName" msgid "D" msgstr "D" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:192 #, kde-format msgctxt "Jalali month 11 - KLocale::NarrowName" msgid "B" msgstr "B" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:194 #, kde-format msgctxt "Jalali month 12 - KLocale::NarrowName" msgid "E" msgstr "E" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:203 #, kde-format msgctxt "Jalali month 1 - KLocale::ShortName Possessive" msgid "of Far" msgstr "de Far" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:205 #, kde-format msgctxt "Jalali month 2 - KLocale::ShortName Possessive" msgid "of Ord" msgstr "de Ord" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:207 #, kde-format msgctxt "Jalali month 3 - KLocale::ShortName Possessive" msgid "of Kho" msgstr "de Kho" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:209 #, kde-format msgctxt "Jalali month 4 - KLocale::ShortName Possessive" msgid "of Tir" msgstr "de Tir" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:211 #, kde-format msgctxt "Jalali month 5 - KLocale::ShortName Possessive" msgid "of Mor" msgstr "de Mor" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:213 #, kde-format msgctxt "Jalali month 6 - KLocale::ShortName Possessive" msgid "of Sha" msgstr "de Sha" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:215 #, kde-format msgctxt "Jalali month 7 - KLocale::ShortName Possessive" msgid "of Meh" msgstr "de Meh" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:217 #, kde-format msgctxt "Jalali month 8 - KLocale::ShortName Possessive" msgid "of Aba" msgstr "de Aba" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:219 #, kde-format msgctxt "Jalali month 9 - KLocale::ShortName Possessive" msgid "of Aza" msgstr "de Aza" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:221 #, kde-format msgctxt "Jalali month 10 - KLocale::ShortName Possessive" msgid "of Dei" msgstr "de Dei" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:223 #, kde-format msgctxt "Jalali month 11 - KLocale::ShortName Possessive" msgid "of Bah" msgstr "de Bah" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:225 #, kde-format msgctxt "Jalali month 12 - KLocale::ShortName Possessive" msgid "of Esf" msgstr "de Esf" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:234 #, kde-format msgctxt "Jalali month 1 - KLocale::ShortName" msgid "Far" msgstr "Far" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:236 #, kde-format msgctxt "Jalali month 2 - KLocale::ShortName" msgid "Ord" msgstr "Ord" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:238 #, kde-format msgctxt "Jalali month 3 - KLocale::ShortName" msgid "Kho" msgstr "Kho" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:240 #, kde-format msgctxt "Jalali month 4 - KLocale::ShortName" msgid "Tir" msgstr "Tir" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:242 #, kde-format msgctxt "Jalali month 5 - KLocale::ShortName" msgid "Mor" msgstr "Mor" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:244 #, kde-format msgctxt "Jalali month 6 - KLocale::ShortName" msgid "Sha" msgstr "Sha" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:246 #, kde-format msgctxt "Jalali month 7 - KLocale::ShortName" msgid "Meh" msgstr "Meh" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:248 #, kde-format msgctxt "Jalali month 8 - KLocale::ShortName" msgid "Aba" msgstr "Aba" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:250 #, kde-format msgctxt "Jalali month 9 - KLocale::ShortName" msgid "Aza" msgstr "Aza" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:252 #, kde-format msgctxt "Jalali month 10 - KLocale::ShortName" msgid "Dei" msgstr "Dei" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:254 #, kde-format msgctxt "Jalali month 11 - KLocale::ShortName" msgid "Bah" msgstr "Bah" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:256 #, kde-format msgctxt "Jalali month 12 - KLocale::ShortName" msgid "Esf" msgstr "Esf" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:265 #, kde-format msgctxt "Jalali month 1 - KLocale::LongName Possessive" msgid "of Farvardin" msgstr "de Farvardin" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:267 #, kde-format msgctxt "Jalali month 2 - KLocale::LongName Possessive" msgid "of Ordibehesht" msgstr "de Ordibehesht" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:269 #, kde-format msgctxt "Jalali month 3 - KLocale::LongName Possessive" msgid "of Khordad" msgstr "de Khordad" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:271 #, kde-format msgctxt "Jalali month 4 - KLocale::LongName Possessive" msgid "of Tir" msgstr "de Tir" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:273 #, kde-format msgctxt "Jalali month 5 - KLocale::LongName Possessive" msgid "of Mordad" msgstr "de Mordad" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:275 #, kde-format msgctxt "Jalali month 6 - KLocale::LongName Possessive" msgid "of Shahrivar" msgstr "de Shahrivar" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:277 #, kde-format msgctxt "Jalali month 7 - KLocale::LongName Possessive" msgid "of Mehr" msgstr "de Mehr" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:279 #, kde-format msgctxt "Jalali month 8 - KLocale::LongName Possessive" msgid "of Aban" msgstr "de Aban" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:281 #, kde-format msgctxt "Jalali month 9 - KLocale::LongName Possessive" msgid "of Azar" msgstr "de Azar" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:283 #, kde-format msgctxt "Jalali month 10 - KLocale::LongName Possessive" msgid "of Dei" msgstr "de Dei" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:285 #, kde-format msgctxt "Jalali month 11 - KLocale::LongName Possessive" msgid "of Bahman" msgstr "de Bahman" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:287 #, kde-format msgctxt "Jalali month 12 - KLocale::LongName Possessive" msgid "of Esfand" msgstr "de Esfand" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:296 #, kde-format msgctxt "Jalali month 1 - KLocale::LongName" msgid "Farvardin" msgstr "Farvardin" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:298 #, kde-format msgctxt "Jalali month 2 - KLocale::LongName" msgid "Ordibehesht" msgstr "Ordibehesht" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:300 #, kde-format msgctxt "Jalali month 3 - KLocale::LongName" msgid "Khordad" msgstr "Khordad" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:302 #, kde-format msgctxt "Jalali month 4 - KLocale::LongName" msgid "Tir" msgstr "Tir" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:304 #, kde-format msgctxt "Jalali month 5 - KLocale::LongName" msgid "Mordad" msgstr "Mordad" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:306 #, kde-format msgctxt "Jalali month 6 - KLocale::LongName" msgid "Shahrivar" msgstr "Shahrivar" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:308 #, kde-format msgctxt "Jalali month 7 - KLocale::LongName" msgid "Mehr" msgstr "Mehr" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:310 #, kde-format msgctxt "Jalali month 8 - KLocale::LongName" msgid "Aban" msgstr "Aban" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:312 #, kde-format msgctxt "Jalali month 9 - KLocale::LongName" msgid "Azar" msgstr "Azar" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:314 #, kde-format msgctxt "Jalali month 10 - KLocale::LongName" msgid "Dei" msgstr "Dei" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:316 #, kde-format msgctxt "Jalali month 11 - KLocale::LongName" msgid "Bahman" msgstr "Bahman" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:318 #, kde-format msgctxt "Jalali month 12 - KLocale::LongName" msgid "Esfand" msgstr "Esfand" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:331 #, kde-format msgctxt "Jalali weekday 1 - KLocale::NarrowName " msgid "2" msgstr "2" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:333 #, kde-format msgctxt "Jalali weekday 2 - KLocale::NarrowName " msgid "3" msgstr "3" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:335 #, kde-format msgctxt "Jalali weekday 3 - KLocale::NarrowName " msgid "4" msgstr "4" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:337 #, kde-format msgctxt "Jalali weekday 4 - KLocale::NarrowName " msgid "5" msgstr "5" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:339 #, kde-format msgctxt "Jalali weekday 5 - KLocale::NarrowName " msgid "J" msgstr "J" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:341 #, kde-format msgctxt "Jalali weekday 6 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:343 #, kde-format msgctxt "Jalali weekday 7 - KLocale::NarrowName " msgid "1" msgstr "1" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:352 #, kde-format msgctxt "Jalali weekday 1 - KLocale::ShortName" msgid "2sh" msgstr "2sh" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:354 #, kde-format msgctxt "Jalali weekday 2 - KLocale::ShortName" msgid "3sh" msgstr "3sh" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:356 #, kde-format msgctxt "Jalali weekday 3 - KLocale::ShortName" msgid "4sh" msgstr "4sh" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:358 #, kde-format msgctxt "Jalali weekday 4 - KLocale::ShortName" msgid "5sh" msgstr "5sh" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:360 #, kde-format msgctxt "Jalali weekday 5 - KLocale::ShortName" msgid "Jom" msgstr "Jom" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:362 #, kde-format msgctxt "Jalali weekday 6 - KLocale::ShortName" msgid "Shn" msgstr "Shn" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:364 #, kde-format msgctxt "Jalali weekday 7 - KLocale::ShortName" msgid "1sh" msgstr "1sh" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:371 #, kde-format msgctxt "Jalali weekday 1 - KLocale::LongName" msgid "Do shanbe" msgstr "Do shanbe" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:373 #, kde-format msgctxt "Jalali weekday 2 - KLocale::LongName" msgid "Se shanbe" msgstr "Se shanbe" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:375 #, kde-format msgctxt "Jalali weekday 3 - KLocale::LongName" msgid "Chahar shanbe" msgstr "Chahar shanbe" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:377 #, kde-format msgctxt "Jalali weekday 4 - KLocale::LongName" msgid "Panj shanbe" msgstr "Panj shanbe" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:379 #, kde-format msgctxt "Jalali weekday 5 - KLocale::LongName" msgid "Jumee" msgstr "Jumee" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:381 #, kde-format msgctxt "Jalali weekday 6 - KLocale::LongName" msgid "Shanbe" msgstr "Shanbe" #. +> trunk5 #: kdecore/kcalendarsystemjalali.cpp:383 #, kde-format msgctxt "Jalali weekday 7 - KLocale::LongName" msgid "Yek-shanbe" msgstr "Yek-shanbe" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:62 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Meiji Era, LongFormat" msgid "Meiji" msgstr "Meiji" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:64 #, kde-format -msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1, e.g. Meiji 1" +msgctxt "" +"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year = 1," +" e.g. Meiji 1" msgid "%EC Gannen" msgstr "%EC Gannen" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:66 #, kde-format -msgctxt "(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1, e.g. Meiji 22" +msgctxt "" +"(kdedt-format) Japanese, Meiji, full era year format used for %EY, year > 1," +" e.g. Meiji 22" msgid "%EC %Ey" msgstr "%EC %Ey" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:69 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Taishō Era, LongFormat" msgid "Taishō" msgstr "Taishō" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:71 #, kde-format -msgctxt "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = 1, e.g. Taishō 1" +msgctxt "" +"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year = 1," +" e.g. Taishō 1" msgid "%EC Gannen" msgstr "%EC Gannen" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:73 #, kde-format -msgctxt "(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > 1, e.g. Taishō 22" +msgctxt "" +"(kdedt-format) Japanese, Taishō, full era year format used for %EY, year > 1," +" e.g. Taishō 22" msgid "%EC %Ey" msgstr "%EC %Ey" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:76 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Shōwa Era, LongFormat" msgid "Shōwa" msgstr "Shōwa" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:78 #, kde-format -msgctxt "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1, e.g. Shōwa 1" +msgctxt "" +"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year = 1," +" e.g. Shōwa 1" msgid "%EC Gannen" msgstr "%EC Gannen" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:80 #, kde-format -msgctxt "(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1, e.g. Shōwa 22" +msgctxt "" +"(kdedt-format) Japanese, Shōwa, full era year format used for %EY, year > 1," +" e.g. Shōwa 22" msgid "%EC %Ey" msgstr "%EC %Ey" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:83 #, kde-format msgctxt "Calendar Era: Japanese Nengō, Heisei Era, LongFormat" msgid "Heisei" msgstr "Heisei" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:85 #, kde-format -msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1, e.g. Heisei 1" +msgctxt "" +"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year = 1," +" e.g. Heisei 1" msgid "%EC Gannen" msgstr "%EC Gannen" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:87 #, kde-format -msgctxt "(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1, e.g. Heisei 22" +msgctxt "" +"(kdedt-format) Japanese, Heisei, full era year format used for %EY, year > 1," +" e.g. Heisei 22" msgid "%EC %Ey" msgstr "%EC %Ey" #. +> trunk5 #: kdecore/kcalendarsystemjapanese.cpp:164 #, kde-format msgctxt "Japanese year 1 of era" msgid "Gannen" msgstr "Gannen" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:73 #, kde-format msgctxt "Calendar Era: Julian Common Era, years < 0, LongFormat" msgid "Before Common Era" msgstr "Antes da Era Común" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:74 #, kde-format msgctxt "Calendar Era: Julian Common Era, years < 0, ShortFormat" msgid "BCE" msgstr "AEC" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:76 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years < 0, LongFormat" msgid "Before Christ" msgstr "Antes de Cristo" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:77 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years < 0, ShortFormat" msgid "BC" msgstr "AC" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:79 #, kde-format -msgctxt "(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" +msgctxt "" +"(kdedt-format) Julian, BC, full era year format used for %EY, e.g. 2000 BC" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:83 #, kde-format msgctxt "Calendar Era: Julian Common Era, years > 0, LongFormat" msgid "Common Era" msgstr "Era Común" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:84 #, kde-format msgctxt "Calendar Era: Julian Common Era, years > 0, ShortFormat" msgid "CE" msgstr "EC" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:86 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years > 0, LongFormat" msgid "Anno Domini" msgstr "Anno Domini" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:87 #, kde-format msgctxt "Calendar Era: Julian Christian Era, years > 0, ShortFormat" msgid "AD" msgstr "AD" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:89 #, kde-format -msgctxt "(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" +msgctxt "" +"(kdedt-format) Julian, AD, full era year format used for %EY, e.g. 2000 AD" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:172 #, kde-format msgctxt "Julian month 1 - KLocale::NarrowName" msgid "J" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:174 #, kde-format msgctxt "Julian month 2 - KLocale::NarrowName" msgid "F" msgstr "F" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:176 #, kde-format msgctxt "Julian month 3 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:178 #, kde-format msgctxt "Julian month 4 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:180 #, kde-format msgctxt "Julian month 5 - KLocale::NarrowName" msgid "M" msgstr "M" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:182 #, kde-format msgctxt "Julian month 6 - KLocale::NarrowName" msgid "J" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:184 #, kde-format msgctxt "Julian month 7 - KLocale::NarrowName" msgid "J" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:186 #, kde-format msgctxt "Julian month 8 - KLocale::NarrowName" msgid "A" msgstr "A" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:188 #, kde-format msgctxt "Julian month 9 - KLocale::NarrowName" msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:190 #, kde-format msgctxt "Julian month 10 - KLocale::NarrowName" msgid "O" msgstr "O" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:192 #, kde-format msgctxt "Julian month 11 - KLocale::NarrowName" msgid "N" msgstr "N" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:194 #, kde-format msgctxt "Julian month 12 - KLocale::NarrowName" msgid "D" msgstr "D" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:203 #, kde-format msgctxt "Julian month 1 - KLocale::ShortName Possessive" msgid "of Jan" msgstr "de xan" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:205 #, kde-format msgctxt "Julian month 2 - KLocale::ShortName Possessive" msgid "of Feb" msgstr "de feb" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:207 #, kde-format msgctxt "Julian month 3 - KLocale::ShortName Possessive" msgid "of Mar" msgstr "de mar" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:209 #, kde-format msgctxt "Julian month 4 - KLocale::ShortName Possessive" msgid "of Apr" msgstr "de abr" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:211 #, kde-format msgctxt "Julian month 5 - KLocale::ShortName Possessive" msgid "of May" msgstr "de mai" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:213 #, kde-format msgctxt "Julian month 6 - KLocale::ShortName Possessive" msgid "of Jun" msgstr "de xuñ" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:215 #, kde-format msgctxt "Julian month 7 - KLocale::ShortName Possessive" msgid "of Jul" msgstr "de xul" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:217 #, kde-format msgctxt "Julian month 8 - KLocale::ShortName Possessive" msgid "of Aug" msgstr "de ago" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:219 #, kde-format msgctxt "Julian month 9 - KLocale::ShortName Possessive" msgid "of Sep" msgstr "de set" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:221 #, kde-format msgctxt "Julian month 10 - KLocale::ShortName Possessive" msgid "of Oct" msgstr "de out" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:223 #, kde-format msgctxt "Julian month 11 - KLocale::ShortName Possessive" msgid "of Nov" msgstr "de nov" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:225 #, kde-format msgctxt "Julian month 12 - KLocale::ShortName Possessive" msgid "of Dec" msgstr "de dec" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:234 #, kde-format msgctxt "Julian month 1 - KLocale::ShortName" msgid "Jan" msgstr "xan" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:236 #, kde-format msgctxt "Julian month 2 - KLocale::ShortName" msgid "Feb" msgstr "feb" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:238 #, kde-format msgctxt "Julian month 3 - KLocale::ShortName" msgid "Mar" msgstr "mar" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:240 #, kde-format msgctxt "Julian month 4 - KLocale::ShortName" msgid "Apr" msgstr "abr" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:242 #, kde-format msgctxt "Julian month 5 - KLocale::ShortName" msgid "May" msgstr "mai" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:244 #, kde-format msgctxt "Julian month 6 - KLocale::ShortName" msgid "Jun" msgstr "xun" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:246 #, kde-format msgctxt "Julian month 7 - KLocale::ShortName" msgid "Jul" msgstr "xul" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:248 #, kde-format msgctxt "Julian month 8 - KLocale::ShortName" msgid "Aug" msgstr "ago" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:250 #, kde-format msgctxt "Julian month 9 - KLocale::ShortName" msgid "Sep" msgstr "set" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:252 #, kde-format msgctxt "Julian month 10 - KLocale::ShortName" msgid "Oct" msgstr "out" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:254 #, kde-format msgctxt "Julian month 11 - KLocale::ShortName" msgid "Nov" msgstr "nov" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:256 #, kde-format msgctxt "Julian month 12 - KLocale::ShortName" msgid "Dec" msgstr "dec" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:265 #, kde-format msgctxt "Julian month 1 - KLocale::LongName Possessive" msgid "of January" msgstr "de xaneiro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:267 #, kde-format msgctxt "Julian month 2 - KLocale::LongName Possessive" msgid "of February" msgstr "de febreiro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:269 #, kde-format msgctxt "Julian month 3 - KLocale::LongName Possessive" msgid "of March" msgstr "de marzo" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:271 #, kde-format msgctxt "Julian month 4 - KLocale::LongName Possessive" msgid "of April" msgstr "de abril" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:273 #, kde-format msgctxt "Julian month 5 - KLocale::LongName Possessive" msgid "of May" msgstr "de maio" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:275 #, kde-format msgctxt "Julian month 6 - KLocale::LongName Possessive" msgid "of June" msgstr "de xuño" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:277 #, kde-format msgctxt "Julian month 7 - KLocale::LongName Possessive" msgid "of July" msgstr "de xullo" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:279 #, kde-format msgctxt "Julian month 8 - KLocale::LongName Possessive" msgid "of August" msgstr "de agosto" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:281 #, kde-format msgctxt "Julian month 9 - KLocale::LongName Possessive" msgid "of September" msgstr "de setembro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:283 #, kde-format msgctxt "Julian month 10 - KLocale::LongName Possessive" msgid "of October" msgstr "de outubro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:285 #, kde-format msgctxt "Julian month 11 - KLocale::LongName Possessive" msgid "of November" msgstr "de novembro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:287 #, kde-format msgctxt "Julian month 12 - KLocale::LongName Possessive" msgid "of December" msgstr "de decembro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:296 #, kde-format msgctxt "Julian month 1 - KLocale::LongName" msgid "January" msgstr "Xaneiro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:298 #, kde-format msgctxt "Julian month 2 - KLocale::LongName" msgid "February" msgstr "Febreiro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:300 #, kde-format msgctxt "Julian month 3 - KLocale::LongName" msgid "March" msgstr "Marzo" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:302 #, kde-format msgctxt "Julian month 4 - KLocale::LongName" msgid "April" msgstr "Abril" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:304 #, kde-format msgctxt "Julian month 5 - KLocale::LongName" msgid "May" msgstr "Maio" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:306 #, kde-format msgctxt "Julian month 6 - KLocale::LongName" msgid "June" msgstr "Xuño" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:308 #, kde-format msgctxt "Julian month 7 - KLocale::LongName" msgid "July" msgstr "Xullo" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:310 #, kde-format msgctxt "Julian month 8 - KLocale::LongName" msgid "August" msgstr "Agosto" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:312 #, kde-format msgctxt "Julian month 9 - KLocale::LongName" msgid "September" msgstr "Setembro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:314 #, kde-format msgctxt "Julian month 10 - KLocale::LongName" msgid "October" msgstr "Outubro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:316 #, kde-format msgctxt "Julian month 11 - KLocale::LongName" msgid "November" msgstr "Novembro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:318 #, kde-format msgctxt "Julian month 12 - KLocale::LongName" msgid "December" msgstr "Decembro" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:331 #, kde-format msgctxt "Julian weekday 1 - KLocale::NarrowName " msgid "M" msgstr "L" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:333 #, kde-format msgctxt "Julian weekday 2 - KLocale::NarrowName " msgid "T" msgstr "Ma" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:335 #, kde-format msgctxt "Julian weekday 3 - KLocale::NarrowName " msgid "W" msgstr "Me" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:337 #, kde-format msgctxt "Julian weekday 4 - KLocale::NarrowName " msgid "T" msgstr "X" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:339 #, kde-format msgctxt "Julian weekday 5 - KLocale::NarrowName " msgid "F" msgstr "V" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:341 #, kde-format msgctxt "Julian weekday 6 - KLocale::NarrowName " msgid "S" msgstr "S" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:343 #, kde-format msgctxt "Julian weekday 7 - KLocale::NarrowName " msgid "S" msgstr "D" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:352 #, kde-format msgctxt "Julian weekday 1 - KLocale::ShortName" msgid "Mon" msgstr "Lun" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:354 #, kde-format msgctxt "Julian weekday 2 - KLocale::ShortName" msgid "Tue" msgstr "Mar" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:356 #, kde-format msgctxt "Julian weekday 3 - KLocale::ShortName" msgid "Wed" msgstr "Mér" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:358 #, kde-format msgctxt "Julian weekday 4 - KLocale::ShortName" msgid "Thu" msgstr "Xov" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:360 #, kde-format msgctxt "Julian weekday 5 - KLocale::ShortName" msgid "Fri" msgstr "Ven" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:362 #, kde-format msgctxt "Julian weekday 6 - KLocale::ShortName" msgid "Sat" msgstr "Sáb" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:364 #, kde-format msgctxt "Julian weekday 7 - KLocale::ShortName" msgid "Sun" msgstr "Dom" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:371 #, kde-format msgctxt "Julian weekday 1 - KLocale::LongName" msgid "Monday" msgstr "Luns" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:373 #, kde-format msgctxt "Julian weekday 2 - KLocale::LongName" msgid "Tuesday" msgstr "Martes" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:375 #, kde-format msgctxt "Julian weekday 3 - KLocale::LongName" msgid "Wednesday" msgstr "Mércores" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:377 #, kde-format msgctxt "Julian weekday 4 - KLocale::LongName" msgid "Thursday" msgstr "Xoves" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:379 #, kde-format msgctxt "Julian weekday 5 - KLocale::LongName" msgid "Friday" msgstr "Venres" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:381 #, kde-format msgctxt "Julian weekday 6 - KLocale::LongName" msgid "Saturday" msgstr "Sábado" #. +> trunk5 #: kdecore/kcalendarsystemjulian.cpp:383 #, kde-format msgctxt "Julian weekday 7 - KLocale::LongName" msgid "Sunday" msgstr "Domingo" #. +> trunk5 #: kdecore/kcalendarsystemminguo.cpp:57 #, kde-format msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, LongFormat" msgid "Republic of China Era" msgstr "Era da República da China" #. +> trunk5 #: kdecore/kcalendarsystemminguo.cpp:58 #, kde-format msgctxt "Calendar Era: Taiwan Republic of China Era, years > 0, ShortFormat" msgid "ROC" msgstr "ERC" #. +> trunk5 #: kdecore/kcalendarsystemminguo.cpp:59 #, kde-format -msgctxt "(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" +msgctxt "" +"(kdedt-format) Taiwan, ROC, full era year format used for %EY, e.g. ROC 99" msgid "%EC %Ey" msgstr "%EC %Ey" #. +> trunk5 #: kdecore/kcalendarsystemthai.cpp:58 #, kde-format msgctxt "Calendar Era: Thai Buddhist Era, years > 0, LongFormat" msgid "Buddhist Era" msgstr "Era budista" #. +> trunk5 #: kdecore/kcalendarsystemthai.cpp:59 #, kde-format msgctxt "Calendar Era: Thai Buddhist Era, years > 0, ShortFormat" msgid "BE" msgstr "EB" #. +> trunk5 #: kdecore/kcalendarsystemthai.cpp:60 #, kde-format -msgctxt "(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" +msgctxt "" +"(kdedt-format) Thai, BE, full era year format used for %EY, e.g. 2000 BE" msgid "%Ey %EC" msgstr "%Ey %EC" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:278 #, kde-format msgid "Use the X-server display 'displayname'" msgstr "Usar a pantalla «displayname» de servidor X" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:281 #, kde-format msgid "Restore the application for the given 'sessionId'" msgstr "Restaurar a aplicación do «sessionId» indicado" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:282 #, kde-format msgid "" "Causes the application to install a private color\n" "map on an 8-bit display" msgstr "" "Fai que a aplicación instale un mapa de cores privado\n" "nunha pantalla de 8 bits" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:283 #, kde-format msgid "" "Limits the number of colors allocated in the color\n" "cube on an 8-bit display, if the application is\n" "using the QApplication::ManyColor color\n" "specification" msgstr "" "Limita o número de cores asignadas no cubo de cores nunha pantalla de\n" "8 bits, se a aplicación usa a especificación de cor QApplication::ManyColor." #. +> trunk5 #: kdecore/kcmdlineargs.cpp:284 #, kde-format msgid "tells Qt to never grab the mouse or the keyboard" msgstr "indícalle a Qt que nunca capture o rato nin o teclado" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:285 #, kde-format msgid "" "running under a debugger can cause an implicit\n" "-nograb, use -dograb to override" msgstr "" "a execución nun depurador pode causar un -nograb implícito,\n" "use -dograb para ignoralo" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:286 #, kde-format msgid "switches to synchronous mode for debugging" msgstr "cambia ao modo síncrono para depuración" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:288 #, kde-format msgid "defines the application font" msgstr "define a fonte da aplicación" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:290 #, kde-format msgid "" "sets the default background color and an\n" "application palette (light and dark shades are\n" "calculated)" msgstr "" "estabelece a cor de fondo predeterminada e a paleta\n" "da aplicación (calcúlanse as sombras escuras e claras)" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:292 #, kde-format msgid "sets the default foreground color" msgstr "estabelece a cor predeterminada do primeiro plano" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:294 #, kde-format msgid "sets the default button color" msgstr "estabelece a cor predeterminada dos botóns" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:295 #, kde-format msgid "sets the application name" msgstr "estabelece o nome da aplicación" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:296 #, kde-format msgid "sets the application title (caption)" msgstr "estabelece o título da aplicación (na cabeceira)" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:297 #, kde-format msgid "load the testability framework" msgstr "cargar a infraestrutura de capacidade de proba" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:299 #, kde-format msgid "" "forces the application to use a TrueColor visual on\n" "an 8-bit display" msgstr "obriga á aplicación a usar TrueColor nunha pantalla de 8 bits" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:300 #, kde-format msgid "" "sets XIM (X Input Method) input style. Possible\n" "values are onthespot, overthespot, offthespot and\n" "root" msgstr "" "estabelece o estilo de entrada XIM (Método de Entrada de X).\n" "Os valores posíbeis son onthespot, overthespot, offthespot\n" "e root" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:301 #, kde-format msgid "set XIM server" msgstr "estabelecer o servidor XIM" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:302 #, kde-format msgid "disable XIM" msgstr "desactivar XIM" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:304 #, kde-format msgid "mirrors the whole layout of widgets" msgstr "reflicte toda a disposición dos trebellos" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:305 #, kde-format msgid "applies the Qt stylesheet to the application widgets" msgstr "aplica a folla de estilo de Qt aos trebellos da aplicación" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:306 #, kde-format -msgid "use a different graphics system instead of the default one, options are raster and opengl (experimental)" -msgstr "empregar un sistema de gráficos distinto do predeterminado. As opcións son raster e opengl (experimental)" +msgid "" +"use a different graphics system instead of the default one, options are" +" raster and opengl (experimental)" +msgstr "" +"empregar un sistema de gráficos distinto do predeterminado. As opcións son" +" raster e opengl (experimental)" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:307 #, kde-format msgid "" "QML JS debugger information. Application must be\n" "built with -DQT_DECLARATIVE_DEBUG for the debugger to be\n" "enabled" msgstr "" "Información do depurador QML JS. A aplicación debe compilarse\n" "coa opción -DQT_DECLARATIVE_DEBUG para activar o depurador." #. +> trunk5 #: kdecore/kcmdlineargs.cpp:308 #, kde-format msgid "The windowing system platform (e.g. xcb or wayland)" msgstr "A plataforma do sistema de xanelas (p.ex. xcb ou wayland)" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:310 #, kde-format msgid "Use 'caption' as name in the titlebar" msgstr "Usar «caption» como nome na barra do título" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:311 #, kde-format msgid "Use 'icon' as the application icon" msgstr "Usar «icona» como icona da aplicación" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:312 #, kde-format msgid "Use alternative configuration file" msgstr "Usar un ficheiro de configuración alternativo" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:313 #, kde-format msgid "Disable crash handler, to get core dumps" msgstr "Desactivar o xestor de quebras, para obter envorcados" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:315 #, kde-format msgid "Waits for a WM_NET compatible windowmanager" msgstr "Agarda por un xestor de xanelas compatíbel con WM_NET" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:317 #, kde-format msgid "sets the application GUI style" msgstr "estabelece o estilo da GUI da aplicación" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:318 #, kde-format -msgid "sets the client geometry of the main widget - see man X for the argument format (usually WidthxHeight+XPos+YPos)" -msgstr "estabelece a xeometría do cliente do trebello principal; consulte a axuda das X para o formato do argumento (polo xeral Anchura×Altura+XPos+YPos)" +msgid "" +"sets the client geometry of the main widget - see man X for the argument" +" format (usually WidthxHeight+XPos+YPos)" +msgstr "" +"estabelece a xeometría do cliente do trebello principal; consulte a axuda das" +" X para o formato do argumento (polo xeral Anchura×Altura+XPos+YPos)" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:436 #, kde-format msgid "KDE Application" msgstr "Aplicación de KDE" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:497 #, kde-format msgid "Qt" msgstr "Qt" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:500 #, kde-format msgid "KDE" msgstr "KDE" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:821 kdecore/kcmdlineargs.cpp:835 #, kde-format msgid "Unknown option '%1'." msgstr "Non se coñece a opción «%1»." #. +> trunk5 #: kdecore/kcmdlineargs.cpp:841 #, kde-format msgctxt "@info:shell %1 is cmdoption name" msgid "'%1' missing." msgstr "falta «%1»." #. +> trunk5 #: kdecore/kcmdlineargs.cpp:895 #, kde-format -msgctxt "@info:shell message on appcmd --version; do not translate 'Development Platform'%3 application name, other %n version strings" +msgctxt "" +"@info:shell message on appcmd --version; do not translate 'Development" +" Platform'%3 application name, other %n version strings" msgid "" "Qt: %1\n" "KDE Frameworks: %2\n" "%3: %4\n" msgstr "" "Qt: %1\n" "Infraestrutura de KDE: %2\n" "%3: %4\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:921 #, kde-format msgctxt "the 2nd argument is a list of name+address, one on each line" msgid "" "%1 was written by\n" "%2" msgstr "" "%1 foi escrito por\n" "%2" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:924 #, kde-format msgid "This application was written by somebody who wants to remain anonymous." msgstr "Esta aplicación foi escrita por alguén que quere quedar anónimo." #. +> trunk5 #: kdecore/kcmdlineargs.cpp:929 #, kde-format msgid "Please use http://bugs.kde.org to report bugs.\n" msgstr "Use http://bugs.kde.org para informar de fallos.\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:931 #, kde-format msgid "Please report bugs to %1.\n" msgstr "Informe dos fallos a %1.\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:961 #, kde-format msgid "Unexpected argument '%1'." msgstr "Non se agardaba o argumento «%1»." #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1074 #, kde-format msgid "Use --help to get a list of available command line options." -msgstr "Use --help para obter unha lista das opcións dispoñíbeis na liña de ordes." +msgstr "" +"Use --help para obter unha lista das opcións dispoñíbeis na liña de ordes." #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1096 #, kde-format msgid "[options] " msgstr "[opcións] " #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1101 #, kde-format msgid "[%1-options]" msgstr "[opcións de %1]" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1122 #, kde-format msgid "Usage: %1 %2\n" msgstr "Uso: %1 %2\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1125 #, kde-format msgid "" "\n" "Generic options:\n" msgstr "" "\n" "Opcións xenéricas:\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1127 #, kde-format msgid "Show help about options" msgstr "Mostrar axuda sobre as opcións" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1133 #, kde-format msgid "Show %1 specific options" msgstr "Mostrar as opcións específicas de %1" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1140 #, kde-format msgid "Show all options" msgstr "Mostrar todas as opcións" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1141 #, kde-format msgid "Show author information" msgstr "Mostrar información do autor" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1142 #, kde-format msgid "Show version information" msgstr "Mostrar información da versión" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1143 #, kde-format msgid "Show license information" msgstr "Mostrar información da licenza" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1144 #, kde-format msgid "End of options" msgstr "Fin das opcións" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1164 #, kde-format msgid "" "\n" "%1 options:\n" msgstr "" "\n" "%1 opcións:\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1166 #, kde-format msgid "" "\n" "Options:\n" msgstr "" "\n" "Opcións:\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1219 #, kde-format msgid "" "\n" "Arguments:\n" msgstr "" "\n" "Argumentos:\n" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1580 #, kde-format msgid "The files/URLs opened by the application will be deleted after use" msgstr "Os ficheiros/URL abertos pola aplicación han eliminarse tras o seu uso" #. +> trunk5 #: kdecore/kcmdlineargs.cpp:1581 #, kde-format msgid "KDE-tempfile" msgstr "Ficheiro temporal de KDE" #. +> trunk5 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 #: kdecore/kdatetime.cpp:2985 #, kde-format msgid "am" msgstr "a.m." #. +> trunk5 #: kdecore/kdatetime.cpp:1567 kdecore/kdatetime.cpp:1577 #: kdecore/kdatetime.cpp:2990 #, kde-format msgid "pm" msgstr "p.m." #. +> trunk5 #: kdecore/klibloader.cpp:101 #, kde-format msgid "Library \"%1\" not found" msgstr "Non se atopou a biblioteca «%1»" #. +> trunk5 #: kdecore/klocale_kde.cpp:785 #, kde-format msgctxt "digit set" msgid "Arabic-Indic" msgstr "Árabe-índica" #. +> trunk5 #: kdecore/klocale_kde.cpp:788 #, kde-format msgctxt "digit set" msgid "Bengali" msgstr "Bengalí" #. +> trunk5 #: kdecore/klocale_kde.cpp:791 #, kde-format msgctxt "digit set" msgid "Devanagari" msgstr "Devanagárico" #. +> trunk5 #: kdecore/klocale_kde.cpp:794 #, kde-format msgctxt "digit set" msgid "Eastern Arabic-Indic" msgstr "Árabe-índica do leste" #. +> trunk5 #: kdecore/klocale_kde.cpp:797 #, kde-format msgctxt "digit set" msgid "Gujarati" msgstr "Guxaratí" #. +> trunk5 #: kdecore/klocale_kde.cpp:800 #, kde-format msgctxt "digit set" msgid "Gurmukhi" msgstr "Gurmukhi" #. +> trunk5 #: kdecore/klocale_kde.cpp:803 #, kde-format msgctxt "digit set" msgid "Kannada" msgstr "Kannada" #. +> trunk5 #: kdecore/klocale_kde.cpp:806 #, kde-format msgctxt "digit set" msgid "Khmer" msgstr "Khmer" #. +> trunk5 #: kdecore/klocale_kde.cpp:809 #, kde-format msgctxt "digit set" msgid "Malayalam" msgstr "Malayalam" #. +> trunk5 #: kdecore/klocale_kde.cpp:812 #, kde-format msgctxt "digit set" msgid "Oriya" msgstr "Orixa" #. +> trunk5 #: kdecore/klocale_kde.cpp:815 #, kde-format msgctxt "digit set" msgid "Tamil" msgstr "Tamil" #. +> trunk5 #: kdecore/klocale_kde.cpp:818 #, kde-format msgctxt "digit set" msgid "Telugu" msgstr "Telugu" #. +> trunk5 #: kdecore/klocale_kde.cpp:821 #, kde-format msgctxt "digit set" msgid "Thai" msgstr "Tailandés" #. +> trunk5 #: kdecore/klocale_kde.cpp:824 #, kde-format msgctxt "digit set" msgid "Arabic" msgstr "Árabe" #. +> trunk5 #: kdecore/klocale_kde.cpp:829 #, kde-format msgctxt "name of digit set with digit string, e.g. 'Arabic (0123456789)'" msgid "%1 (%2)" msgstr "%1 (%2)" #. i18n: comments below, they are used by the #. translators. #. This prefix is shared by all current dialects. #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1327 #, kde-format msgctxt "size in bytes" msgid "%1 B" msgstr "%1 B" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1332 #, kde-format msgctxt "size in 1000 bytes" msgid "%1 kB" msgstr "%1 kB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1334 #, kde-format msgctxt "size in 10^6 bytes" msgid "%1 MB" msgstr "%1 MB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1336 #, kde-format msgctxt "size in 10^9 bytes" msgid "%1 GB" msgstr "%1 GB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1338 #, kde-format msgctxt "size in 10^12 bytes" msgid "%1 TB" msgstr "%1 TB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1340 #, kde-format msgctxt "size in 10^15 bytes" msgid "%1 PB" msgstr "%1 PB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1342 #, kde-format msgctxt "size in 10^18 bytes" msgid "%1 EB" msgstr "%1 EB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1344 #, kde-format msgctxt "size in 10^21 bytes" msgid "%1 ZB" msgstr "%1 ZB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1346 #, kde-format msgctxt "size in 10^24 bytes" msgid "%1 YB" msgstr "%1 YB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1351 #, kde-format msgctxt "memory size in 1024 bytes" msgid "%1 KB" msgstr "%1 KB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1353 #, kde-format msgctxt "memory size in 2^20 bytes" msgid "%1 MB" msgstr "%1 MB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1355 #, kde-format msgctxt "memory size in 2^30 bytes" msgid "%1 GB" msgstr "%1 GB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1357 #, kde-format msgctxt "memory size in 2^40 bytes" msgid "%1 TB" msgstr "%1 TB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1359 #, kde-format msgctxt "memory size in 2^50 bytes" msgid "%1 PB" msgstr "%1 PB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1361 #, kde-format msgctxt "memory size in 2^60 bytes" msgid "%1 EB" msgstr "%1 EB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1363 #, kde-format msgctxt "memory size in 2^70 bytes" msgid "%1 ZB" msgstr "%1 ZB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1365 #, kde-format msgctxt "memory size in 2^80 bytes" msgid "%1 YB" msgstr "%1 YB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1371 #, kde-format msgctxt "size in 1024 bytes" msgid "%1 KiB" msgstr "%1 KiB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1373 #, kde-format msgctxt "size in 2^20 bytes" msgid "%1 MiB" msgstr "%1 MiB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1375 #, kde-format msgctxt "size in 2^30 bytes" msgid "%1 GiB" msgstr "%1 GiB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1377 #, kde-format msgctxt "size in 2^40 bytes" msgid "%1 TiB" msgstr "%1 TiB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1379 #, kde-format msgctxt "size in 2^50 bytes" msgid "%1 PiB" msgstr "%1 PiB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1381 #, kde-format msgctxt "size in 2^60 bytes" msgid "%1 EiB" msgstr "%1 EiB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1383 #, kde-format msgctxt "size in 2^70 bytes" msgid "%1 ZiB" msgstr "%1 ZiB" #. i18n: Dumb message, avoid any markup or scripting. #. +> trunk5 #: kdecore/klocale_kde.cpp:1385 #, kde-format msgctxt "size in 2^80 bytes" msgid "%1 YiB" msgstr "%1 YiB" #. +> trunk5 #: kdecore/klocale_kde.cpp:1472 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 days" msgid "%1 days" msgstr "%1 días" #. +> trunk5 #: kdecore/klocale_kde.cpp:1475 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 hours" msgid "%1 hours" msgstr "%1 horas" #. +> trunk5 #: kdecore/klocale_kde.cpp:1478 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 minutes" msgid "%1 minutes" msgstr "%1 minutos" #. +> trunk5 #: kdecore/klocale_kde.cpp:1481 #, kde-format msgctxt "@item:intext %1 is a real number, e.g. 1.23 seconds" msgid "%1 seconds" msgstr "%1 segundos" #. +> trunk5 #: kdecore/klocale_kde.cpp:1484 #, kde-format msgctxt "@item:intext" msgid "%1 millisecond" msgid_plural "%1 milliseconds" msgstr[0] "%1 milisegundo" msgstr[1] "%1 milisegundos" #. +> trunk5 #: kdecore/klocale_kde.cpp:1491 #, kde-format msgctxt "@item:intext" msgid "1 day" msgid_plural "%1 days" msgstr[0] "1 día" msgstr[1] "%1 días" #. +> trunk5 #: kdecore/klocale_kde.cpp:1493 #, kde-format msgctxt "@item:intext" msgid "1 hour" msgid_plural "%1 hours" msgstr[0] "1 hora" msgstr[1] "%1 horas" #. +> trunk5 #: kdecore/klocale_kde.cpp:1495 #, kde-format msgctxt "@item:intext" msgid "1 minute" msgid_plural "%1 minutes" msgstr[0] "1 minuto" msgstr[1] "%1 minutos" #. +> trunk5 #: kdecore/klocale_kde.cpp:1497 #, kde-format msgctxt "@item:intext" msgid "1 second" msgid_plural "%1 seconds" msgstr[0] "1 segundo" msgstr[1] "%1 segundos" #. +> trunk5 #: kdecore/klocale_kde.cpp:1521 #, kde-format -msgctxt "@item:intext days and hours. This uses the previous item:intext messages. If this does not fit the grammar of your language please contact the i18n team to solve the problem" +msgctxt "" +"@item:intext days and hours. This uses the previous item:intext messages. If" +" this does not fit the grammar of your language please contact the i18n team" +" to solve the problem" msgid "%1 and %2" msgstr "%1 e %2" #. +> trunk5 #: kdecore/klocale_kde.cpp:1527 #, kde-format -msgctxt "@item:intext hours and minutes. This uses the previous item:intext messages. If this does not fit the grammar of your language please contact the i18n team to solve the problem" +msgctxt "" +"@item:intext hours and minutes. This uses the previous item:intext messages." +" If this does not fit the grammar of your language please contact the i18n" +" team to solve the problem" msgid "%1 and %2" msgstr "%1 e %2" #. +> trunk5 #: kdecore/klocale_kde.cpp:1534 #, kde-format -msgctxt "@item:intext minutes and seconds. This uses the previous item:intext messages. If this does not fit the grammar of your language please contact the i18n team to solve the problem" +msgctxt "" +"@item:intext minutes and seconds. This uses the previous item:intext" +" messages. If this does not fit the grammar of your language please contact" +" the i18n team to solve the problem" msgid "%1 and %2" msgstr "%1 e %2" #. +> trunk5 #: kdecore/klocale_kde.cpp:2153 #, kde-format msgctxt "Before Noon KLocale::LongName" msgid "Ante Meridiem" msgstr "Ante meridiem" #. +> trunk5 #: kdecore/klocale_kde.cpp:2154 #, kde-format msgctxt "Before Noon KLocale::ShortName" msgid "AM" msgstr "a.m." #. +> trunk5 #: kdecore/klocale_kde.cpp:2155 #, kde-format msgctxt "Before Noon KLocale::NarrowName" msgid "A" msgstr "a" #. +> trunk5 #: kdecore/klocale_kde.cpp:2158 #, kde-format msgctxt "After Noon KLocale::LongName" msgid "Post Meridiem" msgstr "Post meridiem" #. +> trunk5 #: kdecore/klocale_kde.cpp:2159 #, kde-format msgctxt "After Noon KLocale::ShortName" msgid "PM" msgstr "p.m." #. +> trunk5 #: kdecore/klocale_kde.cpp:2160 #, kde-format msgctxt "After Noon KLocale::NarrowName" msgid "P" msgstr "p" #. +> trunk5 #: kdecore/klocale_kde.cpp:2227 kio/kfilemetadataprovider.cpp:209 #, kde-format msgctxt "concatenation of dates and time" msgid "%1 %2" msgstr "%1 %2" #. +> trunk5 #: kdecore/klocale_kde.cpp:2267 #, kde-format msgctxt "concatenation of date/time and time zone" msgid "%1 %2" msgstr "%1 %2" #. +> trunk5 #: kdecore/ksavefile.cpp:99 #, kde-format msgid "No target filename has been given." msgstr "Non se indicou o nome do ficheiro de destino." #. +> trunk5 #: kdecore/ksavefile.cpp:106 #, kde-format msgid "Already opened." msgstr "Xa está aberto." #. +> trunk5 #: kdecore/ksavefile.cpp:135 #, kde-format msgid "Insufficient permissions in target directory." msgstr "Non ten permisos de abondo no directorio de destino." #. +> trunk5 #: kdecore/ksavefile.cpp:139 #, kde-format msgid "Unable to open temporary file." msgstr "Non se pode abrir o ficheiro temporal." #. +> trunk5 #: kdecore/ksavefile.cpp:249 #, kde-format msgid "Synchronization to disk failed" msgstr "Fallou a sincronización co disco" #. +> trunk5 #: kdecore/ksavefile.cpp:280 #, kde-format msgid "Error during rename." msgstr "Produciuse un erro ao renomear." #. +> trunk5 #: kdecore/ksocketfactory.cpp:92 kdecore/ksocketfactory.cpp:106 #, kde-format msgid "Timed out trying to connect to remote host" msgstr "Esgotouse o tempo ao intentar conectar co servidor remoto" #. +> trunk5 #: kdecore/netsupp.cpp:869 #, kde-format msgid "address family for nodename not supported" msgstr "non se admite a familia de enderezos para o nome do nodo" #. +> trunk5 #: kdecore/netsupp.cpp:871 #, kde-format msgid "invalid value for 'ai_flags'" msgstr "valor incorrecto para «ai_flags»" #. +> trunk5 #: kdecore/netsupp.cpp:873 #, kde-format msgid "'ai_family' not supported" msgstr "a «ai_family» non está admitida" #. +> trunk5 #: kdecore/netsupp.cpp:875 #, kde-format msgid "no address associated with nodename" msgstr "non hai un enderezo asociado co nome do nodo" #. +> trunk5 #: kdecore/netsupp.cpp:877 #, kde-format msgid "servname not supported for ai_socktype" msgstr "nome de servidor non admitido para ai_socktype" #. +> trunk5 #: kdecore/netsupp.cpp:878 #, kde-format msgid "'ai_socktype' not supported" msgstr "«ai_socktype» non está admitido" #. +> trunk5 #: kdecore/netsupp.cpp:879 #, kde-format msgid "system error" msgstr "erro do sistema" #. +> trunk5 #: kdecore/qtest_kde.h:82 kdecore/qtest_kde.h:133 #, kde-format msgid "KDE Test Program" msgstr "Programa de proba de KDE" #. +> trunk5 #: kdecore/TIMEZONES:1 #, kde-format msgid "Africa/Abidjan" msgstr "África/Abidjan" #. +> trunk5 #: kdecore/TIMEZONES:2 #, kde-format msgid "Africa/Accra" msgstr "África/Accra" #. +> trunk5 #: kdecore/TIMEZONES:3 #, kde-format msgid "Africa/Addis_Ababa" msgstr "África/Addis Abeba" #. +> trunk5 #: kdecore/TIMEZONES:4 #, kde-format msgid "Africa/Algiers" msgstr "África/Alxer" #. +> trunk5 #: kdecore/TIMEZONES:5 #, kde-format msgid "Africa/Asmara" msgstr "África/Asmara" #. +> trunk5 #: kdecore/TIMEZONES:6 #, kde-format msgid "Africa/Asmera" msgstr "África/Asmera" #. +> trunk5 #: kdecore/TIMEZONES:7 #, kde-format msgid "Africa/Bamako" msgstr "África/Bamako" #. +> trunk5 #: kdecore/TIMEZONES:8 #, kde-format msgid "Africa/Bangui" msgstr "África/Bungui" #. +> trunk5 #: kdecore/TIMEZONES:9 #, kde-format msgid "Africa/Banjul" msgstr "África/Banjul" #. +> trunk5 #: kdecore/TIMEZONES:10 #, kde-format msgid "Africa/Bissau" msgstr "África/Bissau" #. +> trunk5 #: kdecore/TIMEZONES:11 #, kde-format msgid "Africa/Blantyre" msgstr "África/Blantyre" #. +> trunk5 #: kdecore/TIMEZONES:12 #, kde-format msgid "Africa/Brazzaville" msgstr "África/Brazzaville" #. +> trunk5 #: kdecore/TIMEZONES:13 #, kde-format msgid "Africa/Bujumbura" msgstr "África/Bujumbura" #. +> trunk5 #: kdecore/TIMEZONES:14 #, kde-format msgid "Africa/Cairo" msgstr "África/O Cairo" #. +> trunk5 #: kdecore/TIMEZONES:15 #, kde-format msgid "Africa/Casablanca" msgstr "África/Casabranca" #. +> trunk5 #: kdecore/TIMEZONES:16 #, kde-format msgid "Africa/Ceuta" msgstr "África/Ceuta" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:18 #, kde-format msgid "Ceuta & Melilla" msgstr "Ceuta e Melilla" #. +> trunk5 #: kdecore/TIMEZONES:19 #, kde-format msgid "Africa/Conakry" msgstr "África/Conakry" #. +> trunk5 #: kdecore/TIMEZONES:20 #, kde-format msgid "Africa/Dakar" msgstr "África/Dakar" #. +> trunk5 #: kdecore/TIMEZONES:21 #, kde-format msgid "Africa/Dar_es_Salaam" msgstr "África/Dar es Salaam" #. +> trunk5 #: kdecore/TIMEZONES:22 #, kde-format msgid "Africa/Djibouti" msgstr "África/Djibouti" #. +> trunk5 #: kdecore/TIMEZONES:23 #, kde-format msgid "Africa/Douala" msgstr "África/Douala" #. +> trunk5 #: kdecore/TIMEZONES:24 #, kde-format msgid "Africa/El_Aaiun" msgstr "África/El Aaiun" #. +> trunk5 #: kdecore/TIMEZONES:25 #, kde-format msgid "Africa/Freetown" msgstr "África/Freetown" #. +> trunk5 #: kdecore/TIMEZONES:26 #, kde-format msgid "Africa/Gaborone" msgstr "África/Gaborone" #. +> trunk5 #: kdecore/TIMEZONES:27 #, kde-format msgid "Africa/Harare" msgstr "África/Harare" #. +> trunk5 #: kdecore/TIMEZONES:28 #, kde-format msgid "Africa/Johannesburg" msgstr "África/Johanesburgo" #. +> trunk5 #: kdecore/TIMEZONES:29 #, kde-format msgid "Africa/Juba" msgstr "África/Juba" #. +> trunk5 #: kdecore/TIMEZONES:30 #, kde-format msgid "Africa/Kampala" msgstr "África/Kampala" #. +> trunk5 #: kdecore/TIMEZONES:31 #, kde-format msgid "Africa/Khartoum" msgstr "África/Cartún" #. +> trunk5 #: kdecore/TIMEZONES:32 #, kde-format msgid "Africa/Kigali" msgstr "África/Kigali" #. +> trunk5 #: kdecore/TIMEZONES:33 #, kde-format msgid "Africa/Kinshasa" msgstr "África/Kinshasa" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:35 #, kde-format msgid "west Dem. Rep. of Congo" msgstr "oeste da República Democrática do Congo" #. +> trunk5 #: kdecore/TIMEZONES:36 #, kde-format msgid "Africa/Lagos" msgstr "África/Lagos" #. +> trunk5 #: kdecore/TIMEZONES:37 #, kde-format msgid "Africa/Libreville" msgstr "África/Libreville" #. +> trunk5 #: kdecore/TIMEZONES:38 #, kde-format msgid "Africa/Lome" msgstr "África/Lomé" #. +> trunk5 #: kdecore/TIMEZONES:39 #, kde-format msgid "Africa/Luanda" msgstr "África/Luanda" #. +> trunk5 #: kdecore/TIMEZONES:40 #, kde-format msgid "Africa/Lubumbashi" msgstr "África/Lubumbashi" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:42 #, kde-format msgid "east Dem. Rep. of Congo" msgstr "leste da República Democrática do Congo" #. +> trunk5 #: kdecore/TIMEZONES:43 #, kde-format msgid "Africa/Lusaka" msgstr "África/Lusaca" #. +> trunk5 #: kdecore/TIMEZONES:44 #, kde-format msgid "Africa/Malabo" msgstr "África/Malabo" #. +> trunk5 #: kdecore/TIMEZONES:45 #, kde-format msgid "Africa/Maputo" msgstr "África/Maputo" #. +> trunk5 #: kdecore/TIMEZONES:46 #, kde-format msgid "Africa/Maseru" msgstr "África/Maseru" #. +> trunk5 #: kdecore/TIMEZONES:47 #, kde-format msgid "Africa/Mbabane" msgstr "África/Mbabane" #. +> trunk5 #: kdecore/TIMEZONES:48 #, kde-format msgid "Africa/Mogadishu" msgstr "África/Mogadiscio" #. +> trunk5 #: kdecore/TIMEZONES:49 #, kde-format msgid "Africa/Monrovia" msgstr "África/Monrovia" #. +> trunk5 #: kdecore/TIMEZONES:50 #, kde-format msgid "Africa/Nairobi" msgstr "África/Nairobi" #. +> trunk5 #: kdecore/TIMEZONES:51 #, kde-format msgid "Africa/Ndjamena" msgstr "África/N'djamena" #. +> trunk5 #: kdecore/TIMEZONES:52 #, kde-format msgid "Africa/Niamey" msgstr "África/Niamey" #. +> trunk5 #: kdecore/TIMEZONES:53 #, kde-format msgid "Africa/Nouakchott" msgstr "África/Nouakchott" #. +> trunk5 #: kdecore/TIMEZONES:54 #, kde-format msgid "Africa/Ouagadougou" msgstr "África/Ouagadougou" #. +> trunk5 #: kdecore/TIMEZONES:55 #, kde-format msgid "Africa/Porto-Novo" msgstr "África/Porto-Novo" #. +> trunk5 #: kdecore/TIMEZONES:56 #, kde-format msgid "Africa/Pretoria" msgstr "África/Pretoria" #. +> trunk5 #: kdecore/TIMEZONES:57 #, kde-format msgid "Africa/Sao_Tome" msgstr "África/Santo Tomé" #. +> trunk5 #: kdecore/TIMEZONES:58 #, kde-format msgid "Africa/Timbuktu" msgstr "África/Timbuktú" #. +> trunk5 #: kdecore/TIMEZONES:59 #, kde-format msgid "Africa/Tripoli" msgstr "África/Trípoli" #. +> trunk5 #: kdecore/TIMEZONES:60 #, kde-format msgid "Africa/Tunis" msgstr "África/Tunes" #. +> trunk5 #: kdecore/TIMEZONES:61 #, kde-format msgid "Africa/Windhoek" msgstr "África/Windhoek" #. +> trunk5 #: kdecore/TIMEZONES:62 #, kde-format msgid "America/Adak" msgstr "América/Adak" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:64 kdecore/TIMEZONES:121 kdecore/TIMEZONES:1068 #, kde-format msgid "Aleutian Islands" msgstr "Illas Aleutianas" #. +> trunk5 #: kdecore/TIMEZONES:65 #, kde-format msgid "America/Anchorage" msgstr "América/Anchorage" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:67 kdecore/TIMEZONES:1065 #, kde-format msgid "Alaska Time" msgstr "Hora de Alaska" #. +> trunk5 #: kdecore/TIMEZONES:68 #, kde-format msgid "America/Anguilla" msgstr "América/Anguilla" #. +> trunk5 #: kdecore/TIMEZONES:69 #, kde-format msgid "America/Antigua" msgstr "América/Antigua" #. +> trunk5 #: kdecore/TIMEZONES:70 #, kde-format msgid "America/Araguaina" msgstr "América/Araguaina" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:72 #, kde-format msgid "Tocantins" msgstr "Tocantins" #. +> trunk5 #: kdecore/TIMEZONES:73 #, kde-format msgid "America/Argentina/Buenos_Aires" msgstr "América/Arxentina/Bos Aires" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:75 kdecore/TIMEZONES:145 #, kde-format msgid "Buenos Aires (BA, CF)" msgstr "Bos Aires (BA, CF)" #. +> trunk5 #: kdecore/TIMEZONES:76 #, kde-format msgid "America/Argentina/Catamarca" msgstr "América/Arxentina/Catamarca" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:78 kdecore/TIMEZONES:81 kdecore/TIMEZONES:161 #, kde-format msgid "Catamarca (CT), Chubut (CH)" msgstr "Catamarca (CT), Chubut (CH)" #. +> trunk5 #: kdecore/TIMEZONES:79 #, kde-format msgid "America/Argentina/ComodRivadavia" msgstr "América/Arxentina/ComodRivadavia" #. +> trunk5 #: kdecore/TIMEZONES:82 #, kde-format msgid "America/Argentina/Cordoba" msgstr "América/Arxentina/Córdoba" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:84 kdecore/TIMEZONES:177 kdecore/TIMEZONES:419 #, kde-format msgid "most locations (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" msgstr "a maioría dos lugares (CB, CC, CN, ER, FM, LP, MN, NQ, RN, SA, SE, SF)" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:86 #, kde-format msgid "most locations (CB, CC, CN, ER, FM, MN, SE, SF)" msgstr "a maioría dos lugares (CB, CC, CN, ER, FM, MN, SE, SF)" #. +> trunk5 #: kdecore/TIMEZONES:87 #, kde-format msgid "America/Argentina/Jujuy" msgstr "América/Argentina/Xuxui" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:89 kdecore/TIMEZONES:285 #, kde-format msgid "Jujuy (JY)" msgstr "Jujuy (JY)" #. +> trunk5 #: kdecore/TIMEZONES:90 #, kde-format msgid "America/Argentina/La_Rioja" msgstr "America/Argentina/A_Rioxa" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:92 #, kde-format msgid "La Rioja (LR)" msgstr "A Rioxa (LR)" #. +> trunk5 #: kdecore/TIMEZONES:93 #, kde-format msgid "America/Argentina/Mendoza" msgstr "América/Arxentina/Mendoza" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:95 kdecore/TIMEZONES:325 #, kde-format msgid "Mendoza (MZ)" msgstr "Mendoza (MZ)" #. +> trunk5 #: kdecore/TIMEZONES:96 #, kde-format msgid "America/Argentina/Rio_Gallegos" msgstr "América/Arxentina/Río_Gallegos" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:98 #, kde-format msgid "Santa Cruz (SC)" msgstr "Santa Cruz (SC)" #. +> trunk5 #: kdecore/TIMEZONES:99 #, kde-format msgid "America/Argentina/Salta" msgstr "América/Arxentina/Salta" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:101 #, kde-format msgid "(SA, LP, NQ, RN)" msgstr "(SA, LP, NQ, RN)" #. +> trunk5 #: kdecore/TIMEZONES:102 #, kde-format msgid "America/Argentina/San_Juan" msgstr "América/Arxentina/San_Xoán" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:104 #, kde-format msgid "San Juan (SJ)" msgstr "San Xoán (SJ)" #. +> trunk5 #: kdecore/TIMEZONES:105 #, kde-format msgid "America/Argentina/San_Luis" msgstr "América/Arxentina/San_Luís" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:107 #, kde-format msgid "San Luis (SL)" msgstr "San Luís (SL)" #. +> trunk5 #: kdecore/TIMEZONES:108 #, kde-format msgid "America/Argentina/Tucuman" msgstr "América/Arxentina/Tucumán" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:110 #, kde-format msgid "Tucuman (TM)" msgstr "Tucumán (TM)" #. +> trunk5 #: kdecore/TIMEZONES:111 #, kde-format msgid "America/Argentina/Ushuaia" msgstr "América/Arxentina/Ushuaia" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:113 #, kde-format msgid "Tierra del Fuego (TF)" msgstr "Terra do fogo (TF)" #. +> trunk5 #: kdecore/TIMEZONES:114 #, kde-format msgid "America/Aruba" msgstr "América/Aruba" #. +> trunk5 #: kdecore/TIMEZONES:115 #, kde-format msgid "America/Asuncion" msgstr "América/Asunción" #. +> trunk5 #: kdecore/TIMEZONES:116 #, kde-format msgid "America/Atikokan" msgstr "América/Atikokan" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:118 kdecore/TIMEZONES:174 #, kde-format msgid "Eastern Standard Time - Atikokan, Ontario and Southampton I, Nunavut" msgstr "Hora estándar do leste: Atikokan, Ontario e Southampton I, Nunavut" #. +> trunk5 #: kdecore/TIMEZONES:119 #, kde-format msgid "America/Atka" msgstr "América/Atka" #. +> trunk5 #: kdecore/TIMEZONES:122 #, kde-format msgid "America/Bahia" msgstr "América/Bahía" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:124 #, kde-format msgid "Bahia" msgstr "Bahia" #. +> trunk5 #: kdecore/TIMEZONES:125 #, kde-format msgid "America/Bahia_Banderas" msgstr "América/Bahía_Banderas" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:127 #, kde-format msgid "Mexican Central Time - Bahia de Banderas" msgstr "Hora do centro de México - Bahía de Banderas" #. +> trunk5 #: kdecore/TIMEZONES:128 #, kde-format msgid "America/Barbados" msgstr "América/Barbados" #. +> trunk5 #: kdecore/TIMEZONES:129 #, kde-format msgid "America/Belem" msgstr "América/Belem" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:131 #, kde-format msgid "Amapa, E Para" msgstr "Amapa, E Para" #. +> trunk5 #: kdecore/TIMEZONES:132 #, kde-format msgid "America/Belize" msgstr "América/Belize" #. +> trunk5 #: kdecore/TIMEZONES:133 #, kde-format msgid "America/Blanc-Sablon" msgstr "América/Blanc-Sablon" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:135 #, kde-format msgid "Atlantic Standard Time - Quebec - Lower North Shore" msgstr "Hora estándar do atlántico, Quebec, costa norte inferior" #. +> trunk5 #: kdecore/TIMEZONES:136 #, kde-format msgid "America/Boa_Vista" msgstr "América/Boa Vista" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:138 #, kde-format msgid "Roraima" msgstr "Roraima" #. +> trunk5 #: kdecore/TIMEZONES:139 #, kde-format msgid "America/Bogota" msgstr "América/Bogotá" #. +> trunk5 #: kdecore/TIMEZONES:140 #, kde-format msgid "America/Boise" msgstr "América/Boise" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:142 #, kde-format msgid "Mountain Time - south Idaho & east Oregon" msgstr "Hora da montaña: sur de Idaho e leste de Oregón" #. +> trunk5 #: kdecore/TIMEZONES:143 #, kde-format msgid "America/Buenos_Aires" msgstr "América/Bos Aires" #. +> trunk5 #: kdecore/TIMEZONES:146 #, kde-format msgid "America/Calgary" msgstr "América/Calgary" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:148 kdecore/TIMEZONES:204 kdecore/TIMEZONES:824 #, kde-format msgid "Mountain Time - Alberta, east British Columbia & west Saskatchewan" -msgstr "Hora da montaña: Alberta, leste da Columbia Británica e oeste de Saskatchewan" +msgstr "" +"Hora da montaña: Alberta, leste da Columbia Británica e oeste de Saskatchewan" #. +> trunk5 #: kdecore/TIMEZONES:149 #, kde-format msgid "America/Cambridge_Bay" msgstr "América/Bahía de Cambridge" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:151 #, kde-format msgid "Mountain Time - west Nunavut" msgstr "Hora da montaña: oeste de Nunavut" #. +> trunk5 #: kdecore/TIMEZONES:152 #, kde-format msgid "America/Campo_Grande" msgstr "América/Campo Grande" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:154 #, kde-format msgid "Mato Grosso do Sul" msgstr "Mato Grosso do Sur" #. +> trunk5 #: kdecore/TIMEZONES:155 #, kde-format msgid "America/Cancun" msgstr "América/Cancún" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:157 #, kde-format msgid "Central Time - Quintana Roo" msgstr "Hora central: Quintana Roo" #. +> trunk5 #: kdecore/TIMEZONES:158 #, kde-format msgid "America/Caracas" msgstr "América/Caracas" #. +> trunk5 #: kdecore/TIMEZONES:159 #, kde-format msgid "America/Catamarca" msgstr "América/Catamarca" #. +> trunk5 #: kdecore/TIMEZONES:162 #, kde-format msgid "America/Cayenne" msgstr "América/Cayenne" #. +> trunk5 #: kdecore/TIMEZONES:163 #, kde-format msgid "America/Cayman" msgstr "América/Caimán" #. +> trunk5 #: kdecore/TIMEZONES:164 #, kde-format msgid "America/Chicago" msgstr "América/Chicago" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:166 kdecore/TIMEZONES:1074 #, kde-format msgid "Central Time" msgstr "Hora central" #. +> trunk5 #: kdecore/TIMEZONES:167 #, kde-format msgid "America/Chihuahua" msgstr "América/Chihuahua" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:169 #, kde-format msgid "Mountain Time - Chihuahua" msgstr "Hora da montaña: Chihuahua" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:171 #, kde-format msgid "Mexican Mountain Time - Chihuahua away from US border" msgstr "Hora da montaña de México - Chihuahua lonxe da fronteira cos USA" #. +> trunk5 #: kdecore/TIMEZONES:172 #, kde-format msgid "America/Coral_Harbour" msgstr "América/Coral Harbour" #. +> trunk5 #: kdecore/TIMEZONES:175 #, kde-format msgid "America/Cordoba" msgstr "América/Córdoba" #. +> trunk5 #: kdecore/TIMEZONES:178 #, kde-format msgid "America/Costa_Rica" msgstr "América/Costa Rica" #. +> trunk5 #: kdecore/TIMEZONES:179 #, kde-format msgid "America/Creston" msgstr "América/Creston" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:181 #, kde-format msgid "Mountain Standard Time - Creston, British Columbia" msgstr "Hora estándar da montaña - Creston, Columbia Británica" #. +> trunk5 #: kdecore/TIMEZONES:182 #, kde-format msgid "America/Cuiaba" msgstr "América/Cuiaba" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:184 #, kde-format msgid "Mato Grosso" msgstr "Mato Grosso" #. +> trunk5 #: kdecore/TIMEZONES:185 #, kde-format msgid "America/Curacao" msgstr "América/Curacao" #. +> trunk5 #: kdecore/TIMEZONES:186 #, kde-format msgid "America/Danmarkshavn" msgstr "América/Danmarkshavn" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:188 #, kde-format msgid "east coast, north of Scoresbysund" msgstr "costa leste, norte de Scorebysund" #. +> trunk5 #: kdecore/TIMEZONES:189 #, kde-format msgid "America/Dawson" msgstr "América/Dawson" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:191 #, kde-format msgid "Pacific Time - north Yukon" msgstr "Hora do Pacífico: norte do Yukon" #. +> trunk5 #: kdecore/TIMEZONES:192 #, kde-format msgid "America/Dawson_Creek" msgstr "América/Dawson Creek" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:194 #, kde-format -msgid "Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" -msgstr "Hora estándar da montaña: Dawson Creek e Fort Saint John, Columbia Británica" +msgid "" +"Mountain Standard Time - Dawson Creek & Fort Saint John, British Columbia" +msgstr "" +"Hora estándar da montaña: Dawson Creek e Fort Saint John, Columbia Británica" #. +> trunk5 #: kdecore/TIMEZONES:195 #, kde-format msgid "America/Denver" msgstr "América/Denver" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:197 kdecore/TIMEZONES:965 kdecore/TIMEZONES:1092 #, kde-format msgid "Mountain Time" msgstr "Hora da montaña" #. +> trunk5 #: kdecore/TIMEZONES:198 #, kde-format msgid "America/Detroit" msgstr "América/Detroit" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:200 kdecore/TIMEZONES:1089 #, kde-format msgid "Eastern Time - Michigan - most locations" msgstr "Hora do leste: Michigan, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:201 #, kde-format msgid "America/Dominica" msgstr "América/Dominica" #. +> trunk5 #: kdecore/TIMEZONES:202 #, kde-format msgid "America/Edmonton" msgstr "América/Edmonton" #. +> trunk5 #: kdecore/TIMEZONES:205 #, kde-format msgid "America/Eirunepe" msgstr "América/Eirunepe" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:207 #, kde-format msgid "W Amazonas" msgstr "Amazonas oeste" #. +> trunk5 #: kdecore/TIMEZONES:208 #, kde-format msgid "America/El_Salvador" msgstr "América/El Salvador" #. +> trunk5 #: kdecore/TIMEZONES:209 #, kde-format msgid "America/Ensenada" msgstr "América/Ensenada" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:211 kdecore/TIMEZONES:303 kdecore/TIMEZONES:465 #: kdecore/TIMEZONES:950 kdecore/TIMEZONES:1095 #, kde-format msgid "Pacific Time" msgstr "Hora do Pacífico" #. +> trunk5 #: kdecore/TIMEZONES:212 #, kde-format msgid "America/Fort_Wayne" msgstr "América/Forte_Wayne" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:214 kdecore/TIMEZONES:247 kdecore/TIMEZONES:275 #: kdecore/TIMEZONES:1077 #, kde-format msgid "Eastern Time - Indiana - most locations" msgstr "Hora do leste: Indiana, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:215 #, kde-format msgid "America/Fortaleza" msgstr "América/Fortaleza" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:217 #, kde-format msgid "NE Brazil (MA, PI, CE, RN, PB)" msgstr "NE Brazil (MA, PI, CE, RN, PB)" #. +> trunk5 #: kdecore/TIMEZONES:218 #, kde-format msgid "America/Fredericton" msgstr "América/Fredericton" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:220 kdecore/TIMEZONES:240 kdecore/TIMEZONES:812 #, kde-format msgid "Atlantic Time - Nova Scotia (most places), PEI" msgstr "Hora do atlántico: Nova Escocia (maioría dos lugares), PEI" #. +> trunk5 #: kdecore/TIMEZONES:221 #, kde-format msgid "America/Glace_Bay" msgstr "América/Bahía de Glace" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:223 #, kde-format msgid "Atlantic Time - Nova Scotia - places that did not observe DST 1966-1971" -msgstr "Hora do atlántico: Nova Escocia, lugares que non seguen o DST 1966-1971" +msgstr "" +"Hora do atlántico: Nova Escocia, lugares que non seguen o DST 1966-1971" #. +> trunk5 #: kdecore/TIMEZONES:224 #, kde-format msgid "America/Godthab" msgstr "América/Godthab" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:226 kdecore/TIMEZONES:428 kdecore/TIMEZONES:527 #: kdecore/TIMEZONES:691 kdecore/TIMEZONES:694 kdecore/TIMEZONES:839 #: kdecore/TIMEZONES:870 kdecore/TIMEZONES:959 kdecore/TIMEZONES:972 #: kdecore/TIMEZONES:1014 #, kde-format msgid "most locations" msgstr "maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:227 #, kde-format msgid "America/Goose_Bay" msgstr "América/Bahía de Goose" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:229 #, kde-format msgid "Atlantic Time - Labrador - most locations" msgstr "Hora do Atlántico: Labrador, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:230 #, kde-format msgid "America/Grand_Turk" msgstr "América/Grand Turk" #. +> trunk5 #: kdecore/TIMEZONES:231 #, kde-format msgid "America/Grenada" msgstr "América/Granada" #. +> trunk5 #: kdecore/TIMEZONES:232 #, kde-format msgid "America/Guadeloupe" msgstr "América/Guadalupe" #. +> trunk5 #: kdecore/TIMEZONES:233 #, kde-format msgid "America/Guatemala" msgstr "América/Guatemala" #. +> trunk5 #: kdecore/TIMEZONES:234 #, kde-format msgid "America/Guayaquil" msgstr "América/Guayaquil" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:236 kdecore/TIMEZONES:873 kdecore/TIMEZONES:879 #: kdecore/TIMEZONES:1058 #, kde-format msgid "mainland" msgstr "continental" #. +> trunk5 #: kdecore/TIMEZONES:237 #, kde-format msgid "America/Guyana" msgstr "América/Guiana" #. +> trunk5 #: kdecore/TIMEZONES:238 #, kde-format msgid "America/Halifax" msgstr "América/Halifax" #. +> trunk5 #: kdecore/TIMEZONES:241 #, kde-format msgid "America/Havana" msgstr "América/A Havana" #. +> trunk5 #: kdecore/TIMEZONES:242 #, kde-format msgid "America/Hermosillo" msgstr "América/Hermosillo" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:244 #, kde-format msgid "Mountain Standard Time - Sonora" msgstr "Hora estándar da montaña: Sonora" #. +> trunk5 #: kdecore/TIMEZONES:245 #, kde-format msgid "America/Indiana/Indianapolis" msgstr "América/Indiana/Indianápole" #. +> trunk5 #: kdecore/TIMEZONES:248 #, kde-format msgid "America/Indiana/Knox" msgstr "América/Indiana/Knox" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:250 kdecore/TIMEZONES:297 kdecore/TIMEZONES:1086 #, kde-format msgid "Eastern Time - Indiana - Starke County" msgstr "Hora do leste: Indiana, condado de Starke" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:252 #, kde-format msgid "Central Time - Indiana - Starke County" msgstr "Hora do centro: Indiana, condado de Starke" #. +> trunk5 #: kdecore/TIMEZONES:253 #, kde-format msgid "America/Indiana/Marengo" msgstr "América/Indiana/Marengo" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:255 #, kde-format msgid "Eastern Time - Indiana - Crawford County" msgstr "Hora do leste: Indiana, condado de Crawford" #. +> trunk5 #: kdecore/TIMEZONES:256 #, kde-format msgid "America/Indiana/Petersburg" msgstr "América/Indiana/Petersburg" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:258 #, kde-format msgid "Central Time - Indiana - Pike County" msgstr "Hora do centro: Indiana, condado de Pike" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:260 #, kde-format msgid "Eastern Time - Indiana - Pike County" msgstr "Hora do leste: Indiana, condado de Pike" #. +> trunk5 #: kdecore/TIMEZONES:261 #, kde-format msgid "America/Indiana/Tell_City" msgstr "América/Indiana/Tell_City" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:263 #, kde-format msgid "Central Time - Indiana - Perry County" msgstr "Hora do centro: Indiana, condado de Perry" #. +> trunk5 #: kdecore/TIMEZONES:264 #, kde-format msgid "America/Indiana/Vevay" msgstr "América/Indiana/Vevay" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:266 #, kde-format msgid "Eastern Time - Indiana - Switzerland County" msgstr "Hora do leste: Indiana, condado de Suíza" #. +> trunk5 #: kdecore/TIMEZONES:267 #, kde-format msgid "America/Indiana/Vincennes" msgstr "América/Indiana/Vicennes" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:269 #, kde-format msgid "Eastern Time - Indiana - Daviess, Dubois, Knox & Martin Counties" msgstr "Hora do leste: Indiana, condados de Daviess, Dubois, Knox e Martin" #. +> trunk5 #: kdecore/TIMEZONES:270 #, kde-format msgid "America/Indiana/Winamac" msgstr "América/Indiana/Winamac" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:272 #, kde-format msgid "Eastern Time - Indiana - Pulaski County" msgstr "Hora do leste: Indiana, condado de Pulaski" #. +> trunk5 #: kdecore/TIMEZONES:273 #, kde-format msgid "America/Indianapolis" msgstr "América/Indianápolis" #. +> trunk5 #: kdecore/TIMEZONES:276 #, kde-format msgid "America/Inuvik" msgstr "América/Inuvik" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:278 #, kde-format msgid "Mountain Time - west Northwest Territories" msgstr "Hora da montaña: oeste dos Territorios do Noroeste" #. +> trunk5 #: kdecore/TIMEZONES:279 #, kde-format msgid "America/Iqaluit" msgstr "América/Iqaluit" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:281 #, kde-format msgid "Eastern Time - east Nunavut - most locations" msgstr "Hora do leste: leste de Nunavut, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:282 #, kde-format msgid "America/Jamaica" msgstr "América/Xamaica" #. +> trunk5 #: kdecore/TIMEZONES:283 #, kde-format msgid "America/Jujuy" msgstr "América/Jujuy" #. +> trunk5 #: kdecore/TIMEZONES:286 #, kde-format msgid "America/Juneau" msgstr "América/Juneau" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:288 #, kde-format msgid "Alaska Time - Alaska panhandle" msgstr "Hora de Alaska: Alaska panhandle" #. +> trunk5 #: kdecore/TIMEZONES:289 #, kde-format msgid "America/Kentucky/Louisville" msgstr "América/Kentucky/Louisville" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:291 kdecore/TIMEZONES:306 #, kde-format msgid "Eastern Time - Kentucky - Louisville area" msgstr "Hora do leste: Kentucky, área de Louisville" #. +> trunk5 #: kdecore/TIMEZONES:292 #, kde-format msgid "America/Kentucky/Monticello" msgstr "América/Kentucky/Monticello" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:294 #, kde-format msgid "Eastern Time - Kentucky - Wayne County" msgstr "Hora do leste: Kentucky, condado de Wayne" #. +> trunk5 #: kdecore/TIMEZONES:295 #, kde-format msgid "America/Knox_IN" msgstr "América/Knox, Indiana" #. +> trunk5 #: kdecore/TIMEZONES:298 #, kde-format msgid "America/Kralendijk" msgstr "América/Kralendijk" #. +> trunk5 #: kdecore/TIMEZONES:299 #, kde-format msgid "America/La_Paz" msgstr "América/A Paz" #. +> trunk5 #: kdecore/TIMEZONES:300 #, kde-format msgid "America/Lima" msgstr "América/Lima" #. +> trunk5 #: kdecore/TIMEZONES:301 #, kde-format msgid "America/Los_Angeles" msgstr "América/Os Ánxeles" #. +> trunk5 #: kdecore/TIMEZONES:304 #, kde-format msgid "America/Louisville" msgstr "América/Louisville" #. +> trunk5 #: kdecore/TIMEZONES:307 #, kde-format msgid "America/Lower_Princes" msgstr "América/Lower_Princes" #. +> trunk5 #: kdecore/TIMEZONES:308 #, kde-format msgid "America/Maceio" msgstr "América/Maceio" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:310 #, kde-format msgid "Alagoas, Sergipe" msgstr "Alagoas, Sergipe" #. +> trunk5 #: kdecore/TIMEZONES:311 #, kde-format msgid "America/Managua" msgstr "América/Managua" #. +> trunk5 #: kdecore/TIMEZONES:312 #, kde-format msgid "America/Manaus" msgstr "América/Manaus" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:314 kdecore/TIMEZONES:809 #, kde-format msgid "E Amazonas" msgstr "E Amazonas" #. +> trunk5 #: kdecore/TIMEZONES:315 #, kde-format msgid "America/Marigot" msgstr "América/Marigot" #. +> trunk5 #: kdecore/TIMEZONES:316 #, kde-format msgid "America/Martinique" msgstr "América/Martinica" #. +> trunk5 #: kdecore/TIMEZONES:317 #, kde-format msgid "America/Matamoros" msgstr "América/Matamoros" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:319 #, kde-format -msgid "US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" +msgid "" +"US Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas near US border" msgstr "Hora do centro dos USA: Coahuila, Durango, Nuevo León, Tamaulipas" #. +> trunk5 #: kdecore/TIMEZONES:320 #, kde-format msgid "America/Mazatlan" msgstr "América/Mazatlan" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:322 kdecore/TIMEZONES:953 #, kde-format msgid "Mountain Time - S Baja, Nayarit, Sinaloa" msgstr "Hora da montaña, S Baja, Nayarit, Sinaloa" #. +> trunk5 #: kdecore/TIMEZONES:323 #, kde-format msgid "America/Mendoza" msgstr "América/Mendoza" #. +> trunk5 #: kdecore/TIMEZONES:326 #, kde-format msgid "America/Menominee" msgstr "América/Menominee" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:328 #, kde-format msgid "Central Time - Michigan - Dickinson, Gogebic, Iron & Menominee Counties" -msgstr "Hora do centro: Michigan, condados de Dickinson, Gogebic, Iron e Menominee" +msgstr "" +"Hora do centro: Michigan, condados de Dickinson, Gogebic, Iron e Menominee" #. +> trunk5 #: kdecore/TIMEZONES:329 #, kde-format msgid "America/Merida" msgstr "América/Mérida" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:331 #, kde-format msgid "Central Time - Campeche, Yucatan" msgstr "Hora do centro: Campeche, Yucatán" #. +> trunk5 #: kdecore/TIMEZONES:332 #, kde-format msgid "America/Metlakatla" msgstr "América/Metlakatla" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:334 #, kde-format msgid "Metlakatla Time - Annette Island" msgstr "Hora de Metlakatla: Illa de Annette" #. +> trunk5 #: kdecore/TIMEZONES:335 #, kde-format msgid "America/Mexico_City" msgstr "América/Cidade de México" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:337 kdecore/TIMEZONES:956 #, kde-format msgid "Central Time - most locations" msgstr "Hora do centro: maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:338 #, kde-format msgid "America/Miquelon" msgstr "América/Miguelón" #. +> trunk5 #: kdecore/TIMEZONES:339 #, kde-format msgid "America/Moncton" msgstr "América/Moncton" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:341 #, kde-format msgid "Atlantic Time - New Brunswick" msgstr "Hora do Atlántico: Nova Brunswick" #. +> trunk5 #: kdecore/TIMEZONES:342 #, kde-format msgid "America/Monterrey" msgstr "América/Monterrey" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:344 #, kde-format msgid "Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas" msgstr "Hora do centro: Coahuila, Durango, Nuevo León, Tamaulipas" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:346 #, kde-format -msgid "Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from US border" +msgid "" +"Mexican Central Time - Coahuila, Durango, Nuevo Leon, Tamaulipas away from US" +" border" msgstr "Hora do centro de México: Coahuila, Durango, Nuevo León, Tamaulipas" #. +> trunk5 #: kdecore/TIMEZONES:347 #, kde-format msgid "America/Montevideo" msgstr "América/Montevideo" #. +> trunk5 #: kdecore/TIMEZONES:348 #, kde-format msgid "America/Montreal" msgstr "América/Montreal" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:350 kdecore/TIMEZONES:379 #, kde-format msgid "Eastern Time - Quebec - most locations" msgstr "Hora do leste: Quebec, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:351 #, kde-format msgid "America/Montserrat" msgstr "América/Montserrat" #. +> trunk5 #: kdecore/TIMEZONES:352 #, kde-format msgid "America/Nassau" msgstr "América/Nassau" #. +> trunk5 #: kdecore/TIMEZONES:353 #, kde-format msgid "America/New_York" msgstr "América/Nova Iorque" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:355 kdecore/TIMEZONES:1080 #, kde-format msgid "Eastern Time" msgstr "Hora do leste" #. +> trunk5 #: kdecore/TIMEZONES:356 #, kde-format msgid "America/Nipigon" msgstr "América/Nipigon" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:358 #, kde-format -msgid "Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" -msgstr "Hora do leste: Ontario e Quebec, lugares que non seguen o DST 1967-1973" +msgid "" +"Eastern Time - Ontario & Quebec - places that did not observe DST 1967-1973" +msgstr "" +"Hora do leste: Ontario e Quebec, lugares que non seguen o DST 1967-1973" #. +> trunk5 #: kdecore/TIMEZONES:359 #, kde-format msgid "America/Nome" msgstr "América/Nome" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:361 #, kde-format msgid "Alaska Time - west Alaska" msgstr "Hora de Alaska: oeste de Alaska" #. +> trunk5 #: kdecore/TIMEZONES:362 #, kde-format msgid "America/Noronha" msgstr "América/Noronha" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:364 kdecore/TIMEZONES:803 #, kde-format msgid "Atlantic islands" msgstr "Illas atlánticas" #. +> trunk5 #: kdecore/TIMEZONES:365 #, kde-format msgid "America/North_Dakota/Beulah" msgstr "América/Dakota do Norte/Beulah" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:367 #, kde-format msgid "Central Time - North Dakota - Mercer County" msgstr "Hora do centro: Dakota do Norte, condado de Mercer" #. +> trunk5 #: kdecore/TIMEZONES:368 #, kde-format msgid "America/North_Dakota/Center" msgstr "América/Dakota do Norte/Centro" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:370 #, kde-format msgid "Central Time - North Dakota - Oliver County" msgstr "Hora do centro: Dakota do Norte, condado de Oliver" #. +> trunk5 #: kdecore/TIMEZONES:371 #, kde-format msgid "America/North_Dakota/New_Salem" msgstr "América/Dakota do Norte/Novo Salem" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:373 #, kde-format msgid "Central Time - North Dakota - Morton County (except Mandan area)" -msgstr "Hora do centro: Dakota do Norte, condado de Morton (excepto a área de Mandan)" +msgstr "" +"Hora do centro: Dakota do Norte, condado de Morton (excepto a área de Mandan)" #. +> trunk5 #: kdecore/TIMEZONES:374 #, kde-format msgid "America/Ojinaga" msgstr "América/Ojinaga" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:376 #, kde-format msgid "US Mountain Time - Chihuahua near US border" msgstr "Hora da montaña dos USA: Chihuahua preto da fronteira dos USA" #. +> trunk5 #: kdecore/TIMEZONES:377 #, kde-format msgid "America/Ontario" msgstr "América/Ontario" #. +> trunk5 #: kdecore/TIMEZONES:380 #, kde-format msgid "America/Panama" msgstr "América/Panamá" #. +> trunk5 #: kdecore/TIMEZONES:381 #, kde-format msgid "America/Pangnirtung" msgstr "América/Pangnirtung" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:383 #, kde-format msgid "Eastern Time - Pangnirtung, Nunavut" msgstr "Hora do leste: Pangnirtung, Nunavut" #. +> trunk5 #: kdecore/TIMEZONES:384 #, kde-format msgid "America/Paramaribo" msgstr "América/Paramaribo" #. +> trunk5 #: kdecore/TIMEZONES:385 #, kde-format msgid "America/Phoenix" msgstr "América/Phoenix" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:387 kdecore/TIMEZONES:1071 #, kde-format msgid "Mountain Standard Time - Arizona" msgstr "Hora estándar da montaña: Arizona" #. +> trunk5 #: kdecore/TIMEZONES:388 #, kde-format msgid "America/Port-au-Prince" msgstr "América/Porto Príncipe" #. +> trunk5 #: kdecore/TIMEZONES:389 #, kde-format msgid "America/Port_of_Spain" msgstr "América/Porto de España" #. +> trunk5 #: kdecore/TIMEZONES:390 #, kde-format msgid "America/Porto_Acre" msgstr "América/Porto Acre" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:392 kdecore/TIMEZONES:416 kdecore/TIMEZONES:800 #, kde-format msgid "Acre" msgstr "Acre" #. +> trunk5 #: kdecore/TIMEZONES:393 #, kde-format msgid "America/Porto_Velho" msgstr "América/Porto Vello" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:395 #, kde-format msgid "Rondonia" msgstr "Rondonia" #. +> trunk5 #: kdecore/TIMEZONES:396 #, kde-format msgid "America/Puerto_Rico" msgstr "América/Porto Rico" #. +> trunk5 #: kdecore/TIMEZONES:397 #, kde-format msgid "America/Rainy_River" msgstr "América/Rainy River" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:399 #, kde-format msgid "Central Time - Rainy River & Fort Frances, Ontario" msgstr "Hora do centro: Río Rainy e Forte Frances, Ontario" #. +> trunk5 #: kdecore/TIMEZONES:400 #, kde-format msgid "America/Rankin_Inlet" msgstr "América/Rankin Inlet" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:402 #, kde-format msgid "Central Time - central Nunavut" msgstr "Hora do centro: Nunavut central" #. +> trunk5 #: kdecore/TIMEZONES:403 #, kde-format msgid "America/Recife" msgstr "América/Recife" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:405 #, kde-format msgid "Pernambuco" msgstr "Pernambuco" #. +> trunk5 #: kdecore/TIMEZONES:406 #, kde-format msgid "America/Regina" msgstr "América/Regina" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:408 kdecore/TIMEZONES:435 kdecore/TIMEZONES:818 #: kdecore/TIMEZONES:833 #, kde-format msgid "Central Standard Time - Saskatchewan - most locations" msgstr "Hora estándar do centro: Saskatchewan, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:409 #, kde-format msgid "America/Resolute" msgstr "América/Resolute" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:411 #, kde-format msgid "Eastern Time - Resolute, Nunavut" msgstr "Hora do leste: Resolute, Nunavut" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:413 #, kde-format msgid "Central Standard Time - Resolute, Nunavut" msgstr "Hora do estándar do centro: Resolute, Nunavut" #. +> trunk5 #: kdecore/TIMEZONES:414 #, kde-format msgid "America/Rio_Branco" msgstr "América/Río Branco" #. +> trunk5 #: kdecore/TIMEZONES:417 #, kde-format msgid "America/Rosario" msgstr "América/Rosario" #. +> trunk5 #: kdecore/TIMEZONES:420 #, kde-format msgid "America/Santa_Isabel" msgstr "América/Santa_Isabel" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:422 #, kde-format msgid "Mexican Pacific Time - Baja California away from US border" msgstr "Hora do Pacífico de México: Baja California lonxe da fronteira cos USA" #. +> trunk5 #: kdecore/TIMEZONES:423 #, kde-format msgid "America/Santarem" msgstr "América/Santarem" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:425 #, kde-format msgid "W Para" msgstr "W Para" #. +> trunk5 #: kdecore/TIMEZONES:426 #, kde-format msgid "America/Santiago" msgstr "América/Santiago" #. +> trunk5 #: kdecore/TIMEZONES:429 #, kde-format msgid "America/Santo_Domingo" msgstr "América/Santo Domingo" #. +> trunk5 #: kdecore/TIMEZONES:430 #, kde-format msgid "America/Sao_Paulo" msgstr "América/Sao Paulo" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:432 kdecore/TIMEZONES:806 #, kde-format msgid "S & SE Brazil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" msgstr "S e SE do Brasil (GO, DF, MG, ES, RJ, SP, PR, SC, RS)" #. +> trunk5 #: kdecore/TIMEZONES:433 #, kde-format msgid "America/Saskatoon" msgstr "América/Saskatoon" #. +> trunk5 #: kdecore/TIMEZONES:436 #, kde-format msgid "America/Scoresbysund" msgstr "América/Scoresbysund" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:438 #, kde-format msgid "Scoresbysund / Ittoqqortoormiit" msgstr "Scoresbysund / Ittoqqortoormiit" #. +> trunk5 #: kdecore/TIMEZONES:439 #, kde-format msgid "America/Shiprock" msgstr "América/Shiprock" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:441 #, kde-format msgid "Mountain Time - Navajo" msgstr "Hora da montaña: Navajo" #. +> trunk5 #: kdecore/TIMEZONES:442 #, kde-format msgid "America/Sitka" msgstr "América/Sitka" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:444 #, kde-format msgid "Alaska Time - southeast Alaska panhandle" msgstr "Hora de Alaska: Alaska panhandle sueste" #. +> trunk5 #: kdecore/TIMEZONES:445 #, kde-format msgid "America/St_Barthelemy" msgstr "America/Saint Barthelemy" #. +> trunk5 #: kdecore/TIMEZONES:446 #, kde-format msgid "America/St_Johns" msgstr "América/San Xoán" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:448 kdecore/TIMEZONES:827 #, kde-format msgid "Newfoundland Time, including SE Labrador" msgstr "Hora da Terra Nova, incluído o SE do Labrador" #. +> trunk5 #: kdecore/TIMEZONES:449 #, kde-format msgid "America/St_Kitts" msgstr "América/Saint Kitts" #. +> trunk5 #: kdecore/TIMEZONES:450 #, kde-format msgid "America/St_Lucia" msgstr "América/Santa Lucia" #. +> trunk5 #: kdecore/TIMEZONES:451 #, kde-format msgid "America/St_Thomas" msgstr "América/Santo Tomás" #. +> trunk5 #: kdecore/TIMEZONES:452 #, kde-format msgid "America/St_Vincent" msgstr "América/San Vicente" #. +> trunk5 #: kdecore/TIMEZONES:453 #, kde-format msgid "America/Swift_Current" msgstr "América/Swift Current" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:455 #, kde-format msgid "Central Standard Time - Saskatchewan - midwest" msgstr "Hora estándar do centro: medio-oeste de Saskatchewan" #. +> trunk5 #: kdecore/TIMEZONES:456 #, kde-format msgid "America/Tegucigalpa" msgstr "América/Tegucigalpa" #. +> trunk5 #: kdecore/TIMEZONES:457 #, kde-format msgid "America/Thule" msgstr "América/Thule" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:459 #, kde-format msgid "Thule / Pituffik" msgstr "Thule / Pituffik" #. +> trunk5 #: kdecore/TIMEZONES:460 #, kde-format msgid "America/Thunder_Bay" msgstr "América/Thunder Bay" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:462 #, kde-format msgid "Eastern Time - Thunder Bay, Ontario" msgstr "Hora do leste: Bahía de Thunder, Ontario" #. +> trunk5 #: kdecore/TIMEZONES:463 #, kde-format msgid "America/Tijuana" msgstr "América/Tijuana" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:467 #, kde-format msgid "US Pacific Time - Baja California near US border" msgstr "Hora do Pacífico dos USA: Baja California preto da fronteira cos USA" #. +> trunk5 #: kdecore/TIMEZONES:468 #, kde-format msgid "America/Toronto" msgstr "América/Toronto" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:470 kdecore/TIMEZONES:821 #, kde-format msgid "Eastern Time - Ontario - most locations" msgstr "Hora do leste: Ontario, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:471 #, kde-format msgid "America/Tortola" msgstr "América/Tórtola" #. +> trunk5 #: kdecore/TIMEZONES:472 #, kde-format msgid "America/Vancouver" msgstr "América/Vancouver" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:474 kdecore/TIMEZONES:830 #, kde-format msgid "Pacific Time - west British Columbia" msgstr "Hora do Pacífico: oeste da Columbia Británica" #. +> trunk5 #: kdecore/TIMEZONES:475 #, kde-format msgid "America/Virgin" msgstr "América/Virxinia" #. +> trunk5 #: kdecore/TIMEZONES:476 #, kde-format msgid "America/Whitehorse" msgstr "América/Whitehorse" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:478 kdecore/TIMEZONES:836 #, kde-format msgid "Pacific Time - south Yukon" msgstr "Hora do Pacífico: sur do Yukon" #. +> trunk5 #: kdecore/TIMEZONES:479 #, kde-format msgid "America/Winnipeg" msgstr "América/Winnipeg" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:481 kdecore/TIMEZONES:815 #, kde-format msgid "Central Time - Manitoba & west Ontario" msgstr "Hora do centro: Manitoba e oeste de Ontario" #. +> trunk5 #: kdecore/TIMEZONES:482 #, kde-format msgid "America/Yakutat" msgstr "América/Yakutat" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:484 #, kde-format msgid "Alaska Time - Alaska panhandle neck" msgstr "Hora de Alaske: pescozo do Alaska panhandle" #. +> trunk5 #: kdecore/TIMEZONES:485 #, kde-format msgid "America/Yellowknife" msgstr "América/Yellowknife" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:487 #, kde-format msgid "Mountain Time - central Northwest Territories" msgstr "Hora da montaña: centro dos Territorios do Noroeste" #. +> trunk5 #: kdecore/TIMEZONES:488 #, kde-format msgid "Antarctica/Casey" msgstr "Antártida/Casey" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:490 #, kde-format msgid "Casey Station, Bailey Peninsula" msgstr "Casey Station, península de Bailey" #. +> trunk5 #: kdecore/TIMEZONES:491 #, kde-format msgid "Antarctica/Davis" msgstr "Antártida/Davis" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:493 #, kde-format msgid "Davis Station, Vestfold Hills" msgstr "Davis Station, Vestfold Hills" #. +> trunk5 #: kdecore/TIMEZONES:494 #, kde-format msgid "Antarctica/DumontDUrville" msgstr "Antártida/Dumont D'Urville" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:496 #, kde-format msgid "Dumont-d'Urville Station, Terre Adelie" msgstr "Estación Dumont-d'Urville, Terra Adelia" #. +> trunk5 #: kdecore/TIMEZONES:497 #, kde-format msgid "Antarctica/Macquarie" msgstr "Antártida/Macquarie" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:499 #, kde-format msgid "Macquarie Island Station, Macquarie Island" msgstr "Estación da illa de Macquarie, Illa de Macquarie" #. +> trunk5 #: kdecore/TIMEZONES:500 #, kde-format msgid "Antarctica/Mawson" msgstr "Antártida/Mawson" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:502 #, kde-format msgid "Mawson Station, Holme Bay" msgstr "Estación Mawson, Bahía de Holme" #. +> trunk5 #: kdecore/TIMEZONES:503 #, kde-format msgid "Antarctica/McMurdo" msgstr "Antártida/McMurdo" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:505 #, kde-format msgid "McMurdo Station, Ross Island" msgstr "Estación McMurdo, Illa de Ross" #. +> trunk5 #: kdecore/TIMEZONES:506 #, kde-format msgid "Antarctica/Palmer" msgstr "Antártida/Palmer" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:508 #, kde-format msgid "Palmer Station, Anvers Island" msgstr "Estación Palmer, Illa de Anvers" #. +> trunk5 #: kdecore/TIMEZONES:509 #, kde-format msgid "Antarctica/Rothera" msgstr "Antártida/Rothera" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:511 #, kde-format msgid "Rothera Station, Adelaide Island" msgstr "Estación Rothera, Illa de Adelaida" #. +> trunk5 #: kdecore/TIMEZONES:512 #, kde-format msgid "Antarctica/South_Pole" msgstr "Antártida/Polo Sur" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:514 #, kde-format msgid "Amundsen-Scott Station, South Pole" msgstr "Estación Amundsen-Scott, Polo Sur" #. +> trunk5 #: kdecore/TIMEZONES:515 #, kde-format msgid "Antarctica/Syowa" msgstr "Antártida/Syowa" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:517 #, kde-format msgid "Syowa Station, E Ongul I" msgstr "Estación Syowa, Illa do leste de Ongul" #. +> trunk5 #: kdecore/TIMEZONES:518 #, kde-format msgid "Antarctica/Vostok" msgstr "Antártida/Vostok" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:520 #, kde-format msgid "Vostok Station, S Magnetic Pole" msgstr "Estación Vostok, Polo Sur Magnético" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:522 #, kde-format msgid "Vostok Station, Lake Vostok" msgstr "Estación Vostok, lago Vostok" #. +> trunk5 #: kdecore/TIMEZONES:523 #, kde-format msgid "Arctic/Longyearbyen" msgstr "Ártico/Longyearbyen" #. +> trunk5 #: kdecore/TIMEZONES:524 #, kde-format msgid "Asia/Aden" msgstr "Asia/Aden" #. +> trunk5 #: kdecore/TIMEZONES:525 #, kde-format msgid "Asia/Almaty" msgstr "Asia/Almaty" #. +> trunk5 #: kdecore/TIMEZONES:528 #, kde-format msgid "Asia/Amman" msgstr "Asia/Amán" #. +> trunk5 #: kdecore/TIMEZONES:529 #, kde-format msgid "Asia/Anadyr" msgstr "Asia/Anadyr" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:531 #, kde-format msgid "Moscow+10 - Bering Sea" msgstr "Moscova+10, mar de Bering" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:533 #, kde-format msgid "Moscow+08 - Bering Sea" msgstr "Moscova+08, mar de Bering" #. +> trunk5 #: kdecore/TIMEZONES:534 #, kde-format msgid "Asia/Aqtau" msgstr "Asia/Aqtau" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:536 #, kde-format msgid "Atyrau (Atirau, Gur'yev), Mangghystau (Mankistau)" msgstr "Atirau (Atirau, Gur'yev), Mangghystau (Mankistau)" #. +> trunk5 #: kdecore/TIMEZONES:537 #, kde-format msgid "Asia/Aqtobe" msgstr "Asia/Aqtobe" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:539 #, kde-format msgid "Aqtobe (Aktobe)" msgstr "Aqtobe (Aktobe)" #. +> trunk5 #: kdecore/TIMEZONES:540 #, kde-format msgid "Asia/Ashgabat" msgstr "Asia/Ashgabat" #. +> trunk5 #: kdecore/TIMEZONES:541 #, kde-format msgid "Asia/Ashkhabad" msgstr "Asia/Ashkhabad" #. +> trunk5 #: kdecore/TIMEZONES:542 #, kde-format msgid "Asia/Baghdad" msgstr "Asia/Bagdad" #. +> trunk5 #: kdecore/TIMEZONES:543 #, kde-format msgid "Asia/Bahrain" msgstr "Asia/Barein" #. +> trunk5 #: kdecore/TIMEZONES:544 #, kde-format msgid "Asia/Baku" msgstr "Asia/Baku" #. +> trunk5 #: kdecore/TIMEZONES:545 #, kde-format msgid "Asia/Bangkok" msgstr "Asia/Bangkok" #. +> trunk5 #: kdecore/TIMEZONES:546 #, kde-format msgid "Asia/Beijing" msgstr "Asia/Pequín" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:548 kdecore/TIMEZONES:672 kdecore/TIMEZONES:968 #, kde-format msgid "east China - Beijing, Guangdong, Shanghai, etc." msgstr "leste da China: Pequin, Guangdong, Shangai etc." #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:550 #, kde-format msgid "China Standard Time" msgstr "Hora estándar da China" #. +> trunk5 #: kdecore/TIMEZONES:551 #, kde-format msgid "Asia/Beirut" msgstr "Asia/Beirut" #. +> trunk5 #: kdecore/TIMEZONES:552 #, kde-format msgid "Asia/Bishkek" msgstr "Asia/Bishkek" #. +> trunk5 #: kdecore/TIMEZONES:553 #, kde-format msgid "Asia/Brunei" msgstr "Asia/Brunei" #. +> trunk5 #: kdecore/TIMEZONES:554 #, kde-format msgid "Asia/Calcutta" msgstr "Asia/Calcuta" #. +> trunk5 #: kdecore/TIMEZONES:555 #, kde-format msgid "Asia/Choibalsan" msgstr "Asia/Choibalsan" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:557 #, kde-format msgid "Dornod, Sukhbaatar" msgstr "Dornod, Sukhbaatar" #. +> trunk5 #: kdecore/TIMEZONES:558 #, kde-format msgid "Asia/Chongqing" msgstr "Asia/Chogqing" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:560 kdecore/TIMEZONES:565 #, kde-format msgid "central China - Sichuan, Yunnan, Guangxi, Shaanxi, Guizhou, etc." msgstr "centro da China: Sichuán, Yunnan, Guangxi, Shaanxi, Guizhou etc." #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:562 #, kde-format msgid "China mountains" msgstr "Montañas da China" #. +> trunk5 #: kdecore/TIMEZONES:563 #, kde-format msgid "Asia/Chungking" msgstr "Asia/Chungking" #. +> trunk5 #: kdecore/TIMEZONES:566 #, kde-format msgid "Asia/Colombo" msgstr "Asia/Colombo" #. +> trunk5 #: kdecore/TIMEZONES:567 #, kde-format msgid "Asia/Dacca" msgstr "Asia/Dacca" #. +> trunk5 #: kdecore/TIMEZONES:568 #, kde-format msgid "Asia/Damascus" msgstr "Asia/Damasco" #. +> trunk5 #: kdecore/TIMEZONES:569 #, kde-format msgid "Asia/Dhaka" msgstr "Asia/Dhaka" #. +> trunk5 #: kdecore/TIMEZONES:570 #, kde-format msgid "Asia/Dili" msgstr "Asia/Dili" #. +> trunk5 #: kdecore/TIMEZONES:571 #, kde-format msgid "Asia/Dubai" msgstr "Asia/Dubai" #. +> trunk5 #: kdecore/TIMEZONES:572 #, kde-format msgid "Asia/Dushanbe" msgstr "Asia/Dushanbe" #. +> trunk5 #: kdecore/TIMEZONES:573 #, kde-format msgid "Asia/Gaza" msgstr "Asia/Gaza" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:575 #, kde-format msgid "Gaza Strip" msgstr "Franxa de Gaxa" #. +> trunk5 #: kdecore/TIMEZONES:576 #, kde-format msgid "Asia/Harbin" msgstr "Asia/Harbin" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:578 #, kde-format msgid "Heilongjiang (except Mohe), Jilin" msgstr "Heilongjiang (excepto Mohe), Jilin" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:580 #, kde-format msgid "China north" msgstr "Norte da China" #. +> trunk5 #: kdecore/TIMEZONES:581 #, kde-format msgid "Asia/Hebron" msgstr "Asia/Hebrón" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:583 #, kde-format msgid "West Bank" msgstr "Cisxordania" #. +> trunk5 #: kdecore/TIMEZONES:584 #, kde-format msgid "Asia/Ho_Chi_Minh" msgstr "Asia/Ho Chi Minh" #. +> trunk5 #: kdecore/TIMEZONES:585 #, kde-format msgid "Asia/Hong_Kong" msgstr "Asia/Hong Kong" #. +> trunk5 #: kdecore/TIMEZONES:586 #, kde-format msgid "Asia/Hovd" msgstr "Asia/Hovd" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:588 #, kde-format msgid "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" msgstr "Bayan-Olgiy, Govi-Altai, Hovd, Uvs, Zavkhan" #. +> trunk5 #: kdecore/TIMEZONES:589 #, kde-format msgid "Asia/Irkutsk" msgstr "Asia/Irkutsk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:591 #, kde-format msgid "Moscow+05 - Lake Baikal" msgstr "Moscova+05: Lago Baikal" #. +> trunk5 #: kdecore/TIMEZONES:592 #, kde-format msgid "Asia/Jakarta" msgstr "Asia/Xacarta" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:594 #, kde-format msgid "Java & Sumatra" msgstr "Xava e Sumatra" #. +> trunk5 #: kdecore/TIMEZONES:595 #, kde-format msgid "Asia/Jayapura" msgstr "Asia/Jayapura" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:597 #, kde-format msgid "Irian Jaya & the Moluccas" msgstr "Irian Jaya e as Molucas" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:599 #, kde-format msgid "west New Guinea (Irian Jaya) & Malukus (Moluccas)" msgstr "Oeste de Nova Guinea (Irian Jaya) e as Molucas" #. +> trunk5 #: kdecore/TIMEZONES:600 #, kde-format msgid "Asia/Jerusalem" msgstr "Asia/Xerusalén" #. +> trunk5 #: kdecore/TIMEZONES:601 #, kde-format msgid "Asia/Kabul" msgstr "Asia/Kabul" #. +> trunk5 #: kdecore/TIMEZONES:602 #, kde-format msgid "Asia/Kamchatka" msgstr "Asia/Kamchatka" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:604 #, kde-format msgid "Moscow+09 - Kamchatka" msgstr "Moscova+09: Kamchatka" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:606 #, kde-format msgid "Moscow+08 - Kamchatka" msgstr "Moscova+08: Kamchatka" #. +> trunk5 #: kdecore/TIMEZONES:607 #, kde-format msgid "Asia/Karachi" msgstr "Asia/Karachi" #. +> trunk5 #: kdecore/TIMEZONES:608 #, kde-format msgid "Asia/Kashgar" msgstr "Asia/Kashgar" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:610 #, kde-format msgid "west Tibet & Xinjiang" msgstr "oeste do Tíbet e Xinjiang" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:612 #, kde-format msgid "China west Xinjiang" msgstr "China: Xinjiang occidental" #. +> trunk5 #: kdecore/TIMEZONES:613 #, kde-format msgid "Asia/Kathmandu" msgstr "Asia/Katmandú" #. +> trunk5 #: kdecore/TIMEZONES:614 #, kde-format msgid "Asia/Katmandu" msgstr "Asia/Katmandú" #. +> trunk5 #: kdecore/TIMEZONES:615 #, kde-format msgid "Asia/Kolkata" msgstr "Asia/Kolkata" #. +> trunk5 #: kdecore/TIMEZONES:616 #, kde-format msgid "Asia/Krasnoyarsk" msgstr "Asia/Krasnoyarsk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:618 #, kde-format msgid "Moscow+04 - Yenisei River" msgstr "Moscova+04: río Yenisei" #. +> trunk5 #: kdecore/TIMEZONES:619 #, kde-format msgid "Asia/Kuala_Lumpur" msgstr "Asia/Kuala Lumpur" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:621 #, kde-format msgid "peninsular Malaysia" msgstr "Malaisia peninsular" #. +> trunk5 #: kdecore/TIMEZONES:622 #, kde-format msgid "Asia/Kuching" msgstr "Asia/Kuching" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:624 #, kde-format msgid "Sabah & Sarawak" msgstr "Sabah e Sarawak" #. +> trunk5 #: kdecore/TIMEZONES:625 #, kde-format msgid "Asia/Kuwait" msgstr "Asia/Kuwait" #. +> trunk5 #: kdecore/TIMEZONES:626 #, kde-format msgid "Asia/Macao" msgstr "Asia/Macau" #. +> trunk5 #: kdecore/TIMEZONES:627 #, kde-format msgid "Asia/Macau" msgstr "Asia/Macau" #. +> trunk5 #: kdecore/TIMEZONES:628 #, kde-format msgid "Asia/Magadan" msgstr "Asia/Magadán" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:630 #, kde-format msgid "Moscow+08 - Magadan" msgstr "Moscova+08: Magadán" #. +> trunk5 #: kdecore/TIMEZONES:631 #, kde-format msgid "Asia/Makassar" msgstr "Asia/Makassar" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:633 kdecore/TIMEZONES:688 #, kde-format msgid "east & south Borneo, Celebes, Bali, Nusa Tenggara, west Timor" msgstr "leste e sur de Borneo, illas Célebes, Bali, Nusa Tengarra, Timor-oeste" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:635 #, kde-format -msgid "east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" -msgstr "leste e sur de Borneo, Sulawesi (illas Célebes), Bali, Nusa Tengarra, Timor-oeste" +msgid "" +"east & south Borneo, Sulawesi (Celebes), Bali, Nusa Tenggara, west Timor" +msgstr "" +"leste e sur de Borneo, Sulawesi (illas Célebes), Bali, Nusa Tengarra," +" Timor-oeste" #. +> trunk5 #: kdecore/TIMEZONES:636 #, kde-format msgid "Asia/Manila" msgstr "Asia/Manila" #. +> trunk5 #: kdecore/TIMEZONES:637 #, kde-format msgid "Asia/Muscat" msgstr "Asia/Muscat" #. +> trunk5 #: kdecore/TIMEZONES:638 #, kde-format msgid "Asia/Nicosia" msgstr "Asia/Nicosia" #. +> trunk5 #: kdecore/TIMEZONES:639 #, kde-format msgid "Asia/Novokuznetsk" msgstr "Asia/Novokuznetsk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:641 #, kde-format msgid "Moscow+03 - Novokuznetsk" msgstr "Moscova+03 - Novokuznetsk" #. +> trunk5 #: kdecore/TIMEZONES:642 #, kde-format msgid "Asia/Novosibirsk" msgstr "Asia/Novosibirsk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:644 #, kde-format msgid "Moscow+03 - Novosibirsk" msgstr "Moscova+03: Novosibirsk" #. +> trunk5 #: kdecore/TIMEZONES:645 #, kde-format msgid "Asia/Omsk" msgstr "Asia/Omsk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:647 #, kde-format msgid "Moscow+03 - west Siberia" msgstr "Moscova+03 - oeste de Siberia" #. +> trunk5 #: kdecore/TIMEZONES:648 #, kde-format msgid "Asia/Oral" msgstr "Asia/Oral" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:650 #, kde-format msgid "West Kazakhstan" msgstr "Casaquistán oeste" #. +> trunk5 #: kdecore/TIMEZONES:651 #, kde-format msgid "Asia/Phnom_Penh" msgstr "Asia/Phnom Penh" #. +> trunk5 #: kdecore/TIMEZONES:652 #, kde-format msgid "Asia/Pontianak" msgstr "Asia/Pontianak" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:654 #, kde-format msgid "west & central Borneo" msgstr "Borneo central e oeste" #. +> trunk5 #: kdecore/TIMEZONES:655 #, kde-format msgid "Asia/Pyongyang" msgstr "Asia/Pyongyang" #. +> trunk5 #: kdecore/TIMEZONES:656 #, kde-format msgid "Asia/Qatar" msgstr "Asia/Qatar" #. +> trunk5 #: kdecore/TIMEZONES:657 #, kde-format msgid "Asia/Qyzylorda" msgstr "Asia/Qyzylorda" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:659 #, kde-format msgid "Qyzylorda (Kyzylorda, Kzyl-Orda)" msgstr "Qyzylorda (Kyzylorda, Kzyl-Orda)" #. +> trunk5 #: kdecore/TIMEZONES:660 #, kde-format msgid "Asia/Rangoon" msgstr "Asia/Rangún" #. +> trunk5 #: kdecore/TIMEZONES:661 #, kde-format msgid "Asia/Riyadh" msgstr "Asia/Riyadh" #. +> trunk5 #: kdecore/TIMEZONES:662 #, kde-format msgid "Asia/Saigon" msgstr "Asia/Saigón" #. +> trunk5 #: kdecore/TIMEZONES:663 #, kde-format msgid "Asia/Sakhalin" msgstr "Asia/Sakhalin" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:665 #, kde-format msgid "Moscow+07 - Sakhalin Island" msgstr "Moscova+07: illa Sahalin" #. +> trunk5 #: kdecore/TIMEZONES:666 #, kde-format msgid "Asia/Samarkand" msgstr "Asia/Samarcanda" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:668 #, kde-format msgid "west Uzbekistan" msgstr "oeste de Uzbequistán" #. +> trunk5 #: kdecore/TIMEZONES:669 #, kde-format msgid "Asia/Seoul" msgstr "Asia/Seúl" #. +> trunk5 #: kdecore/TIMEZONES:670 #, kde-format msgid "Asia/Shanghai" msgstr "Asia/Shanghai" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:674 #, kde-format msgid "China east" msgstr "China oriental" #. +> trunk5 #: kdecore/TIMEZONES:675 #, kde-format msgid "Asia/Singapore" msgstr "Asia/Singapur" #. +> trunk5 #: kdecore/TIMEZONES:676 #, kde-format msgid "Asia/Taipei" msgstr "Asia/Taipei" #. +> trunk5 #: kdecore/TIMEZONES:677 #, kde-format msgid "Asia/Tashkent" msgstr "Asia/Tashkent" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:679 #, kde-format msgid "east Uzbekistan" msgstr "leste de Uzbequistán" #. +> trunk5 #: kdecore/TIMEZONES:680 #, kde-format msgid "Asia/Tbilisi" msgstr "Asia/Tbilisi" #. +> trunk5 #: kdecore/TIMEZONES:681 #, kde-format msgid "Asia/Tehran" msgstr "Asia/Teherán" #. +> trunk5 #: kdecore/TIMEZONES:682 #, kde-format msgid "Asia/Tel_Aviv" msgstr "Asia/Tel Aviv" #. +> trunk5 #: kdecore/TIMEZONES:683 #, kde-format msgid "Asia/Thimbu" msgstr "Asia/Thimbu" #. +> trunk5 #: kdecore/TIMEZONES:684 #, kde-format msgid "Asia/Thimphu" msgstr "Asia/Thimphu" #. +> trunk5 #: kdecore/TIMEZONES:685 #, kde-format msgid "Asia/Tokyo" msgstr "Asia/Toquio" #. +> trunk5 #: kdecore/TIMEZONES:686 #, kde-format msgid "Asia/Ujung_Pandang" msgstr "Asia/Ujung Pandang" #. +> trunk5 #: kdecore/TIMEZONES:689 #, kde-format msgid "Asia/Ulaanbaatar" msgstr "Asia/Ulán batar" #. +> trunk5 #: kdecore/TIMEZONES:692 #, kde-format msgid "Asia/Ulan_Bator" msgstr "Asia/Ulán Bator" #. +> trunk5 #: kdecore/TIMEZONES:695 #, kde-format msgid "Asia/Urumqi" msgstr "Asia/Urunqui" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:697 #, kde-format msgid "most of Tibet & Xinjiang" msgstr "maioría do Tíbet e Xinjiang" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:699 #, kde-format msgid "China Xinjiang-Tibet" msgstr "China Xinjiang-Tibet" #. +> trunk5 #: kdecore/TIMEZONES:700 #, kde-format msgid "Asia/Vientiane" msgstr "Asia/Vientiane" #. +> trunk5 #: kdecore/TIMEZONES:701 #, kde-format msgid "Asia/Vladivostok" msgstr "Asia/Vladivostok" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:703 #, kde-format msgid "Moscow+07 - Amur River" msgstr "Moscova+07: río Amur" #. +> trunk5 #: kdecore/TIMEZONES:704 #, kde-format msgid "Asia/Yakutsk" msgstr "Asia/Yakutsk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:706 #, kde-format msgid "Moscow+06 - Lena River" msgstr "Moscova+06: río Lena" #. +> trunk5 #: kdecore/TIMEZONES:707 #, kde-format msgid "Asia/Yekaterinburg" msgstr "Asia/Yekaterinburg" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:709 #, kde-format msgid "Moscow+02 - Urals" msgstr "Moscova+02: Os Urais" #. +> trunk5 #: kdecore/TIMEZONES:710 #, kde-format msgid "Asia/Yerevan" msgstr "Asia/Yerevan" #. +> trunk5 #: kdecore/TIMEZONES:711 #, kde-format msgid "Atlantic/Azores" msgstr "Atlántico/Azores" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:713 #, kde-format msgid "Azores" msgstr "Azores" #. +> trunk5 #: kdecore/TIMEZONES:714 #, kde-format msgid "Atlantic/Bermuda" msgstr "Atlántico/Bermuda" #. +> trunk5 #: kdecore/TIMEZONES:715 #, kde-format msgid "Atlantic/Canary" msgstr "Atlántico/Canarias" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:717 #, kde-format msgid "Canary Islands" msgstr "Illas Canarias" #. +> trunk5 #: kdecore/TIMEZONES:718 #, kde-format msgid "Atlantic/Cape_Verde" msgstr "Atlántico/Cabo_Verde" #. +> trunk5 #: kdecore/TIMEZONES:719 #, kde-format msgid "Atlantic/Faeroe" msgstr "Atlántico/Illas Feroe" #. +> trunk5 #: kdecore/TIMEZONES:720 #, kde-format msgid "Atlantic/Faroe" msgstr "Atlántico/Illas Feroe" #. +> trunk5 #: kdecore/TIMEZONES:721 #, kde-format msgid "Atlantic/Jan_Mayen" msgstr "Atlántico/Illa Jan Mayen" #. +> trunk5 #: kdecore/TIMEZONES:722 #, kde-format msgid "Atlantic/Madeira" msgstr "Atlántico/Madeira" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:724 #, kde-format msgid "Madeira Islands" msgstr "Illas de Madeira" #. +> trunk5 #: kdecore/TIMEZONES:725 #, kde-format msgid "Atlantic/Reykjavik" msgstr "Atlántico/Reikiavik" #. +> trunk5 #: kdecore/TIMEZONES:726 #, kde-format msgid "Atlantic/South_Georgia" msgstr "Atlántico/Xeorxia do Sur" #. +> trunk5 #: kdecore/TIMEZONES:727 #, kde-format msgid "Atlantic/St_Helena" msgstr "Atlántico/Illa Santa Helena" #. +> trunk5 #: kdecore/TIMEZONES:728 #, kde-format msgid "Atlantic/Stanley" msgstr "Atlántico/Stanley" #. +> trunk5 #: kdecore/TIMEZONES:729 #, kde-format msgid "Australia/ACT" msgstr "Australia/ACT" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:731 kdecore/TIMEZONES:743 kdecore/TIMEZONES:770 #: kdecore/TIMEZONES:785 #, kde-format msgid "New South Wales - most locations" msgstr "Nova Gales do Sur, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:732 #, kde-format msgid "Australia/Adelaide" msgstr "Australia/Adelaida" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:734 kdecore/TIMEZONES:782 #, kde-format msgid "South Australia" msgstr "Sur de Australia" #. +> trunk5 #: kdecore/TIMEZONES:735 #, kde-format msgid "Australia/Brisbane" msgstr "Australia/Brisbane" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:737 kdecore/TIMEZONES:779 #, kde-format msgid "Queensland - most locations" msgstr "Queensland, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:738 #, kde-format msgid "Australia/Broken_Hill" msgstr "Australia/Broken Hill" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:740 kdecore/TIMEZONES:797 #, kde-format msgid "New South Wales - Yancowinna" msgstr "Nova Gales do Sur, Yancowinna" #. +> trunk5 #: kdecore/TIMEZONES:741 #, kde-format msgid "Australia/Canberra" msgstr "Australia/Canberra" #. +> trunk5 #: kdecore/TIMEZONES:744 #, kde-format msgid "Australia/Currie" msgstr "Australia/Currie" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:746 #, kde-format msgid "Tasmania - King Island" msgstr "Tasmania, illa King" #. +> trunk5 #: kdecore/TIMEZONES:747 #, kde-format msgid "Australia/Darwin" msgstr "Australia/Darwin" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:749 kdecore/TIMEZONES:773 #, kde-format msgid "Northern Territory" msgstr "Territorio do Norte" #. +> trunk5 #: kdecore/TIMEZONES:750 #, kde-format msgid "Australia/Eucla" msgstr "Australia/Eucla" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:752 #, kde-format msgid "Western Australia - Eucla area" msgstr "Australia Occidental, área de Eucla" #. +> trunk5 #: kdecore/TIMEZONES:753 #, kde-format msgid "Australia/Hobart" msgstr "Australia/Hobart" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:755 kdecore/TIMEZONES:788 #, kde-format msgid "Tasmania - most locations" msgstr "Tasmania, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:756 #, kde-format msgid "Australia/LHI" msgstr "Australia/LHI" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:758 kdecore/TIMEZONES:764 #, kde-format msgid "Lord Howe Island" msgstr "Illas de Lord Howe" #. +> trunk5 #: kdecore/TIMEZONES:759 #, kde-format msgid "Australia/Lindeman" msgstr "Australia/Lindeman" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:761 #, kde-format msgid "Queensland - Holiday Islands" msgstr "Queensland, illas de Holiday" #. +> trunk5 #: kdecore/TIMEZONES:762 #, kde-format msgid "Australia/Lord_Howe" msgstr "Australia/Lord Howe" #. +> trunk5 #: kdecore/TIMEZONES:765 #, kde-format msgid "Australia/Melbourne" msgstr "Australia/Melbourne" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:767 kdecore/TIMEZONES:791 #, kde-format msgid "Victoria" msgstr "Victoria" #. +> trunk5 #: kdecore/TIMEZONES:768 #, kde-format msgid "Australia/NSW" msgstr "Australia/NSW" #. +> trunk5 #: kdecore/TIMEZONES:771 #, kde-format msgid "Australia/North" msgstr "Australia/Norte" #. +> trunk5 #: kdecore/TIMEZONES:774 #, kde-format msgid "Australia/Perth" msgstr "Australia/Perth" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:776 kdecore/TIMEZONES:794 #, kde-format msgid "Western Australia - most locations" msgstr "Australia Occidental, maioría dos lugares" #. +> trunk5 #: kdecore/TIMEZONES:777 #, kde-format msgid "Australia/Queensland" msgstr "Australia/Queensland" #. +> trunk5 #: kdecore/TIMEZONES:780 #, kde-format msgid "Australia/South" msgstr "Australia/Sur" #. +> trunk5 #: kdecore/TIMEZONES:783 #, kde-format msgid "Australia/Sydney" msgstr "Australia/Sidnei" #. +> trunk5 #: kdecore/TIMEZONES:786 #, kde-format msgid "Australia/Tasmania" msgstr "Australia/Tasmania" #. +> trunk5 #: kdecore/TIMEZONES:789 #, kde-format msgid "Australia/Victoria" msgstr "Australia/Victoria" #. +> trunk5 #: kdecore/TIMEZONES:792 #, kde-format msgid "Australia/West" msgstr "Australia/Oeste" #. +> trunk5 #: kdecore/TIMEZONES:795 #, kde-format msgid "Australia/Yancowinna" msgstr "Australia/Yancowinna" #. +> trunk5 #: kdecore/TIMEZONES:798 #, kde-format msgid "Brazil/Acre" msgstr "Brasil/Acre" #. +> trunk5 #: kdecore/TIMEZONES:801 #, kde-format msgid "Brazil/DeNoronha" msgstr "Brasil/DeNoronha" #. +> trunk5 #: kdecore/TIMEZONES:804 #, kde-format msgid "Brazil/East" msgstr "Brasil/Leste" #. +> trunk5 #: kdecore/TIMEZONES:807 #, kde-format msgid "Brazil/West" msgstr "Brasil/Oeste" #. +> trunk5 #: kdecore/TIMEZONES:810 #, kde-format msgid "Canada/Atlantic" msgstr "Canadá/Atlántico" #. +> trunk5 #: kdecore/TIMEZONES:813 #, kde-format msgid "Canada/Central" msgstr "Canadá/Central" #. +> trunk5 #: kdecore/TIMEZONES:816 #, kde-format msgid "Canada/East-Saskatchewan" msgstr "Canada/Leste de Saskatchewan" #. +> trunk5 #: kdecore/TIMEZONES:819 #, kde-format msgid "Canada/Eastern" msgstr "Canadá/Oriental" #. +> trunk5 #: kdecore/TIMEZONES:822 #, kde-format msgid "Canada/Mountain" msgstr "Canadá/Montaña" #. +> trunk5 #: kdecore/TIMEZONES:825 #, kde-format msgid "Canada/Newfoundland" msgstr "Canadá/Terra Nova" #. +> trunk5 #: kdecore/TIMEZONES:828 #, kde-format msgid "Canada/Pacific" msgstr "Canadá/Pacífico" #. +> trunk5 #: kdecore/TIMEZONES:831 #, kde-format msgid "Canada/Saskatchewan" msgstr "Canadá/Saskatchewan" #. +> trunk5 #: kdecore/TIMEZONES:834 #, kde-format msgid "Canada/Yukon" msgstr "Canadá/Yukon" #. +> trunk5 #: kdecore/TIMEZONES:837 #, kde-format msgid "Chile/Continental" msgstr "Chile/Continental" #. +> trunk5 #: kdecore/TIMEZONES:840 #, kde-format msgid "Chile/EasterIsland" msgstr "Chile/Illa de Pascua" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:842 kdecore/TIMEZONES:981 #, kde-format msgid "Easter Island & Sala y Gomez" msgstr "Illa de Pascua e Sala y Gómez" #. +> trunk5 #: kdecore/TIMEZONES:843 #, kde-format msgid "Cuba" msgstr "Cuba" #. +> trunk5 #: kdecore/TIMEZONES:844 #, kde-format msgid "Egypt" msgstr "Exipto" #. +> trunk5 #: kdecore/TIMEZONES:845 #, kde-format msgid "Eire" msgstr "Irlanda" #. +> trunk5 #: kdecore/TIMEZONES:846 #, kde-format msgid "Europe/Amsterdam" msgstr "Europa/Amsterdam" #. +> trunk5 #: kdecore/TIMEZONES:847 #, kde-format msgid "Europe/Andorra" msgstr "Europa/Andorra" #. +> trunk5 #: kdecore/TIMEZONES:848 #, kde-format msgid "Europe/Athens" msgstr "Europa/Atenas" #. +> trunk5 #: kdecore/TIMEZONES:849 #, kde-format msgid "Europe/Belfast" msgstr "Europa/Belfast" #. +> trunk5 #: kdecore/TIMEZONES:850 #, kde-format msgid "Europe/Belgrade" msgstr "Europa/Belgrado" #. +> trunk5 #: kdecore/TIMEZONES:851 #, kde-format msgid "Europe/Berlin" msgstr "Europa/Berlín" #. +> trunk5 #: kdecore/TIMEZONES:852 #, kde-format msgid "Europe/Bratislava" msgstr "Europa/Bratislava" #. +> trunk5 #: kdecore/TIMEZONES:853 #, kde-format msgid "Europe/Brussels" msgstr "Europa/Bruxelas" #. +> trunk5 #: kdecore/TIMEZONES:854 #, kde-format msgid "Europe/Bucharest" msgstr "Europa/Bucarés" #. +> trunk5 #: kdecore/TIMEZONES:855 #, kde-format msgid "Europe/Budapest" msgstr "Europa/Budapest" #. +> trunk5 #: kdecore/TIMEZONES:856 #, kde-format msgid "Europe/Chisinau" msgstr "Europa/Chisinau" #. +> trunk5 #: kdecore/TIMEZONES:857 #, kde-format msgid "Europe/Copenhagen" msgstr "Europa/Copenhague" #. +> trunk5 #: kdecore/TIMEZONES:858 #, kde-format msgid "Europe/Dublin" msgstr "Europa/Dublín" #. +> trunk5 #: kdecore/TIMEZONES:859 #, kde-format msgid "Europe/Gibraltar" msgstr "Europa/Xibraltar" #. +> trunk5 #: kdecore/TIMEZONES:860 #, kde-format msgid "Europe/Guernsey" msgstr "Europa/Guernsey" #. +> trunk5 #: kdecore/TIMEZONES:861 #, kde-format msgid "Europe/Helsinki" msgstr "Europa/Helsinki" #. +> trunk5 #: kdecore/TIMEZONES:862 #, kde-format msgid "Europe/Isle_of_Man" msgstr "Europa/Illa de Man" #. +> trunk5 #: kdecore/TIMEZONES:863 #, kde-format msgid "Europe/Istanbul" msgstr "Europa/Istambul" #. +> trunk5 #: kdecore/TIMEZONES:864 #, kde-format msgid "Europe/Jersey" msgstr "Europa/Xersei" #. +> trunk5 #: kdecore/TIMEZONES:865 #, kde-format msgid "Europe/Kaliningrad" msgstr "Europa/Kaliningrado" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:867 #, kde-format msgid "Moscow-01 - Kaliningrad" msgstr "Moscova-01, Kaliningrado" #. +> trunk5 #: kdecore/TIMEZONES:868 #, kde-format msgid "Europe/Kiev" msgstr "Europa/Kiev" #. +> trunk5 #: kdecore/TIMEZONES:871 #, kde-format msgid "Europe/Lisbon" msgstr "Europa/Lisboa" #. +> trunk5 #: kdecore/TIMEZONES:874 #, kde-format msgid "Europe/Ljubljana" msgstr "Europa/Liubliana" #. +> trunk5 #: kdecore/TIMEZONES:875 #, kde-format msgid "Europe/London" msgstr "Europa/Londres" #. +> trunk5 #: kdecore/TIMEZONES:876 #, kde-format msgid "Europe/Luxembourg" msgstr "Europa/Luxemburgo" #. +> trunk5 #: kdecore/TIMEZONES:877 #, kde-format msgid "Europe/Madrid" msgstr "Europa/Madrid" #. +> trunk5 #: kdecore/TIMEZONES:880 #, kde-format msgid "Europe/Malta" msgstr "Europa/Malta" #. +> trunk5 #: kdecore/TIMEZONES:881 #, kde-format msgid "Europe/Mariehamn" msgstr "Europa/Mariehamn" #. +> trunk5 #: kdecore/TIMEZONES:882 #, kde-format msgid "Europe/Minsk" msgstr "Europa/Minsk" #. +> trunk5 #: kdecore/TIMEZONES:883 #, kde-format msgid "Europe/Monaco" msgstr "Europa/Mónaco" #. +> trunk5 #: kdecore/TIMEZONES:884 #, kde-format msgid "Europe/Moscow" msgstr "Europa/Moscova" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:886 kdecore/TIMEZONES:1099 #, kde-format msgid "Moscow+00 - west Russia" msgstr "Moscova+00, oeste de Rusia" #. +> trunk5 #: kdecore/TIMEZONES:887 #, kde-format msgid "Europe/Oslo" msgstr "Europa/Oslo" #. +> trunk5 #: kdecore/TIMEZONES:888 #, kde-format msgid "Europe/Paris" msgstr "Europa/París" #. +> trunk5 #: kdecore/TIMEZONES:889 #, kde-format msgid "Europe/Podgorica" msgstr "Europa/Podgorica" #. +> trunk5 #: kdecore/TIMEZONES:890 #, kde-format msgid "Europe/Prague" msgstr "Europa/Praga" #. +> trunk5 #: kdecore/TIMEZONES:891 #, kde-format msgid "Europe/Riga" msgstr "Europa/Riga" #. +> trunk5 #: kdecore/TIMEZONES:892 #, kde-format msgid "Europe/Rome" msgstr "Europa/Roma" #. +> trunk5 #: kdecore/TIMEZONES:893 #, kde-format msgid "Europe/Samara" msgstr "Europa/Samara" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:895 #, kde-format msgid "Moscow+01 - Samara, Udmurtia" msgstr "Moscova+01, Samara, Udmurtia" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:897 #, kde-format msgid "Moscow+00 - Samara, Udmurtia" msgstr "Moscova+01, Samara, Udmurtia" #. +> trunk5 #: kdecore/TIMEZONES:898 #, kde-format msgid "Europe/San_Marino" msgstr "Europa/San Marino" #. +> trunk5 #: kdecore/TIMEZONES:899 #, kde-format msgid "Europe/Sarajevo" msgstr "Europa/Saraievo" #. +> trunk5 #: kdecore/TIMEZONES:900 #, kde-format msgid "Europe/Simferopol" msgstr "Europa/Simferopol" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:902 #, kde-format msgid "central Crimea" msgstr "Crimea central" #. +> trunk5 #: kdecore/TIMEZONES:903 #, kde-format msgid "Europe/Skopje" msgstr "Europa/Skopje" #. +> trunk5 #: kdecore/TIMEZONES:904 #, kde-format msgid "Europe/Sofia" msgstr "Europa/Sofía" #. +> trunk5 #: kdecore/TIMEZONES:905 #, kde-format msgid "Europe/Stockholm" msgstr "Europa/Estocolmo" #. +> trunk5 #: kdecore/TIMEZONES:906 #, kde-format msgid "Europe/Tallinn" msgstr "Europa/Talin" #. +> trunk5 #: kdecore/TIMEZONES:907 #, kde-format msgid "Europe/Tirane" msgstr "Europa/Tirana" #. +> trunk5 #: kdecore/TIMEZONES:908 #, kde-format msgid "Europe/Tiraspol" msgstr "Europa/Tiraspol" #. +> trunk5 #: kdecore/TIMEZONES:909 #, kde-format msgid "Europe/Uzhgorod" msgstr "Europa/Uzhgorod" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:911 #, kde-format msgid "Ruthenia" msgstr "Rutenia" #. +> trunk5 #: kdecore/TIMEZONES:912 #, kde-format msgid "Europe/Vaduz" msgstr "Europa/Vaduz" #. +> trunk5 #: kdecore/TIMEZONES:913 #, kde-format msgid "Europe/Vatican" msgstr "Europa/Cidade do Vaticano" #. +> trunk5 #: kdecore/TIMEZONES:914 #, kde-format msgid "Europe/Vienna" msgstr "Europa/Viena" #. +> trunk5 #: kdecore/TIMEZONES:915 #, kde-format msgid "Europe/Vilnius" msgstr "Europa/Vilna" #. +> trunk5 #: kdecore/TIMEZONES:916 #, kde-format msgid "Europe/Volgograd" msgstr "Europa/Volgogrado" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:918 #, kde-format msgid "Moscow+00 - Caspian Sea" msgstr "Moscova+00, mar Caspio" #. +> trunk5 #: kdecore/TIMEZONES:919 #, kde-format msgid "Europe/Warsaw" msgstr "Europa/Varsovia" #. +> trunk5 #: kdecore/TIMEZONES:920 #, kde-format msgid "Europe/Zagreb" msgstr "Europa/Zagreb" #. +> trunk5 #: kdecore/TIMEZONES:921 #, kde-format msgid "Europe/Zaporozhye" msgstr "Europa/Zaporozhye" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:923 #, kde-format msgid "Zaporozh'ye, E Lugansk / Zaporizhia, E Luhansk" msgstr "Zaporozh'ye, Lugansk leste / Zaporizhia, Luhansk leste" #. +> trunk5 #: kdecore/TIMEZONES:924 #, kde-format msgid "Europe/Zurich" msgstr "Europa/Zúric" #. +> trunk5 #: kdecore/TIMEZONES:925 #, kde-format msgid "GB" msgstr "GB" #. +> trunk5 #: kdecore/TIMEZONES:926 #, kde-format msgid "GB-Eire" msgstr "GB-Irlanda" #. +> trunk5 #: kdecore/TIMEZONES:927 #, kde-format msgid "Hongkong" msgstr "Hong Kong" #. +> trunk5 #: kdecore/TIMEZONES:928 #, kde-format msgid "Iceland" msgstr "Islandia" #. +> trunk5 #: kdecore/TIMEZONES:929 #, kde-format msgid "Indian/Antananarivo" msgstr "Índico/Illas Antananarivo" #. +> trunk5 #: kdecore/TIMEZONES:930 #, kde-format msgid "Indian/Chagos" msgstr "Índico/Illas Chagos" #. +> trunk5 #: kdecore/TIMEZONES:931 #, kde-format msgid "Indian/Christmas" msgstr "Índico/Illa de Natividade" #. +> trunk5 #: kdecore/TIMEZONES:932 #, kde-format msgid "Indian/Cocos" msgstr "Índico/Cocos" #. +> trunk5 #: kdecore/TIMEZONES:933 #, kde-format msgid "Indian/Comoro" msgstr "Índico/Illas Comoro" #. +> trunk5 #: kdecore/TIMEZONES:934 #, kde-format msgid "Indian/Kerguelen" msgstr "Índico/Illas Kerguelen" #. +> trunk5 #: kdecore/TIMEZONES:935 #, kde-format msgid "Indian/Mahe" msgstr "Índico/Illa Mahe" #. +> trunk5 #: kdecore/TIMEZONES:936 #, kde-format msgid "Indian/Maldives" msgstr "Índico/Illas Maldivas" #. +> trunk5 #: kdecore/TIMEZONES:937 #, kde-format msgid "Indian/Mauritius" msgstr "Índico/Illa Mauricio" #. +> trunk5 #: kdecore/TIMEZONES:938 #, kde-format msgid "Indian/Mayotte" msgstr "Índico/Mayotte" #. +> trunk5 #: kdecore/TIMEZONES:939 #, kde-format msgid "Indian/Reunion" msgstr "Índico/Illas Reunión" #. +> trunk5 #: kdecore/TIMEZONES:940 #, kde-format msgid "Iran" msgstr "Irán" #. +> trunk5 #: kdecore/TIMEZONES:941 #, kde-format msgid "Israel" msgstr "Israel" #. +> trunk5 #: kdecore/TIMEZONES:942 #, kde-format msgid "Jamaica" msgstr "Xamaica" #. +> trunk5 #: kdecore/TIMEZONES:943 #, kde-format msgid "Japan" msgstr "Xapón" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:944 kdecore/TIMEZONES:946 kdecore/TIMEZONES:1011 #, kde-format msgid "Kwajalein" msgstr "Kwajalein" #. +> trunk5 #: kdecore/TIMEZONES:947 #, kde-format msgid "Libya" msgstr "Libia" #. +> trunk5 #: kdecore/TIMEZONES:948 #, kde-format msgid "Mexico/BajaNorte" msgstr "México/BajaNorte" #. +> trunk5 #: kdecore/TIMEZONES:951 #, kde-format msgid "Mexico/BajaSur" msgstr "México/BajaSur" #. +> trunk5 #: kdecore/TIMEZONES:954 #, kde-format msgid "Mexico/General" msgstr "México/Xeral" #. +> trunk5 #: kdecore/TIMEZONES:957 #, kde-format msgid "NZ" msgstr "NZ" # skip-rule: PT-2011_chat #. +> trunk5 #: kdecore/TIMEZONES:960 #, kde-format msgid "NZ-CHAT" msgstr "NZ-CHAT" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:962 kdecore/TIMEZONES:975 #, kde-format msgid "Chatham Islands" msgstr "Illas Chatham" #. +> trunk5 #: kdecore/TIMEZONES:963 #, kde-format msgid "Navajo" msgstr "Navaxo" #. +> trunk5 #: kdecore/TIMEZONES:966 #, kde-format msgid "PRC" msgstr "PRC" #. +> trunk5 #: kdecore/TIMEZONES:969 #, kde-format msgid "Pacific/Apia" msgstr "Pacífico/Apia" #. +> trunk5 #: kdecore/TIMEZONES:970 #, kde-format msgid "Pacific/Auckland" msgstr "Pacífico/Illas Auckland" #. +> trunk5 #: kdecore/TIMEZONES:973 #, kde-format msgid "Pacific/Chatham" msgstr "Pacífico/Illas Chatham" #. +> trunk5 #: kdecore/TIMEZONES:976 #, kde-format msgid "Pacific/Chuuk" msgstr "Pacífico/Chuuk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:978 #, kde-format msgid "Chuuk (Truk) and Yap" msgstr "Chuuk (Truk) e Yap" #. +> trunk5 #: kdecore/TIMEZONES:979 #, kde-format msgid "Pacific/Easter" msgstr "Pacífico/Illa de Pascua" #. +> trunk5 #: kdecore/TIMEZONES:982 #, kde-format msgid "Pacific/Efate" msgstr "Pacífico/Illas Efate" #. +> trunk5 #: kdecore/TIMEZONES:983 #, kde-format msgid "Pacific/Enderbury" msgstr "Pacífico/Illa Enderbury" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:985 #, kde-format msgid "Phoenix Islands" msgstr "Illas Fénix" #. +> trunk5 #: kdecore/TIMEZONES:986 #, kde-format msgid "Pacific/Fakaofo" msgstr "Pacífico/Fakaofo" #. +> trunk5 #: kdecore/TIMEZONES:987 #, kde-format msgid "Pacific/Fiji" msgstr "Pacífico/Fidxi" #. +> trunk5 #: kdecore/TIMEZONES:988 #, kde-format msgid "Pacific/Funafuti" msgstr "Pacífico/Illas Funafuti" #. +> trunk5 #: kdecore/TIMEZONES:989 #, kde-format msgid "Pacific/Galapagos" msgstr "Pacífico/Galápagos" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:991 #, kde-format msgid "Galapagos Islands" msgstr "Illas Galápagos" #. +> trunk5 #: kdecore/TIMEZONES:992 #, kde-format msgid "Pacific/Gambier" msgstr "Pacífico/Illas Gambier" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:994 #, kde-format msgid "Gambier Islands" msgstr "Illas Gambier" #. +> trunk5 #: kdecore/TIMEZONES:995 #, kde-format msgid "Pacific/Guadalcanal" msgstr "Pacífico/Guadalcanal" #. +> trunk5 #: kdecore/TIMEZONES:996 #, kde-format msgid "Pacific/Guam" msgstr "Pacífico/Illa de Guam" #. +> trunk5 #: kdecore/TIMEZONES:997 #, kde-format msgid "Pacific/Honolulu" msgstr "América/Honolulú" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:999 kdecore/TIMEZONES:1083 #, kde-format msgid "Hawaii" msgstr "Havai" #. +> trunk5 #: kdecore/TIMEZONES:1000 #, kde-format msgid "Pacific/Johnston" msgstr "Pacífico/Arquipélago Johnston" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1002 #, kde-format msgid "Johnston Atoll" msgstr "Atolón Johnston" #. +> trunk5 #: kdecore/TIMEZONES:1003 #, kde-format msgid "Pacific/Kiritimati" msgstr "Pacífico/Illas Kiritimati" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1005 #, kde-format msgid "Line Islands" msgstr "Illas Line" #. +> trunk5 #: kdecore/TIMEZONES:1006 #, kde-format msgid "Pacific/Kosrae" msgstr "Pacífico/Illa Kodrae" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1008 #, kde-format msgid "Kosrae" msgstr "Kosrae" #. +> trunk5 #: kdecore/TIMEZONES:1009 #, kde-format msgid "Pacific/Kwajalein" msgstr "Pacífico/Illas Kwajalein" #. +> trunk5 #: kdecore/TIMEZONES:1012 #, kde-format msgid "Pacific/Majuro" msgstr "Pacífico/Illas Majuro" #. +> trunk5 #: kdecore/TIMEZONES:1015 #, kde-format msgid "Pacific/Marquesas" msgstr "Pacífico/Illas Marquesas" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1017 #, kde-format msgid "Marquesas Islands" msgstr "Illas Marquesas" #. +> trunk5 #: kdecore/TIMEZONES:1018 #, kde-format msgid "Pacific/Midway" msgstr "Pacífico/Arquipélago Midway" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1020 #, kde-format msgid "Midway Islands" msgstr "Illas de Midway" #. +> trunk5 #: kdecore/TIMEZONES:1021 #, kde-format msgid "Pacific/Nauru" msgstr "Pacífico/Nauru" #. +> trunk5 #: kdecore/TIMEZONES:1022 #, kde-format msgid "Pacific/Niue" msgstr "Pacífico/Illa Niue" #. +> trunk5 #: kdecore/TIMEZONES:1023 #, kde-format msgid "Pacific/Norfolk" msgstr "Pacífico/Illas Nolfolk" #. +> trunk5 #: kdecore/TIMEZONES:1024 #, kde-format msgid "Pacific/Noumea" msgstr "Pacífico/Illas Noumea" #. +> trunk5 #: kdecore/TIMEZONES:1025 #, kde-format msgid "Pacific/Pago_Pago" msgstr "Pacífico/Pago_Pago" #. +> trunk5 #: kdecore/TIMEZONES:1026 #, kde-format msgid "Pacific/Palau" msgstr "Pacífico/Illas Palau" #. +> trunk5 #: kdecore/TIMEZONES:1027 #, kde-format msgid "Pacific/Pitcairn" msgstr "Pacífico/Illas Pitcairn" #. +> trunk5 #: kdecore/TIMEZONES:1028 #, kde-format msgid "Pacific/Pohnpei" msgstr "Pacífico/Ponape" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1030 #, kde-format msgid "Pohnpei (Ponape)" msgstr "Pohnpei (Ponape)" #. +> trunk5 #: kdecore/TIMEZONES:1031 #, kde-format msgid "Pacific/Ponape" msgstr "Pacífico/Ponape" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1033 #, kde-format msgid "Ponape (Pohnpei)" msgstr "Ponape (Pohnpei)" #. +> trunk5 #: kdecore/TIMEZONES:1034 #, kde-format msgid "Pacific/Port_Moresby" msgstr "Pacífico/Port Moresby" #. +> trunk5 #: kdecore/TIMEZONES:1035 #, kde-format msgid "Pacific/Rarotonga" msgstr "Pacífico/Rarotonga" #. +> trunk5 #: kdecore/TIMEZONES:1036 #, kde-format msgid "Pacific/Saipan" msgstr "Pacífico/Illas Saipán" #. +> trunk5 #: kdecore/TIMEZONES:1037 #, kde-format msgid "Pacific/Samoa" msgstr "Pacífico/Samoa" #. +> trunk5 #: kdecore/TIMEZONES:1038 #, kde-format msgid "Pacific/Tahiti" msgstr "Pacífico/Tahití" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1040 #, kde-format msgid "Society Islands" msgstr "Illas da Sociedade" #. +> trunk5 #: kdecore/TIMEZONES:1041 #, kde-format msgid "Pacific/Tarawa" msgstr "Pacífico/Illas Torawa" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1043 #, kde-format msgid "Gilbert Islands" msgstr "Illas de Gilbert" #. +> trunk5 #: kdecore/TIMEZONES:1044 #, kde-format msgid "Pacific/Tongatapu" msgstr "Pacífico/Illas Tongatapu" #. +> trunk5 #: kdecore/TIMEZONES:1045 #, kde-format msgid "Pacific/Truk" msgstr "Pacífico/Truk" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1047 kdecore/TIMEZONES:1054 #, kde-format msgid "Truk (Chuuk) and Yap" msgstr "Truk (Chuuk) e Yap" #. +> trunk5 #: kdecore/TIMEZONES:1048 #, kde-format msgid "Pacific/Wake" msgstr "Pacífico/Wake" #. i18n: comment to the previous timezone #. +> trunk5 #: kdecore/TIMEZONES:1050 #, kde-format msgid "Wake Island" msgstr "Illa de Wake" #. +> trunk5 #: kdecore/TIMEZONES:1051 #, kde-format msgid "Pacific/Wallis" msgstr "Pacífico/Arquipélago de Wallis" #. +> trunk5 #: kdecore/TIMEZONES:1052 #, kde-format msgid "Pacific/Yap" msgstr "Pacífico/Yap" #. +> trunk5 #: kdecore/TIMEZONES:1055 #, kde-format msgid "Poland" msgstr "Polonia" #. +> trunk5 #: kdecore/TIMEZONES:1056 #, kde-format msgid "Portugal" msgstr "Portugal" #. +> trunk5 #: kdecore/TIMEZONES:1059 #, kde-format msgid "ROC" msgstr "ROC" #. +> trunk5 #: kdecore/TIMEZONES:1060 #, kde-format msgid "ROK" msgstr "ROK" #. +> trunk5 #: kdecore/TIMEZONES:1061 #, kde-format msgid "Singapore" msgstr "Singapur" #. +> trunk5 #: kdecore/TIMEZONES:1062 #, kde-format msgid "Turkey" msgstr "Turquía" #. +> trunk5 #: kdecore/TIMEZONES:1063 #, kde-format msgid "US/Alaska" msgstr "US/Alaska" #. +> trunk5 #: kdecore/TIMEZONES:1066 #, kde-format msgid "US/Aleutian" msgstr "US/Aleutianas" #. +> trunk5 #: kdecore/TIMEZONES:1069 #, kde-format msgid "US/Arizona" msgstr "US/Arizona" #. +> trunk5 #: kdecore/TIMEZONES:1072 #, kde-format msgid "US/Central" msgstr "US/Central" #. +> trunk5 #: kdecore/TIMEZONES:1075 #, kde-format msgid "US/East-Indiana" msgstr "US/Indiana do leste" #. +> trunk5 #: kdecore/TIMEZONES:1078 #, kde-format msgid "US/Eastern" msgstr "US/Leste" #. +> trunk5 #: kdecore/TIMEZONES:1081 #, kde-format msgid "US/Hawaii" msgstr "US/Havai" #. +> trunk5 #: kdecore/TIMEZONES:1084 #, kde-format msgid "US/Indiana-Starke" msgstr "US/Indiana-Starke" #. +> trunk5 #: kdecore/TIMEZONES:1087 #, kde-format msgid "US/Michigan" msgstr "US/Michigan" #. +> trunk5 #: kdecore/TIMEZONES:1090 #, kde-format msgid "US/Mountain" msgstr "US/Montaña" #. +> trunk5 #: kdecore/TIMEZONES:1093 #, kde-format msgid "US/Pacific" msgstr "US/Pacífico" #. +> trunk5 #: kdecore/TIMEZONES:1096 #, kde-format msgid "US/Samoa" msgstr "US/Samoa" #. +> trunk5 #: kdecore/TIMEZONES:1097 #, kde-format msgid "W-SU" msgstr "W-SU" #. i18n: Generic sans serif font presented in font choosers. When selected, #. the system will choose a real font, mandated by distro settings. #. +> trunk5 #: kdeui/fonthelpers.cpp:29 #, kde-format msgctxt "@item Font name" msgid "Sans Serif" msgstr "Sans serif" #. i18n: Generic serif font presented in font choosers. When selected, #. the system will choose a real font, mandated by distro settings. #. +> trunk5 #: kdeui/fonthelpers.cpp:32 #, kde-format msgctxt "@item Font name" msgid "Serif" msgstr "Serif" #. i18n: Generic monospace font presented in font choosers. When selected, #. the system will choose a real font, mandated by distro settings. #. +> trunk5 #: kdeui/fonthelpers.cpp:35 #, kde-format msgctxt "@item Font name" msgid "Monospace" -msgstr "Monoespaciada" +msgstr "Monoespazo" #. +> trunk5 #: kdeui/k4timezonewidget.cpp:62 #, kde-format msgctxt "Define an area in the time zone, like a town area" msgid "Area" msgstr "Área" #. +> trunk5 #: kdeui/k4timezonewidget.cpp:62 #, kde-format msgctxt "Time zone" msgid "Region" msgstr "Rexión" #. +> trunk5 #: kdeui/k4timezonewidget.cpp:62 #, kde-format msgid "Comment" msgstr "Comentario" #. +> trunk5 #: kdeui/kapplication.cpp:746 #, kde-format msgid "The style '%1' was not found" msgstr "Non se atopou o estilo «%1»" #. +> trunk5 #: kdeui/kcolordialog.cpp:102 #, kde-format msgctxt "palette name" msgid "* Recent Colors *" msgstr "* Cores recentes *" #. +> trunk5 #: kdeui/kcolordialog.cpp:103 #, kde-format msgctxt "palette name" msgid "* Custom Colors *" msgstr "* Cores personalizadas *" #. +> trunk5 #: kdeui/kcolordialog.cpp:104 #, kde-format msgctxt "palette name" msgid "Forty Colors" msgstr "Corenta cores" #. +> trunk5 #: kdeui/kcolordialog.cpp:105 #, kde-format msgctxt "palette name" msgid "Oxygen Colors" msgstr "Cores oxygen" #. +> trunk5 #: kdeui/kcolordialog.cpp:106 #, kde-format msgctxt "palette name" msgid "Rainbow Colors" msgstr "Cores do arco-da-vella" #. +> trunk5 #: kdeui/kcolordialog.cpp:107 #, kde-format msgctxt "palette name" msgid "Royal Colors" msgstr "Cores reais" #. +> trunk5 #: kdeui/kcolordialog.cpp:108 #, kde-format msgctxt "palette name" msgid "Web Colors" msgstr "Cores web" #. +> trunk5 #: kdeui/kcolordialog.cpp:572 #, kde-format msgid "Named Colors" msgstr "Cores con nome" #. +> trunk5 #: kdeui/kcolordialog.cpp:746 #, kde-format -msgctxt "%1 is the number of paths, %2 is the list of paths (with newlines between them)" +msgctxt "" +"%1 is the number of paths, %2 is the list of paths (with newlines between" +" them)" msgid "" -"Unable to read X11 RGB color strings. The following file location was examined:\n" +"Unable to read X11 RGB color strings. The following file location was" +" examined:\n" "%2" msgid_plural "" -"Unable to read X11 RGB color strings. The following file locations were examined:\n" +"Unable to read X11 RGB color strings. The following file locations were" +" examined:\n" "%2" msgstr[0] "" -"Non se poden ler as cadeas das cores RGB de X11. Examinouse a seguinte ruta de ficheiro:\n" +"Non se poden ler as cadeas das cores RGB de X11. Examinouse a seguinte ruta" +" de ficheiro:\n" "%2" msgstr[1] "" -"Non se poden ler as cadeas das cores RGB de X11. Examináronse as seguintes rutas de ficheiro:\n" +"Non se poden ler as cadeas das cores RGB de X11. Examináronse as seguintes" +" rutas de ficheiro:\n" "%2" #. +> trunk5 #: kdeui/kcolordialog.cpp:997 #, kde-format msgid "Select Color" msgstr "Escoller unha cor" #. +> trunk5 #: kdeui/kcolordialog.cpp:1077 #, kde-format msgid "Hue:" msgstr "Ton:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1083 #, kde-format msgctxt "The angular degree unit (for hue)" msgid "°" msgstr "°" #. +> trunk5 #: kdeui/kcolordialog.cpp:1088 #, kde-format msgid "Saturation:" msgstr "Saturación:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1098 #, kde-format msgctxt "This is the V of HSV" msgid "Value:" msgstr "Valor:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1111 #, kde-format msgid "Red:" msgstr "Vermello:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1121 #, kde-format msgid "Green:" msgstr "Verde:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1131 #, kde-format msgid "Blue:" msgstr "Azul:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1152 #, kde-format msgid "Alpha:" msgstr "Alfa:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1206 #, kde-format msgid "&Add to Custom Colors" msgstr "&Engadir ás cores personalizadas" #. +> trunk5 #: kdeui/kcolordialog.cpp:1234 #, kde-format msgid "Name:" msgstr "Nome:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1241 #, kde-format msgid "HTML:" msgstr "HTML:" #. +> trunk5 #: kdeui/kcolordialog.cpp:1328 #, kde-format msgid "Default color" msgstr "Cor predeterminada" #. +> trunk5 #: kdeui/kcolordialog.cpp:1393 #, kde-format msgid "-default-" msgstr "-predeterminada-" #. +> trunk5 #: kdeui/kcolordialog.cpp:1668 #, kde-format msgid "-unnamed-" msgstr "-sen nome-" #. +> trunk5 #: kdeui/kdeprintdialog.cpp:40 #, kde-format msgctxt "@title:window" msgid "Print" msgstr "Imprimir" #. +> trunk5 #: kdeui/kdialog.cpp:271 #, kde-format msgid "&Try" msgstr "&Intentar" #. +> trunk5 #: kdeui/kdialog.cpp:484 #, kde-format msgid "modified" msgstr "modificado" #. +> trunk5 #: kdeui/kdialog.cpp:495 #, kde-format msgctxt "Document/application separator in titlebar" msgid " – " msgstr " – " #. +> trunk5 #: kdeui/kdialog.cpp:896 #, kde-format msgid "&Details" msgstr "&Detalles" #. +> trunk5 #: kdeui/kdialog.cpp:1054 #, kde-format msgid "Get help..." msgstr "Obter axuda…" #. +> trunk5 #: kdeui/keditlistbox.cpp:324 #, kde-format msgid "&Add" msgstr "Eng&adir" #. +> trunk5 #: kdeui/keditlistbox.cpp:336 #, kde-format msgid "&Remove" msgstr "&Retirar" #. +> trunk5 #: kdeui/keditlistbox.cpp:348 #, kde-format msgid "Move &Up" msgstr "&Subir" #. +> trunk5 #: kdeui/keditlistbox.cpp:353 #, kde-format msgid "Move &Down" msgstr "&Baixar" #. i18n: A shorter version of the alphabet test phrase translated in #. another message. It is displayed in the dropdown list of font previews #. (the font selection combo box), so keep it under the length equivalent #. to 60 or so proportional Latin characters. #. +> trunk5 #: kdeui/kfontcombobox.cpp:48 #, kde-format msgctxt "short" msgid "The Quick Brown Fox Jumps Over The Lazy Dog" msgstr "Fíxate, o mesquiño bacharel pide vinganza" #. i18n: Integer which indicates the script you used in the sample text #. for font previews in your language. For the possible values, see #. https://doc.qt.io/qt-5/qfontdatabase.html#WritingSystem-enum #. If the sample text contains several scripts, their IDs can be given #. as a comma-separated list (e.g. for Japanese it is "1,27"). #. +> trunk5 #: kdeui/kfontcombobox.cpp:119 #, kde-format msgctxt "Numeric IDs of scripts for font previews" msgid "1" msgstr "1" #. +> trunk5 #: kdeui/kfontdialog.cpp:51 #, kde-format msgid "Select Font" msgstr "Seleccionar a fonte" #. +> trunk5 #: kdeui/kprintpreview.cpp:119 #, kde-format msgid "Could not load print preview part" msgstr "Non se puido cargar a compoñente de previsualización da impresión" #. +> trunk5 #: kdeui/kprintpreview.cpp:136 #, kde-format msgid "Print Preview" msgstr "Vista previa do impreso" #. +> trunk5 #: kdeui/ksystemtrayicon.cpp:153 #, kde-format msgid "Minimize" msgstr "Minimizar" #. +> trunk5 #: kdeui/ksystemtrayicon.cpp:205 #, kde-format msgid "&Minimize" msgstr "&Minimizar" #. +> trunk5 #: kdeui/ksystemtrayicon.cpp:207 #, kde-format msgid "&Restore" msgstr "&Restaurar" #. +> trunk5 #: kdeui/ksystemtrayicon.cpp:226 #, kde-format msgid "Are you sure you want to quit %1?" msgstr "Seguro que quere saír de %1?" #. +> trunk5 #: kdeui/ksystemtrayicon.cpp:229 #, kde-format msgid "Confirm Quit From System Tray" msgstr "Confirmar a saída desde a bandexa do sistema" #. +> trunk5 #: kdeui/kundostack.cpp:47 #, kde-format msgid "Redo" msgstr "Refacer" #. +> trunk5 #: kdeui/kundostack.cpp:66 #, kde-format msgid "Undo" msgstr "Desfacer" #. +> trunk5 #: kdeui/kuniqueapplication.cpp:79 #, kde-format msgid "Do not run in the background." msgstr "Non executar no fondo." # skip-rule: noPT-2010_find #. +> trunk5 #: kdeui/kuniqueapplication.cpp:81 #, kde-format msgid "Internally added if launched from Finder" msgstr "Engadido internamente se é iniciado desde o Finder" #. +> trunk5 #: kio/kcommentwidget.cpp:68 #, kde-format msgctxt "@label" msgid "Add Comment..." msgstr "Engadir un comentario…" #. +> trunk5 #: kio/kcommentwidget.cpp:74 #, kde-format msgctxt "@label" msgid "Change..." msgstr "Cambiar…" #. +> trunk5 #: kio/kcommentwidget.cpp:128 #, kde-format msgctxt "@title:window" msgid "Change Comment" msgstr "Cambiar o comentario" #. +> trunk5 #: kio/kcommentwidget.cpp:129 #, kde-format msgctxt "@title:window" msgid "Add Comment" msgstr "Engadir un comentario" #. +> trunk5 #: kio/kdevicelistmodel.cpp:116 #, kde-format msgid "Device name" msgstr "Nome do dispositivo" #. +> trunk5 #: kio/kdirselectdialog.cpp:136 #, kde-format msgctxt "folder name" msgid "New Folder" msgstr "Cartafol novo" #. +> trunk5 #: kio/kdirselectdialog.cpp:141 #, kde-format msgctxt "@title:window" msgid "New Folder" msgstr "Novo cartafol" #. +> trunk5 #: kio/kdirselectdialog.cpp:142 #, kde-format msgctxt "@label:textbox" msgid "" "Create new folder in:\n" "%1" msgstr "" "Crear un cartafol novo en:\n" "%1" #. +> trunk5 #: kio/kdirselectdialog.cpp:172 #, kde-format msgid "A file or folder named %1 already exists." msgstr "Xa existe un ficheiro ou cartafol chamado %1." #. +> trunk5 #: kio/kdirselectdialog.cpp:175 #, kde-format msgid "You do not have permission to create that folder." msgstr "Non ten permisos para crear ese cartafol." #. +> trunk5 #: kio/kdirselectdialog.cpp:290 #, kde-format msgctxt "@title:window" msgid "Select Folder" msgstr "Escoller un cartafol" #. +> trunk5 #: kio/kdirselectdialog.cpp:299 #, kde-format msgctxt "@action:button" msgid "New Folder..." msgstr "Novo cartafol…" #. +> trunk5 #: kio/kdirselectdialog.cpp:345 #, kde-format msgctxt "@action:inmenu" msgid "New Folder..." msgstr "Novo cartafol…" #. +> trunk5 #: kio/kdirselectdialog.cpp:352 #, kde-format msgctxt "@action:inmenu" msgid "Move to Trash" msgstr "Botar no lixo" #. +> trunk5 #: kio/kdirselectdialog.cpp:359 #, kde-format msgctxt "@action:inmenu" msgid "Delete" msgstr "Eliminar" #. +> trunk5 #: kio/kdirselectdialog.cpp:368 #, kde-format msgctxt "@option:check" msgid "Show Hidden Folders" msgstr "Mostrar os cartafoles agochados" #. +> trunk5 #: kio/kdirselectdialog.cpp:375 #, kde-format msgctxt "@action:inmenu" msgid "Properties" msgstr "Propiedades" #. +> trunk5 #: kio/kfiledialog.cpp:132 #, kde-format msgid "*|All files" msgstr "*|Todos os ficheiros" #. +> trunk5 #: kio/kfiledialog.cpp:332 #, kde-format msgid "All Supported Files" msgstr "Todos os ficheiros admitidos" #. +> trunk5 #: kio/kfiledialog.cpp:455 kio/kfiledialog.cpp:465 kio/kfiledialog.cpp:491 #: kio/kfiledialog.cpp:515 kio/kfiledialog.cpp:525 kio/kfiledialog.cpp:553 #: kio/kfiledialog.cpp:591 kio/kfiledialog.cpp:643 #, kde-format msgid "Open" msgstr "Abrir" #. +> trunk5 #: kio/kfiledialog.cpp:734 kio/kfiledialog.cpp:754 kio/kfiledialog.cpp:794 #: kio/kfiledialog.cpp:838 #, kde-format msgid "Save As" msgstr "Gardar como" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:245 #, kde-format msgctxt "@item:intable" msgid "%1 item" msgid_plural "%1 items" msgstr[0] "%1 elemento" msgstr[1] "%1 elementos" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:446 kio/knfotranslator.cpp:39 #, kde-format msgctxt "@label" msgid "Comment" msgstr "Comentario" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:447 #, kde-format msgctxt "@label" msgid "Modified" msgstr "Modificación" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:448 #, kde-format msgctxt "@label" msgid "Owner" msgstr "Dono" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:449 #, kde-format msgctxt "@label" msgid "Permissions" msgstr "Permisos" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:450 #, kde-format msgctxt "@label" msgid "Rating" msgstr "Puntuación" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:451 #, kde-format msgctxt "@label" msgid "Size" msgstr "Tamaño" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:452 #, kde-format msgctxt "@label" msgid "Tags" msgstr "Etiquetas" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:453 #, kde-format msgctxt "@label" msgid "Total Size" msgstr "Tamaño total" #. +> trunk5 #: kio/kfilemetadataprovider.cpp:454 #, kde-format msgctxt "@label" msgid "Type" msgstr "Tipo" #. +> trunk5 #: kio/kfilemetadatareaderprocess.cpp:234 #, kde-format msgid "KFileMetaDataReader" msgstr "KFileMetaDataReader" #. +> trunk5 #: kio/kfilemetadatareaderprocess.cpp:236 #, kde-format msgid "KFileMetaDataReader can be used to read metadata from a file" msgstr "KFileMetaDataReader pode empregarse para ler metadatos dun ficheiro" #. +> trunk5 #: kio/kfilemetadatareaderprocess.cpp:238 #, kde-format msgid "(C) 2011, Peter Penz" msgstr "© 2011, Peter Penz" #. +> trunk5 #: kio/kfilemetadatareaderprocess.cpp:239 #, kde-format msgid "Peter Penz" msgstr "Peter Penz" #. +> trunk5 #: kio/kfilemetadatareaderprocess.cpp:239 #, kde-format msgid "Current maintainer" msgstr "Mantedor na actualidade" #. +> trunk5 #: kio/kfilemetadatareaderprocess.cpp:244 #, kde-format msgid "Only the meta data that is part of the file is read" msgstr "Só se len o metadatos que son parte do ficheiro" #. +> trunk5 #: kio/kfilemetadatareaderprocess.cpp:245 #, kde-format msgid "List of URLs where the meta-data should be read from" msgstr "Lista de URL de onde se deben ler os metadatos" #. +> trunk5 #: kio/kfilemetainfowidget.cpp:161 #, kde-format msgid "" msgstr "" #. +> trunk5 #: kio/kfiletreeview.cpp:192 #, kde-format msgid "Show Hidden Folders" msgstr "Mostrar os cartafoles agochados" #. +> trunk5 #: kio/kimageio.cpp:46 #, kde-format msgid "All Pictures" msgstr "Todas as imaxes" #. +> trunk5 #: kio/kmetaprops.cpp:57 #, kde-format msgctxt "@title:window" msgid "Configure Shown Data" msgstr "Configurar os datos mostrados" #. +> trunk5 #: kio/kmetaprops.cpp:60 #, kde-format msgctxt "@label::textbox" msgid "Select which data should be shown:" msgstr "Escolla os datos que desexe ver:" #. +> trunk5 #: kio/kmetaprops.cpp:123 #, kde-format msgctxt "@action:button" msgid "Configure..." msgstr "Configurar…" #. +> trunk5 #: kio/kmetaprops.cpp:133 #, kde-format msgctxt "@title:tab" msgid "Information" msgstr "Información" #. +> trunk5 #: kio/knfotranslator.cpp:40 #, kde-format msgctxt "@label creation date" msgid "Created" msgstr "Creación" #. +> trunk5 #: kio/knfotranslator.cpp:41 #, kde-format msgctxt "@label file content size" msgid "Size" msgstr "Tamaño" #. +> trunk5 #: kio/knfotranslator.cpp:42 #, kde-format msgctxt "@label file depends from" msgid "Depends" msgstr "Depende de" #. +> trunk5 #: kio/knfotranslator.cpp:43 #, kde-format msgctxt "@label" msgid "Description" msgstr "Descrición" #. +> trunk5 #: kio/knfotranslator.cpp:44 #, kde-format msgctxt "@label Software used to generate content" msgid "Generator" msgstr "Xerador" #. +> trunk5 #: kio/knfotranslator.cpp:45 #, kde-format -msgctxt "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" +msgctxt "" +"@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasPart" msgid "Has Part" msgstr "Ten partes" #. +> trunk5 #: kio/knfotranslator.cpp:46 #, kde-format -msgctxt "@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasLogicalPart" +msgctxt "" +"@label see http://www.semanticdesktop.org/ontologies/2007/01/19/nie#hasLogical" +"Part" msgid "Has Logical Part" msgstr "Ten partes lóxicas" #. +> trunk5 #: kio/knfotranslator.cpp:47 #, kde-format msgctxt "@label parent directory" msgid "Part of" msgstr "Parte de" #. +> trunk5 #: kio/knfotranslator.cpp:48 #, kde-format msgctxt "@label" msgid "Keyword" msgstr "Palabra clave" #. +> trunk5 #: kio/knfotranslator.cpp:49 #, kde-format msgctxt "@label modified date of file" msgid "Modified" msgstr "Modificación" #. +> trunk5 #: kio/knfotranslator.cpp:50 #, kde-format msgctxt "@label" msgid "MIME Type" msgstr "Tipo mime" #. +> trunk5 #: kio/knfotranslator.cpp:51 #, kde-format msgctxt "@label" msgid "Content" msgstr "Contido" #. +> trunk5 #: kio/knfotranslator.cpp:52 #, kde-format msgctxt "@label" msgid "Related To" msgstr "Está relacionado con" #. +> trunk5 #: kio/knfotranslator.cpp:53 #, kde-format msgctxt "@label" msgid "Subject" msgstr "Asunto" #. +> trunk5 #: kio/knfotranslator.cpp:54 #, kde-format msgctxt "@label music title" msgid "Title" msgstr "Título" #. +> trunk5 #: kio/knfotranslator.cpp:55 #, kde-format msgctxt "@label file URL" msgid "File Location" msgstr "Localización do ficheiro" #. +> trunk5 #: kio/knfotranslator.cpp:56 #, kde-format msgctxt "@label" msgid "Creator" msgstr "Creador" #. +> trunk5 #: kio/knfotranslator.cpp:57 #, kde-format msgctxt "@label" msgid "Average Bitrate" msgstr "Taxa de bits media" #. +> trunk5 #: kio/knfotranslator.cpp:58 #, kde-format msgctxt "@label" msgid "Channels" msgstr "Canles" #. +> trunk5 #: kio/knfotranslator.cpp:59 #, kde-format msgctxt "@label number of characters" msgid "Characters" msgstr "Caracteres" #. +> trunk5 #: kio/knfotranslator.cpp:60 #, kde-format msgctxt "@label" msgid "Codec" msgstr "Códec" #. +> trunk5 #: kio/knfotranslator.cpp:61 #, kde-format msgctxt "@label" msgid "Color Depth" msgstr "Profundidade de cor" #. +> trunk5 #: kio/knfotranslator.cpp:62 #, kde-format msgctxt "@label" msgid "Duration" msgstr "Duración" #. +> trunk5 #: kio/knfotranslator.cpp:63 #, kde-format msgctxt "@label" msgid "Filename" msgstr "Nome do ficheiro" #. +> trunk5 #: kio/knfotranslator.cpp:64 #, kde-format msgctxt "@label" msgid "Hash" msgstr "Hash" #. +> trunk5 #: kio/knfotranslator.cpp:65 #, kde-format msgctxt "@label" msgid "Height" msgstr "Altura" #. +> trunk5 #: kio/knfotranslator.cpp:66 #, kde-format msgctxt "@label" msgid "Interlace Mode" msgstr "Modo de interlace" #. +> trunk5 #: kio/knfotranslator.cpp:67 #, kde-format msgctxt "@label number of lines" msgid "Lines" msgstr "Liñas" #. +> trunk5 #: kio/knfotranslator.cpp:68 #, kde-format msgctxt "@label" msgid "Programming Language" msgstr "Linguaxe de programación" #. +> trunk5 #: kio/knfotranslator.cpp:69 #, kde-format msgctxt "@label" msgid "Sample Rate" msgstr "Taxa de exemplo" #. +> trunk5 #: kio/knfotranslator.cpp:70 #, kde-format msgctxt "@label" msgid "Width" msgstr "Anchura" #. +> trunk5 #: kio/knfotranslator.cpp:71 #, kde-format msgctxt "@label number of words" msgid "Words" msgstr "Palabras" #. +> trunk5 #: kio/knfotranslator.cpp:72 #, kde-format msgctxt "@label EXIF aperture value" msgid "Aperture" msgstr "Abertura" #. +> trunk5 #: kio/knfotranslator.cpp:73 #, kde-format msgctxt "@label EXIF" msgid "Exposure Bias Value" msgstr "Valor de compensación da exposición" #. +> trunk5 #: kio/knfotranslator.cpp:74 #, kde-format msgctxt "@label EXIF" msgid "Exposure Time" msgstr "Tempo de exposición" #. +> trunk5 #: kio/knfotranslator.cpp:75 #, kde-format msgctxt "@label EXIF" msgid "Flash" msgstr "Flash" #. +> trunk5 #: kio/knfotranslator.cpp:76 #, kde-format msgctxt "@label EXIF" msgid "Focal Length" msgstr "Distancia focal" #. +> trunk5 #: kio/knfotranslator.cpp:77 #, kde-format msgctxt "@label EXIF" msgid "Focal Length 35 mm" msgstr "Distancia focal 35 mm" #. +> trunk5 #: kio/knfotranslator.cpp:78 #, kde-format msgctxt "@label EXIF" msgid "ISO Speed Ratings" msgstr "Velocidades ISO" #. +> trunk5 #: kio/knfotranslator.cpp:79 #, kde-format msgctxt "@label EXIF" msgid "Make" msgstr "Fabricante" #. +> trunk5 #: kio/knfotranslator.cpp:80 #, kde-format msgctxt "@label EXIF" msgid "Metering Mode" msgstr "Método de medición" #. +> trunk5 #: kio/knfotranslator.cpp:81 #, kde-format msgctxt "@label EXIF" msgid "Model" msgstr "Modelo" #. +> trunk5 #: kio/knfotranslator.cpp:82 #, kde-format msgctxt "@label EXIF" msgid "Orientation" msgstr "Orientación" #. +> trunk5 #: kio/knfotranslator.cpp:83 #, kde-format msgctxt "@label EXIF" msgid "White Balance" msgstr "Balance de brancos" #. +> trunk5 #: kio/knfotranslator.cpp:84 #, kde-format msgctxt "@label video director" msgid "Director" msgstr "Director" #. +> trunk5 #: kio/knfotranslator.cpp:85 #, kde-format msgctxt "@label music genre" msgid "Genre" msgstr "Xénero" #. +> trunk5 #: kio/knfotranslator.cpp:86 #, kde-format msgctxt "@label music album" msgid "Album" msgstr "Álbum" #. +> trunk5 #: kio/knfotranslator.cpp:87 #, kde-format msgctxt "@label" msgid "Performer" msgstr "Artista" #. +> trunk5 #: kio/knfotranslator.cpp:88 #, kde-format msgctxt "@label" msgid "Release Date" msgstr "Data de publicación" #. +> trunk5 #: kio/knfotranslator.cpp:89 #, kde-format msgctxt "@label music track number" msgid "Track" msgstr "Pista" #. +> trunk5 #: kio/knfotranslator.cpp:90 #, kde-format msgctxt "@label resource created time" msgid "Resource Created" msgstr "Data de creación do recurso" #. +> trunk5 #: kio/knfotranslator.cpp:91 #, kde-format msgctxt "@label" msgid "Sub Resource" msgstr "Subrecurso" #. +> trunk5 #: kio/knfotranslator.cpp:92 #, kde-format msgctxt "@label resource last modified" msgid "Resource Modified" msgstr "Data de modificación do recurso" #. +> trunk5 #: kio/knfotranslator.cpp:93 #, kde-format msgctxt "@label" msgid "Numeric Rating" msgstr "Puntuación numérica" #. +> trunk5 #: kio/knfotranslator.cpp:94 #, kde-format msgctxt "@label" msgid "Copied From" msgstr "Copiado desde" #. +> trunk5 #: kio/knfotranslator.cpp:95 #, kde-format msgctxt "@label" msgid "First Usage" msgstr "Primeira utilización" #. +> trunk5 #: kio/knfotranslator.cpp:96 #, kde-format msgctxt "@label" msgid "Last Usage" msgstr "Última utilización" #. +> trunk5 #: kio/knfotranslator.cpp:97 #, kde-format msgctxt "@label" msgid "Usage Count" msgstr "Cantidade de utilizacións" #. +> trunk5 #: kio/knfotranslator.cpp:98 #, kde-format msgctxt "@label" msgid "Unix File Group" msgstr "Grupo Unix de ficheiros" #. +> trunk5 #: kio/knfotranslator.cpp:99 #, kde-format msgctxt "@label" msgid "Unix File Mode" msgstr "Modo Unix do ficheiro" #. +> trunk5 #: kio/knfotranslator.cpp:100 #, kde-format msgctxt "@label" msgid "Unix File Owner" msgstr "Dono Unix do ficheiro" #. +> trunk5 #: kio/knfotranslator.cpp:101 #, kde-format msgctxt "@label file type" msgid "Type" msgstr "Tipo" #. +> trunk5 #: kio/knfotranslator.cpp:102 #, kde-format msgctxt "@label Number of fuzzy translations" msgid "Fuzzy Translations" msgstr "Traducións dubidosas" #. +> trunk5 #: kio/knfotranslator.cpp:103 #, kde-format msgctxt "@label Name of last translator" msgid "Last Translator" msgstr "Último tradutor" #. +> trunk5 #: kio/knfotranslator.cpp:104 #, kde-format msgctxt "@label Number of obsolete translations" msgid "Obsolete Translations" msgstr "Traducións obsoletas" #. +> trunk5 #: kio/knfotranslator.cpp:105 #, kde-format msgctxt "@label" msgid "Translation Source Date" msgstr "Data do orixinal da tradución" #. +> trunk5 #: kio/knfotranslator.cpp:106 #, kde-format msgctxt "@label Number of total translations" msgid "Total Translations" msgstr "Traducións totais" #. +> trunk5 #: kio/knfotranslator.cpp:107 #, kde-format msgctxt "@label Number of translated strings" msgid "Translated" msgstr "Traducidas" #. +> trunk5 #: kio/knfotranslator.cpp:108 #, kde-format msgctxt "@label" msgid "Translation Date" msgstr "Data da tradución" #. +> trunk5 #: kio/knfotranslator.cpp:109 #, kde-format msgctxt "@label Number of untranslated strings" msgid "Untranslated" msgstr "Sen traducir" #. +> trunk5 #: kio/kpreviewprops.cpp:51 #, kde-format msgid "P&review" msgstr "Pre&visualizar" #. +> trunk5 #: kio/kscan.cpp:49 #, kde-format msgid "Acquire Image" msgstr "Tomar a imaxe" #. +> trunk5 #: kio/kscan.cpp:97 #, kde-format msgid "OCR Image" msgstr "OCR da imaxe" #. +> trunk5 #: kio/netaccess.cpp:103 #, kde-format msgid "File '%1' is not readable" msgstr "O ficheiro «%1» non é lexíbel" #. +> trunk5 #: kio/netaccess.cpp:437 #, kde-format msgid "ERROR: Unknown protocol '%1'" msgstr "ERRO: Protocolo descoñecido «%1»" #. +> trunk5 #: kio/passworddialog.cpp:56 #, kde-format msgid "Authorization Dialog" msgstr "Diálogo de autorización" #. +> trunk5 #: kioslave/metainfo/metainfo.cpp:91 #, kde-format msgid "No metainfo for %1" msgstr "Non hai metainformación para %1" #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) #. +> trunk5 #: kssl/kcm/cacertificates.ui:24 #, kde-format msgid "Organization / Common Name" msgstr "Organización / Nome normal" #. i18n: ectx: property (text), widget (QTreeWidget, treeWidget) #. +> trunk5 #: kssl/kcm/cacertificates.ui:29 #, kde-format msgid "Organizational Unit" msgstr "Unidade da organización" #. i18n: ectx: property (text), widget (QPushButton, displaySelection) #. +> trunk5 #: kssl/kcm/cacertificates.ui:42 #, kde-format msgid "Display..." msgstr "Mostrar…" #. i18n: ectx: property (text), widget (QPushButton, disableSelection) #. +> trunk5 #: kssl/kcm/cacertificates.ui:68 #, kde-format msgid "Disable" msgstr "Desactivar" #. i18n: ectx: property (text), widget (QPushButton, enableSelection) #. +> trunk5 #: kssl/kcm/cacertificates.ui:78 #, kde-format msgid "Enable" msgstr "Activar" #. i18n: ectx: property (text), widget (QPushButton, removeSelection) #. +> trunk5 #: kssl/kcm/cacertificates.ui:104 #, kde-format msgid "Remove" msgstr "Retirar" #. i18n: ectx: property (text), widget (QPushButton, add) #. +> trunk5 #: kssl/kcm/cacertificates.ui:111 #, kde-format msgid "Add..." msgstr "Engadir…" #. +> trunk5 #: kssl/kcm/cacertificatespage.cpp:140 #, kde-format msgid "System certificates" msgstr "Certificados do sistema" #. +> trunk5 #: kssl/kcm/cacertificatespage.cpp:147 #, kde-format msgid "User-added certificates" msgstr "Certificados engadidos polo usuario" #. +> trunk5 #: kssl/kcm/cacertificatespage.cpp:302 #, kde-format msgid "Pick Certificates" msgstr "Coller certificados" #. i18n: ectx: property (text), widget (QLabel, subjectHeading) #. +> trunk5 #: kssl/kcm/displaycert.ui:23 #, kde-format msgid "Subject Information" msgstr "Información sobre o asunto" #. i18n: ectx: property (text), widget (QLabel, issuerHeading) #. +> trunk5 #: kssl/kcm/displaycert.ui:39 #, kde-format msgid "Issuer Information" msgstr "Información sobre o expedidor" #. i18n: ectx: property (text), widget (QLabel, label) #. +> trunk5 #: kssl/kcm/displaycert.ui:55 #, kde-format msgid "Other" msgstr "Outro" #. i18n: ectx: property (text), widget (QLabel, validityPeriodLabel) #. +> trunk5 #: kssl/kcm/displaycert.ui:64 #, kde-format msgid "Validity period" msgstr "Período de validez" #. i18n: ectx: property (text), widget (QLabel, serialNumberLabel) #. +> trunk5 #: kssl/kcm/displaycert.ui:78 #, kde-format msgid "Serial number" msgstr "Número de serie" #. i18n: ectx: property (text), widget (QLabel, md5DigestLabel) #. +> trunk5 #: kssl/kcm/displaycert.ui:92 #, kde-format msgid "MD5 digest" msgstr "Resumo MD5" #. i18n: ectx: property (text), widget (QLabel, sha1DigestLabel) #. +> trunk5 #: kssl/kcm/displaycert.ui:106 #, kde-format msgid "SHA1 digest" msgstr "Resumo SHA1" #. +> trunk5 #: kssl/kcm/displaycertdialog.cpp:73 #, kde-format msgctxt "%1 is the effective date of the certificate, %2 is the expiry date" msgid "%1 to %2" msgstr "Desde o %1 ata o %2" #. +> trunk5 #: kssl/kcm/kcmssl.cpp:37 #, kde-format msgid "SSL Configuration Module" msgstr "Módulo de configuración de SSL" #. +> trunk5 #: kssl/kcm/kcmssl.cpp:39 #, kde-format msgid "Copyright 2010 Andreas Hartmetz" msgstr "Copyright 2010 Andreas Hartmetz" #. +> trunk5 #: kssl/kcm/kcmssl.cpp:40 #, kde-format msgid "Andreas Hartmetz" msgstr "Andreas Hartmetz" #. +> trunk5 #: kssl/kcm/kcmssl.cpp:52 #, kde-format msgid "SSL Signers" msgstr "Asinantes de SSL" #. +> trunk5 #: kssl/ksslcertificate.cpp:202 #, kde-format msgid "Signature Algorithm: " msgstr "Algoritmo de sinatura: " #. +> trunk5 #: kssl/ksslcertificate.cpp:203 #, kde-format msgid "Unknown" msgstr "Descoñecido" #. +> trunk5 #: kssl/ksslcertificate.cpp:206 #, kde-format msgid "Signature Contents:" msgstr "Contidos da sinatura:" #. +> trunk5 #: kssl/ksslcertificate.cpp:341 #, kde-format msgctxt "Unknown" msgid "Unknown key algorithm" msgstr "Descoñécese o algoritmo da chave" #. +> trunk5 #: kssl/ksslcertificate.cpp:347 #, kde-format msgid "Key type: RSA (%1 bit)" msgstr "Tipo da chave: RSA (%1 bits)" #. +> trunk5 #: kssl/ksslcertificate.cpp:349 #, kde-format msgid "Modulus: " msgstr "Módulo: " #. +> trunk5 #: kssl/ksslcertificate.cpp:362 #, kde-format msgid "Exponent: 0x" msgstr "Expoñente: 0x" #. +> trunk5 #: kssl/ksslcertificate.cpp:374 #, kde-format msgid "Key type: DSA (%1 bit)" msgstr "Tipo da chave: DSA (%1 bits)" #. +> trunk5 #: kssl/ksslcertificate.cpp:376 #, kde-format msgid "Prime: " msgstr "Primo: " #. +> trunk5 #: kssl/ksslcertificate.cpp:389 #, kde-format msgid "160 bit prime factor: " msgstr "Factor primo de 160 bits: " #. +> trunk5 #: kssl/ksslcertificate.cpp:417 #, kde-format msgid "Public key: " msgstr "Chave pública: " #. +> trunk5 #: kssl/ksslcertificate.cpp:1065 #, kde-format msgid "The certificate is valid." msgstr "O certificado é correcto." #. +> trunk5 #: kssl/ksslcertificate.cpp:1067 #, kde-format -msgid "Retrieval of the issuer certificate failed. This means the CA's (Certificate Authority) certificate can not be found." -msgstr "A recuperación do certificado do expendedor fallou. Isto significa que non se pode atopar o certificado da CA (Autoridade de Certificación)." +msgid "" +"Retrieval of the issuer certificate failed. This means the CA's (Certificate" +" Authority) certificate can not be found." +msgstr "" +"A recuperación do certificado do expendedor fallou. Isto significa que non se" +" pode atopar o certificado da CA (Autoridade de Certificación)." #. +> trunk5 #: kssl/ksslcertificate.cpp:1069 #, kde-format -msgid "Retrieval of the CRL (Certificate Revocation List) failed. This means the CA's (Certificate Authority) CRL can not be found." -msgstr "A recuperación da CRL (Lista de revogación de certificados) fallou. Isto significa que non se pode atopar a CRL da CA (Autoridade de Certificación)." +msgid "" +"Retrieval of the CRL (Certificate Revocation List) failed. This means the" +" CA's (Certificate Authority) CRL can not be found." +msgstr "" +"A recuperación da CRL (Lista de revogación de certificados) fallou. Isto" +" significa que non se pode atopar a CRL da CA (Autoridade de Certificación)." #. +> trunk5 #: kssl/ksslcertificate.cpp:1071 #, kde-format -msgid "The decryption of the certificate's signature failed. This means it could not even be calculated as opposed to just not matching the expected result." -msgstr "Fallou o descifrado da sinatura do certificado. Isto significa que nin se puido calcular, non que simplemente non coincidise co resultado esperado." +msgid "" +"The decryption of the certificate's signature failed. This means it could not" +" even be calculated as opposed to just not matching the expected result." +msgstr "" +"Fallou o descifrado da sinatura do certificado. Isto significa que nin se" +" puido calcular, non que simplemente non coincidise co resultado esperado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1073 #, kde-format -msgid "The decryption of the CRL's (Certificate Revocation List) signature failed. This means it could not even be calculated as opposed to just not matching the expected result." -msgstr "Fallou o descifrado da firma da lista de revogación de certificados (CRL). Isto significa que nin se puido calcular, non que simplemente non coincidise co resultado esperado." +msgid "" +"The decryption of the CRL's (Certificate Revocation List) signature failed." +" This means it could not even be calculated as opposed to just not matching" +" the expected result." +msgstr "" +"Fallou o descifrado da firma da lista de revogación de certificados (CRL)." +" Isto significa que nin se puido calcular, non que simplemente non coincidise" +" co resultado esperado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1075 #, kde-format -msgid "The decoding of the public key of the issuer failed. This means that the CA's (Certificate Authority) certificate can not be used to verify the certificate you wanted to use." -msgstr "A descodificación da chave pública do expendedor fallou. Isto significa que non se pode usar o certificado da CA (Autoridade de Certificación) para verificar o certificado que quere usar." +msgid "" +"The decoding of the public key of the issuer failed. This means that the CA's" +" (Certificate Authority) certificate can not be used to verify the" +" certificate you wanted to use." +msgstr "" +"A descodificación da chave pública do expendedor fallou. Isto significa que" +" non se pode usar o certificado da CA (Autoridade de Certificación) para" +" verificar o certificado que quere usar." #. +> trunk5 #: kssl/ksslcertificate.cpp:1077 #, kde-format -msgid "The certificate's signature is invalid. This means that the certificate can not be verified." -msgstr "A sinatura do certificado é incorrecta. Isto significa que non se pode verificar o certificado." +msgid "" +"The certificate's signature is invalid. This means that the certificate can" +" not be verified." +msgstr "" +"A sinatura do certificado é incorrecta. Isto significa que non se pode" +" verificar o certificado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1079 #, kde-format -msgid "The CRL's (Certificate Revocation List) signature is invalid. This means that the CRL can not be verified." -msgstr "A CRL (Lista de Revogado do Certificado) é incorrecta. Isto significa que non se pode verificar a CRL." +msgid "" +"The CRL's (Certificate Revocation List) signature is invalid. This means that" +" the CRL can not be verified." +msgstr "" +"A CRL (Lista de Revogado do Certificado) é incorrecta. Isto significa que non" +" se pode verificar a CRL." #. +> trunk5 #: kssl/ksslcertificate.cpp:1081 #, kde-format msgid "The certificate is not valid, yet." msgstr "O certificado non é correcto, aínda." #. +> trunk5 #: kssl/ksslcertificate.cpp:1083 #, kde-format msgid "The certificate is not valid, any more." msgstr "O certificado non é correcto, nunca máis." #. +> trunk5 #: kssl/ksslcertificate.cpp:1085 kssl/ksslcertificate.cpp:1087 #, kde-format msgid "The CRL (Certificate Revocation List) is not valid, yet." msgstr "A CRL (Lista de Revogado do Certificado) non é correcta, aínda." #. +> trunk5 #: kssl/ksslcertificate.cpp:1089 #, kde-format msgid "The time format of the certificate's 'notBefore' field is invalid." msgstr "O formato de data do campo «notBefore» do certificado é incorrecto." #. +> trunk5 #: kssl/ksslcertificate.cpp:1091 #, kde-format msgid "The time format of the certificate's 'notAfter' field is invalid." msgstr "O formato de data do campo «notAfter» do certificado é incorrecto." #. +> trunk5 #: kssl/ksslcertificate.cpp:1093 #, kde-format -msgid "The time format of the CRL's (Certificate Revocation List) 'lastUpdate' field is invalid." -msgstr "O formato de data do campo «lastUpdate» da CRL (Lista de Revogado do Certificado) é incorrecto." +msgid "" +"The time format of the CRL's (Certificate Revocation List) 'lastUpdate' field" +" is invalid." +msgstr "" +"O formato de data do campo «lastUpdate» da CRL (Lista de Revogado do" +" Certificado) é incorrecto." #. +> trunk5 #: kssl/ksslcertificate.cpp:1095 #, kde-format -msgid "The time format of the CRL's (Certificate Revocation List) 'nextUpdate' field is invalid." -msgstr "O formato de data do campo «nextUpdate» da CRL (Lista de Revogado do Certificado) é incorrecto." +msgid "" +"The time format of the CRL's (Certificate Revocation List) 'nextUpdate' field" +" is invalid." +msgstr "" +"O formato de data do campo «nextUpdate» da CRL (Lista de Revogado do" +" Certificado) é incorrecto." #. +> trunk5 #: kssl/ksslcertificate.cpp:1097 #, kde-format msgid "The OpenSSL process ran out of memory." msgstr "O proceso OpenSSL esgotou a memoria." #. +> trunk5 #: kssl/ksslcertificate.cpp:1099 #, kde-format -msgid "The certificate is self-signed and not in the list of trusted certificates. If you want to accept this certificate, import it into the list of trusted certificates." -msgstr "O certificado está autoasinado e non está na lista de certificados verificados. Se quere aceptar este certificado, impórteo á lista de certificados verificados." +msgid "" +"The certificate is self-signed and not in the list of trusted certificates." +" If you want to accept this certificate, import it into the list of trusted" +" certificates." +msgstr "" +"O certificado está autoasinado e non está na lista de certificados" +" verificados. Se quere aceptar este certificado, impórteo á lista de" +" certificados verificados." #. +> trunk5 #: kssl/ksslcertificate.cpp:1102 #, kde-format -msgid "The certificate is self-signed. While the trust chain could be built up, the root CA's (Certificate Authority) certificate can not be found." -msgstr "O certificado está autoasinado. Aínda que se podería construír a cadea de confianza, non se pode atopar a CA (Autoridade de Certificación) raíz do certificado." +msgid "" +"The certificate is self-signed. While the trust chain could be built up, the" +" root CA's (Certificate Authority) certificate can not be found." +msgstr "" +"O certificado está autoasinado. Aínda que se podería construír a cadea de" +" confianza, non se pode atopar a CA (Autoridade de Certificación) raíz do" +" certificado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1104 #, kde-format -msgid "The CA's (Certificate Authority) certificate can not be found. Most likely, your trust chain is broken." -msgstr "Non se pode atopar a CA (Autoridade de Certificación) do certificado. Posibelmente se estragase a súa cadea de confianza." +msgid "" +"The CA's (Certificate Authority) certificate can not be found. Most likely," +" your trust chain is broken." +msgstr "" +"Non se pode atopar a CA (Autoridade de Certificación) do certificado." +" Posibelmente se estragase a súa cadea de confianza." #. +> trunk5 #: kssl/ksslcertificate.cpp:1106 #, kde-format -msgid "The certificate can not be verified as it is the only certificate in the trust chain and not self-signed. If you self-sign the certificate, make sure to import it into the list of trusted certificates." -msgstr "Non se pode verificar o certificado xa que é o único na cadea de confianza e non está autoasinado. Se autoasina o certificado asegúrese de importalo á lista de certificados de confianza." +msgid "" +"The certificate can not be verified as it is the only certificate in the" +" trust chain and not self-signed. If you self-sign the certificate, make sure" +" to import it into the list of trusted certificates." +msgstr "" +"Non se pode verificar o certificado xa que é o único na cadea de confianza e" +" non está autoasinado. Se autoasina o certificado asegúrese de importalo á" +" lista de certificados de confianza." #. +> trunk5 #: kssl/ksslcertificate.cpp:1108 #, kde-format msgid "The certificate chain is longer than the maximum depth specified." -msgstr "A cadea do certificado é máis longa que a profundidade máxima especificada." +msgstr "" +"A cadea do certificado é máis longa que a profundidade máxima especificada." #. +> trunk5 #: kssl/ksslcertificate.cpp:1111 #, kde-format msgid "The certificate has been revoked." msgstr "O certificado revogouse." #. +> trunk5 #: kssl/ksslcertificate.cpp:1113 #, kde-format msgid "The certificate's CA (Certificate Authority) is invalid." msgstr "A CA (Autoridade de Certificación) do certificado é incorrecta." #. +> trunk5 #: kssl/ksslcertificate.cpp:1115 #, kde-format -msgid "The length of the trust chain exceeded one of the CA's (Certificate Authority) 'pathlength' parameters, making all subsequent signatures invalid." -msgstr "A lonxitude da cadea de confianza supera a do parámetro «pathlength» da EC (Entidade de Certificación), facendo que todas as demais sinaturas sexan incorrectas." +msgid "" +"The length of the trust chain exceeded one of the CA's (Certificate" +" Authority) 'pathlength' parameters, making all subsequent signatures invalid." +msgstr "" +"A lonxitude da cadea de confianza supera a do parámetro «pathlength» da EC" +" (Entidade de Certificación), facendo que todas as demais sinaturas sexan" +" incorrectas." #. +> trunk5 #: kssl/ksslcertificate.cpp:1117 #, kde-format -msgid "The certificate has not been signed for the purpose you tried to use it for. This means the CA (Certificate Authority) does not allow this usage." -msgstr "O certificado non se asinou para o propósito que o intentou usar. Isto significa que a CA (Autoridade de Certificación) non permite este uso." +msgid "" +"The certificate has not been signed for the purpose you tried to use it for." +" This means the CA (Certificate Authority) does not allow this usage." +msgstr "" +"O certificado non se asinou para o propósito que o intentou usar. Isto" +" significa que a CA (Autoridade de Certificación) non permite este uso." #. +> trunk5 #: kssl/ksslcertificate.cpp:1120 #, kde-format -msgid "The root CA (Certificate Authority) is not trusted for the purpose you tried to use this certificate for." -msgstr "A CA (Autoridade de Certificación) raíz non está validada para o propósito que intentou usar este certificado." +msgid "" +"The root CA (Certificate Authority) is not trusted for the purpose you tried" +" to use this certificate for." +msgstr "" +"A CA (Autoridade de Certificación) raíz non está validada para o propósito" +" que intentou usar este certificado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1123 #, kde-format -msgid "The root CA (Certificate Authority) has been marked to be rejected for the purpose you tried to use it for." -msgstr "A CA (Autoridade de Certificación) raíz marcouse para rexeitar para o propósito para o que intentou usar este certificado." +msgid "" +"The root CA (Certificate Authority) has been marked to be rejected for the" +" purpose you tried to use it for." +msgstr "" +"A CA (Autoridade de Certificación) raíz marcouse para rexeitar para o" +" propósito para o que intentou usar este certificado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1125 #, kde-format -msgid "The certificate's CA (Certificate Authority) does not match the CA name of the certificate." -msgstr "A CA (Autoridade de Certificación) do certificado non coincide co nome da CA do certificado." +msgid "" +"The certificate's CA (Certificate Authority) does not match the CA name of" +" the certificate." +msgstr "" +"A CA (Autoridade de Certificación) do certificado non coincide co nome da CA" +" do certificado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1127 #, kde-format -msgid "The CA (Certificate Authority) certificate's key ID does not match the key ID in the 'Issuer' section of the certificate you are trying to use." -msgstr "A ID da chave do certificado da CA (Autoridade de Certificación) non coincide coa ID da sección «Issuer» do certificado que está a intentar usar." +msgid "" +"The CA (Certificate Authority) certificate's key ID does not match the key ID" +" in the 'Issuer' section of the certificate you are trying to use." +msgstr "" +"A ID da chave do certificado da CA (Autoridade de Certificación) non coincide" +" coa ID da sección «Issuer» do certificado que está a intentar usar." #. +> trunk5 #: kssl/ksslcertificate.cpp:1129 #, kde-format -msgid "The CA (Certificate Authority) certificate's key ID and name do not match the key ID and name in the 'Issuer' section of the certificate you are trying to use." -msgstr "O ID da chave e o nome do certificado da CA (Autoridade de Certificación) non coinciden co ID e o nome na sección «Issuer» do certificado que está a intentar usar." +msgid "" +"The CA (Certificate Authority) certificate's key ID and name do not match the" +" key ID and name in the 'Issuer' section of the certificate you are trying to" +" use." +msgstr "" +"O ID da chave e o nome do certificado da CA (Autoridade de Certificación) non" +" coinciden co ID e o nome na sección «Issuer» do certificado que está a" +" intentar usar." #. +> trunk5 #: kssl/ksslcertificate.cpp:1131 #, kde-format -msgid "The certificate's CA (Certificate Authority) is not allowed to sign certificates." -msgstr "A CA (Autoridade de Certificación) do certificado non está autorizada a asinar certificados." +msgid "" +"The certificate's CA (Certificate Authority) is not allowed to sign" +" certificates." +msgstr "" +"A CA (Autoridade de Certificación) do certificado non está autorizada a" +" asinar certificados." #. +> trunk5 #: kssl/ksslcertificate.cpp:1133 #, kde-format msgid "OpenSSL could not be verified." msgstr "Non se puido verificar a OpenSSL." # skip-rule: noPT-2010-invalid #. +> trunk5 #: kssl/ksslcertificate.cpp:1137 #, kde-format -msgid "The signature test for this certificate failed. This could mean that the signature of this certificate or any in its trust path are invalid, could not be decoded or that the CRL (Certificate Revocation List) could not be verified. If you see this message, please let the author of the software you are using know that he or she should use the new, more specific error messages." -msgstr "Fallou a proba da sinatura deste certificado. Isto pode significar que a sinatura deste certificado ou dalgún na súa cadea de confianza sexa incorrecta, non se puido descodificar ou que a CRL (Lista de Revogado do Certificado) non poida verificarse. Se ve esta mensaxe, fágalle saber o autor do programa que está a usar que debería usar as novas mensaxes de erro máis específicas." +msgid "" +"The signature test for this certificate failed. This could mean that the" +" signature of this certificate or any in its trust path are invalid, could" +" not be decoded or that the CRL (Certificate Revocation List) could not be" +" verified. If you see this message, please let the author of the software you" +" are using know that he or she should use the new, more specific error" +" messages." +msgstr "" +"Fallou a proba da sinatura deste certificado. Isto pode significar que a" +" sinatura deste certificado ou dalgún na súa cadea de confianza sexa" +" incorrecta, non se puido descodificar ou que a CRL (Lista de Revogado do" +" Certificado) non poida verificarse. Se ve esta mensaxe, fágalle saber o" +" autor do programa que está a usar que debería usar as novas mensaxes de erro" +" máis específicas." #. +> trunk5 #: kssl/ksslcertificate.cpp:1139 #, kde-format -msgid "This certificate, any in its trust path or its CA's (Certificate Authority) CRL (Certificate Revocation List) is not valid. Any of them could not be valid yet or not valid any more. If you see this message, please let the author of the software you are using know that he or she should use the new, more specific error messages." -msgstr "Este certificado ou calquera na súa cadea de confianza ou na CRL (Lista de Revogado do Certificado) da súa EC (Entidade Certificadora) non é correcto. Calquera deles podería non ser correcto aínda ou non volver ser correcto nunca máis. Se ve esta mensaxe, fágalle saber ao autor do programa que está a usar que debería usar as novas mensaxes de erro máis específicas." +msgid "" +"This certificate, any in its trust path or its CA's (Certificate Authority)" +" CRL (Certificate Revocation List) is not valid. Any of them could not be" +" valid yet or not valid any more. If you see this message, please let the" +" author of the software you are using know that he or she should use the new," +" more specific error messages." +msgstr "" +"Este certificado ou calquera na súa cadea de confianza ou na CRL (Lista de" +" Revogado do Certificado) da súa EC (Entidade Certificadora) non é correcto." +" Calquera deles podería non ser correcto aínda ou non volver ser correcto" +" nunca máis. Se ve esta mensaxe, fágalle saber ao autor do programa que está" +" a usar que debería usar as novas mensaxes de erro máis específicas." #. +> trunk5 #: kssl/ksslcertificate.cpp:1145 #, kde-format -msgid "Certificate signing authority root files could not be found so the certificate is not verified." -msgstr "Non se puideron atopar os ficheiros raíz da autoridade asinante polo que o certificado non está verificado." +msgid "" +"Certificate signing authority root files could not be found so the" +" certificate is not verified." +msgstr "" +"Non se puideron atopar os ficheiros raíz da autoridade asinante polo que o" +" certificado non está verificado." #. +> trunk5 #: kssl/ksslcertificate.cpp:1147 #, kde-format msgid "SSL support was not found." msgstr "Non se atopou compatibilidade con SSL." #. +> trunk5 #: kssl/ksslcertificate.cpp:1149 #, kde-format msgid "Private key test failed." msgstr "Fallou a proba da chave privada." #. +> trunk5 #: kssl/ksslcertificate.cpp:1151 #, kde-format msgid "The certificate has not been issued for this host." msgstr "O certificado non se expendeu para este servidor." #. +> trunk5 #: kssl/ksslcertificate.cpp:1153 #, kde-format msgid "This certificate is not relevant." msgstr "Este certificado non é relevante." #. +> trunk5 #: kssl/ksslcertificate.cpp:1158 #, kde-format msgid "The certificate is invalid." msgstr "O certificado é incorrecto." #. +> trunk5 #: kssl/ksslutils.cpp:90 #, kde-format msgid "GMT" msgstr "GMT" Index: trunk/l10n-support/gl/summit/messages/frameworks/kwidgetsaddons5_qt.po =================================================================== --- trunk/l10n-support/gl/summit/messages/frameworks/kwidgetsaddons5_qt.po (revision 1557103) +++ trunk/l10n-support/gl/summit/messages/frameworks/kwidgetsaddons5_qt.po (revision 1557104) @@ -1,2852 +1,2852 @@ # translation of kdelibs4.po to galician # Copyright (C) YEAR This_file_is_part_of_KDE # This file is distributed under the same license as the PACKAGE package. # # Marce Villarino , 2007-2014. # Xosé , 2010. # Adrián Chaves Fernández , 2015, 2017. # Adrián Chaves (Gallaecio) , 2017, 2018, 2019. msgid "" msgstr "" "Project-Id-Version: kdelibs4\n" "Report-Msgid-Bugs-To: http://bugs.kde.org\n" "POT-Creation-Date: 2019-10-17 13:59+0200\n" -"PO-Revision-Date: 2019-11-28 00:31+0100\n" +"PO-Revision-Date: 2019-11-28 00:38+0100\n" "Last-Translator: Adrián Chaves (Gallaecio) \n" "Language-Team: Galician \n" "Language: gl\n" "MIME-Version: 1.0\n" "Content-Type: text/plain; charset=UTF-8\n" "Content-Transfer-Encoding: 8bit\n" "Plural-Forms: nplurals=2; plural=n != 1;\n" "X-Generator: Lokalize 19.08.3\n" #. Generic sans serif font presented in font choosers. When selected, the system will choose a real font, mandated by distro settings. #. +> trunk5 #: fonthelpers.cpp:29 msgctxt "FontHelpers|@item Font name" msgid "Sans Serif" msgstr "Sans Serif" #. Generic serif font presented in font choosers. When selected, the system will choose a real font, mandated by distro settings. #. +> trunk5 #: fonthelpers.cpp:32 msgctxt "FontHelpers|@item Font name" msgid "Serif" msgstr "Serif" #. Generic monospace font presented in font choosers. When selected, the system will choose a real font, mandated by distro settings. #. +> trunk5 #: fonthelpers.cpp:35 msgctxt "FontHelpers|@item Font name" msgid "Monospace" -msgstr "Monoespaciada" +msgstr "Monoespazo" #. +> trunk5 #: fonthelpers.cpp:78 #, qt-format msgctxt "FontHelpers|@item Font name" msgid "%1" msgstr "%1" #. +> trunk5 #: fonthelpers.cpp:82 #, qt-format msgctxt "FontHelpers|@item Font name [foundry]" msgid "%1 [%2]" msgstr "%1 [%2]" #. +> trunk5 #: kactionselector.cpp:106 msgctxt "KActionSelector|" msgid "&Available:" msgstr "&Dispoñíbel:" #. +> trunk5 #: kactionselector.cpp:123 msgctxt "KActionSelector|" msgid "&Selected:" msgstr "E&scollidas:" #. +> trunk5 #: kassistantdialog.cpp:105 msgctxt "KAssistantDialog|go back" msgid "&Back" msgstr "&Atrás" #. +> trunk5 #: kassistantdialog.cpp:107 msgctxt "KAssistantDialog|" msgid "Go back one step" msgstr "Retroceder un paso" #. +> trunk5 #: kassistantdialog.cpp:112 msgctxt "KAssistantDialog|Opposite to Back" msgid "Next" msgstr "Seguinte" #. +> trunk5 #: kassistantdialog.cpp:119 msgctxt "KAssistantDialog|" msgid "Finish" msgstr "Finalizar" #. +> trunk5 #: kcharselect-translation.cpp:24 msgctxt "KCharSelectData|KCharSelect section name" msgid "European Scripts" msgstr "Escritas europeas" #. +> trunk5 #: kcharselect-translation.cpp:25 msgctxt "KCharSelectData|KCharSelect section name" msgid "African Scripts" msgstr "Escritas africanas" #. +> trunk5 #: kcharselect-translation.cpp:26 msgctxt "KCharSelectData|KCharSelect section name" msgid "Middle Eastern Scripts" msgstr "Escritas do Oriente Medio" #. +> trunk5 #: kcharselect-translation.cpp:27 msgctxt "KCharSelectData|KCharSelect section name" msgid "Central Asian Scripts" msgstr "Escritas centroasiáticas" #. +> trunk5 #: kcharselect-translation.cpp:28 msgctxt "KCharSelectData|KCharSelect section name" msgid "South Asian Scripts" msgstr "Escritas do sueste de Asia" #. +> trunk5 #: kcharselect-translation.cpp:29 msgctxt "KCharSelectData|KCharSelect section name" msgid "Southeast Asian Scripts" msgstr "Escritas do sueste de Asia" #. +> trunk5 #: kcharselect-translation.cpp:30 msgctxt "KCharSelectData|KCharSelect section name" msgid "Indonesia and Oceania Scripts" msgstr "Escritas de Indonesia e Oceanía" #. +> trunk5 #: kcharselect-translation.cpp:31 msgctxt "KCharSelectData|KCharSelect section name" msgid "East Asian Scripts" msgstr "Escritas do leste de Asia" #. +> trunk5 #: kcharselect-translation.cpp:32 msgctxt "KCharSelectData|KCharSelect section name" msgid "American Scripts" msgstr "Escritas americanas" #. +> trunk5 #: kcharselect-translation.cpp:33 msgctxt "KCharSelectData|KCharSelect section name" msgid "Symbols" msgstr "Símbolos" #. +> trunk5 #: kcharselect-translation.cpp:34 msgctxt "KCharSelectData|KCharSelect section name" msgid "Mathematical Symbols" msgstr "Símbolos matemáticos" #. +> trunk5 #: kcharselect-translation.cpp:35 msgctxt "KCharSelectData|KCharSelect section name" msgid "Phonetic Symbols" msgstr "Símbolos fonéticos" #. +> trunk5 #: kcharselect-translation.cpp:36 kcharselectdata.cpp:750 msgctxt "KCharSelectData|KCharSelect section name" msgid "Combining Diacritics" msgstr "Diacríticos combinatorios" #. +> trunk5 #: kcharselect-translation.cpp:37 msgctxt "KCharSelectData|KCharSelect section name" msgid "Other" msgstr "Outro" #. +> trunk5 #: kcharselect-translation.cpp:38 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Basic Latin" msgstr "Latino básico" #. +> trunk5 #: kcharselect-translation.cpp:39 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Latin-1 Supplement" msgstr "Suplemento de Latin-1" #. +> trunk5 #: kcharselect-translation.cpp:40 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Latin Extended-A" msgstr "Latino ampliado-A" #. +> trunk5 #: kcharselect-translation.cpp:41 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Latin Extended-B" msgstr "Latino Ampliado-B" #. +> trunk5 #: kcharselect-translation.cpp:42 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "IPA Extensions" msgstr "Extensións do IPA" #. +> trunk5 #: kcharselect-translation.cpp:43 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Spacing Modifier Letters" msgstr "Letras modificadoras do espazado" #. +> trunk5 #: kcharselect-translation.cpp:44 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Combining Diacritical Marks" msgstr "Sinais diacríticos combinatorios" #. +> trunk5 #: kcharselect-translation.cpp:45 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Greek and Coptic" msgstr "Grego e copto" #. +> trunk5 #: kcharselect-translation.cpp:46 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cyrillic" msgstr "Cirílico" #. +> trunk5 #: kcharselect-translation.cpp:47 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cyrillic Supplement" msgstr "Suplemento cirílico" #. +> trunk5 #: kcharselect-translation.cpp:48 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Armenian" msgstr "Armenio" #. +> trunk5 #: kcharselect-translation.cpp:49 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hebrew" msgstr "Hebreo" #. +> trunk5 #: kcharselect-translation.cpp:50 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Arabic" msgstr "Árabe" #. +> trunk5 #: kcharselect-translation.cpp:51 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Syriac" msgstr "Sirio" #. +> trunk5 #: kcharselect-translation.cpp:52 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Arabic Supplement" msgstr "Suplemento árabe" #. +> trunk5 #: kcharselect-translation.cpp:53 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Thaana" msgstr "Thaana" #. +> trunk5 #: kcharselect-translation.cpp:54 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "NKo" msgstr "NKo" #. +> trunk5 #: kcharselect-translation.cpp:55 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Samaritan" msgstr "Samaritano" #. +> trunk5 #: kcharselect-translation.cpp:56 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Mandaic" msgstr "Mandeo" #. +> trunk5 #: kcharselect-translation.cpp:57 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Syriac Supplement" msgstr "Suplemento siríaco" #. +> trunk5 #: kcharselect-translation.cpp:58 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Arabic Extended-A" msgstr "Árabe ampliado-A" #. +> trunk5 #: kcharselect-translation.cpp:59 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Devanagari" msgstr "Devanagárico" #. +> trunk5 #: kcharselect-translation.cpp:60 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Bengali" msgstr "Bengalí" #. +> trunk5 #: kcharselect-translation.cpp:61 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Gurmukhi" msgstr "Gurmukhi" #. +> trunk5 #: kcharselect-translation.cpp:62 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Gujarati" msgstr "Guxaratí" #. +> trunk5 #: kcharselect-translation.cpp:63 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Oriya" msgstr "Orixa" #. +> trunk5 #: kcharselect-translation.cpp:64 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tamil" msgstr "Tamil" #. +> trunk5 #: kcharselect-translation.cpp:65 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Telugu" msgstr "Telugu" #. +> trunk5 #: kcharselect-translation.cpp:66 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Kannada" msgstr "Kannada" #. +> trunk5 #: kcharselect-translation.cpp:67 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Malayalam" msgstr "Malayalam" #. +> trunk5 #: kcharselect-translation.cpp:68 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Sinhala" msgstr "Sinhala" #. +> trunk5 #: kcharselect-translation.cpp:69 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Thai" msgstr "Tailandés" #. +> trunk5 #: kcharselect-translation.cpp:70 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Lao" msgstr "Lao" #. +> trunk5 #: kcharselect-translation.cpp:71 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tibetan" msgstr "Tibetano" #. +> trunk5 #: kcharselect-translation.cpp:72 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Myanmar" msgstr "Myanmar" #. +> trunk5 #: kcharselect-translation.cpp:73 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Georgian" msgstr "Xeorxiano" #. +> trunk5 #: kcharselect-translation.cpp:74 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hangul Jamo" msgstr "Hangul Jamo" #. +> trunk5 #: kcharselect-translation.cpp:75 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ethiopic" msgstr "Etíope" #. +> trunk5 #: kcharselect-translation.cpp:76 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ethiopic Supplement" msgstr "Suplemento etíope" #. +> trunk5 #: kcharselect-translation.cpp:77 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cherokee" msgstr "Cherokee" #. +> trunk5 #: kcharselect-translation.cpp:78 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Unified Canadian Aboriginal Syllabics" msgstr "Silábico unificado dos aborixes canadenses" #. +> trunk5 #: kcharselect-translation.cpp:79 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ogham" msgstr "Ogham" #. +> trunk5 #: kcharselect-translation.cpp:80 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Runic" msgstr "Rúnico" #. +> trunk5 #: kcharselect-translation.cpp:81 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tagalog" msgstr "Tagalo" #. +> trunk5 #: kcharselect-translation.cpp:82 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hanunoo" msgstr "Hanunoo" #. +> trunk5 #: kcharselect-translation.cpp:83 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Buhid" msgstr "Buhid" #. +> trunk5 #: kcharselect-translation.cpp:84 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tagbanwa" msgstr "Tagbanwa" #. +> trunk5 #: kcharselect-translation.cpp:85 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Khmer" msgstr "Khmer" #. +> trunk5 #: kcharselect-translation.cpp:86 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Mongolian" msgstr "Mongol" #. +> trunk5 #: kcharselect-translation.cpp:87 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Unified Canadian Aboriginal Syllabics Extended" msgstr "Silábico unificado ampliado dos aborixes canadenses" #. +> trunk5 #: kcharselect-translation.cpp:88 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Limbu" msgstr "Limbu" #. +> trunk5 #: kcharselect-translation.cpp:89 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tai Le" msgstr "Tai Le" #. +> trunk5 #: kcharselect-translation.cpp:90 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "New Tai Lue" msgstr "Tai Lue novo" #. +> trunk5 #: kcharselect-translation.cpp:91 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Khmer Symbols" msgstr "Símbolos Khmer" # skip-rule: PT-2011_bug #. +> trunk5 #: kcharselect-translation.cpp:92 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Buginese" msgstr "Buxinés" #. +> trunk5 #: kcharselect-translation.cpp:93 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tai Tham" msgstr "Tai Tham" #. +> trunk5 #: kcharselect-translation.cpp:94 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Combining Diacritical Marks Extended" msgstr "Sinais diacríticos combinatorios ampliado" #. +> trunk5 #: kcharselect-translation.cpp:95 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Balinese" msgstr "Balinés" #. +> trunk5 #: kcharselect-translation.cpp:96 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Sundanese" msgstr "Sundanés" #. +> trunk5 #: kcharselect-translation.cpp:97 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Batak" msgstr "Batak" #. +> trunk5 #: kcharselect-translation.cpp:98 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Lepcha" msgstr "Lepcha" #. +> trunk5 #: kcharselect-translation.cpp:99 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ol Chiki" msgstr "Ol Chiki" #. +> trunk5 #: kcharselect-translation.cpp:100 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cyrillic Extended-C" msgstr "Cirílico ampliado-C" #. +> trunk5 #: kcharselect-translation.cpp:101 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Georgian Extended" msgstr "Xeorxiano estendido" #. +> trunk5 #: kcharselect-translation.cpp:102 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Sundanese Supplement" msgstr "Suplemento sundanés" #. +> trunk5 #: kcharselect-translation.cpp:103 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Vedic Extensions" msgstr "Extensións védicas" #. +> trunk5 #: kcharselect-translation.cpp:104 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Phonetic Extensions" msgstr "Extensións fonéticas" #. +> trunk5 #: kcharselect-translation.cpp:105 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Phonetic Extensions Supplement" msgstr "Suplemento de extensións fonéticas" #. +> trunk5 #: kcharselect-translation.cpp:106 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Combining Diacritical Marks Supplement" msgstr "Suplemento de sinais diacríticos combinatorios" #. +> trunk5 #: kcharselect-translation.cpp:107 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Latin Extended Additional" msgstr "Latino ampliado adicional" #. +> trunk5 #: kcharselect-translation.cpp:108 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Greek Extended" msgstr "Grego ampliado" #. +> trunk5 #: kcharselect-translation.cpp:109 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "General Punctuation" msgstr "Puntuación xeral" #. +> trunk5 #: kcharselect-translation.cpp:110 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Superscripts and Subscripts" msgstr "Superíndices e subíndices" #. +> trunk5 #: kcharselect-translation.cpp:111 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Currency Symbols" msgstr "Símbolos de divisas" #. +> trunk5 #: kcharselect-translation.cpp:112 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Combining Diacritical Marks for Symbols" msgstr "Sinais diacríticos combinatorios para símbolos" #. +> trunk5 #: kcharselect-translation.cpp:113 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Letterlike Symbols" msgstr "Símbolos ao estilo de letras" #. +> trunk5 #: kcharselect-translation.cpp:114 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Number Forms" msgstr "Formas numéricas" #. +> trunk5 #: kcharselect-translation.cpp:115 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Arrows" msgstr "Frechas" #. +> trunk5 #: kcharselect-translation.cpp:116 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Mathematical Operators" msgstr "Operadores matemáticos" #. +> trunk5 #: kcharselect-translation.cpp:117 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Miscellaneous Technical" msgstr "Símbolos técnicos diversos" #. +> trunk5 #: kcharselect-translation.cpp:118 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Control Pictures" msgstr "Imaxes de control" #. +> trunk5 #: kcharselect-translation.cpp:119 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Optical Character Recognition" msgstr "Recoñecemento óptico de caracteres" #. +> trunk5 #: kcharselect-translation.cpp:120 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Enclosed Alphanumerics" msgstr "Símbolos alfanuméricos contidos" #. +> trunk5 #: kcharselect-translation.cpp:121 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Box Drawing" msgstr "Debuxo de caixa" #. +> trunk5 #: kcharselect-translation.cpp:122 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Block Elements" msgstr "Elementos de bloque" #. +> trunk5 #: kcharselect-translation.cpp:123 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Geometric Shapes" msgstr "Formas xeométricas" #. +> trunk5 #: kcharselect-translation.cpp:124 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Miscellaneous Symbols" msgstr "Símbolos diversos" #. +> trunk5 #: kcharselect-translation.cpp:125 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Dingbats" msgstr "Viñetas" #. +> trunk5 #: kcharselect-translation.cpp:126 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Miscellaneous Mathematical Symbols-A" msgstr "Símbolos matemáticos diversos - A" #. +> trunk5 #: kcharselect-translation.cpp:127 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Supplemental Arrows-A" msgstr "Frechas adicionais - A" #. +> trunk5 #: kcharselect-translation.cpp:128 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Braille Patterns" msgstr "Padróns de Braille" #. +> trunk5 #: kcharselect-translation.cpp:129 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Supplemental Arrows-B" msgstr "Frechas adicionais - B" #. +> trunk5 #: kcharselect-translation.cpp:130 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Miscellaneous Mathematical Symbols-B" msgstr "Símbolos matemáticos diversos - B" #. +> trunk5 #: kcharselect-translation.cpp:131 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Supplemental Mathematical Operators" msgstr "Operadores matemáticos adicionais" #. +> trunk5 #: kcharselect-translation.cpp:132 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Miscellaneous Symbols and Arrows" msgstr "Símbolos e frechas diversos" #. +> trunk5 #: kcharselect-translation.cpp:133 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Glagolitic" msgstr "Glagolítico" #. +> trunk5 #: kcharselect-translation.cpp:134 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Latin Extended-C" msgstr "Latino ampliado-C" #. +> trunk5 #: kcharselect-translation.cpp:135 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Coptic" msgstr "Copto" #. +> trunk5 #: kcharselect-translation.cpp:136 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Georgian Supplement" msgstr "Suplemento de xeorxiano" #. +> trunk5 #: kcharselect-translation.cpp:137 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tifinagh" msgstr "Tifinagh" #. +> trunk5 #: kcharselect-translation.cpp:138 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ethiopic Extended" msgstr "Etíope ampliado" #. +> trunk5 #: kcharselect-translation.cpp:139 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cyrillic Extended-A" msgstr "Cirílico ampliado-A" #. +> trunk5 #: kcharselect-translation.cpp:140 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Supplemental Punctuation" msgstr "Puntuación adicional" #. +> trunk5 #: kcharselect-translation.cpp:141 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Radicals Supplement" msgstr "Suplemento de radicais CJK" #. +> trunk5 #: kcharselect-translation.cpp:142 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Kangxi Radicals" msgstr "Radicais kangxi" #. +> trunk5 #: kcharselect-translation.cpp:143 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ideographic Description Characters" msgstr "Caracteres de descrición ideográfica" #. +> trunk5 #: kcharselect-translation.cpp:144 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Symbols and Punctuation" msgstr "Símbolos e puntuación CJK" #. +> trunk5 #: kcharselect-translation.cpp:145 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hiragana" msgstr "Hiragana" #. +> trunk5 #: kcharselect-translation.cpp:146 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Katakana" msgstr "Katakana" #. +> trunk5 #: kcharselect-translation.cpp:147 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Bopomofo" msgstr "Bopomofo" #. +> trunk5 #: kcharselect-translation.cpp:148 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hangul Compatibility Jamo" msgstr "Jamo compatíbel con Hangul" #. +> trunk5 #: kcharselect-translation.cpp:149 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Kanbun" msgstr "Kanbun" #. +> trunk5 #: kcharselect-translation.cpp:150 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Bopomofo Extended" msgstr "Bopomofo ampliado" #. +> trunk5 #: kcharselect-translation.cpp:151 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Strokes" msgstr "Trazos CJK" #. +> trunk5 #: kcharselect-translation.cpp:152 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Katakana Phonetic Extensions" msgstr "Extensións fonéticas Katakana" #. +> trunk5 #: kcharselect-translation.cpp:153 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Enclosed CJK Letters and Months" msgstr "Letras e meses anexados CJK" #. +> trunk5 #: kcharselect-translation.cpp:154 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Compatibility" msgstr "Compatibilidade con CJK" #. +> trunk5 #: kcharselect-translation.cpp:155 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Unified Ideographs Extension A" msgstr "Ideogramas CJK unificados ampliación A" #. +> trunk5 #: kcharselect-translation.cpp:156 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Yijing Hexagram Symbols" msgstr "Símbolos de hexagrama Yijing" #. +> trunk5 #: kcharselect-translation.cpp:157 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Unified Ideographs" msgstr "Ideogramas unificados CJK" #. +> trunk5 #: kcharselect-translation.cpp:158 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Yi Syllables" msgstr "Sílabas Yi" #. +> trunk5 #: kcharselect-translation.cpp:159 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Yi Radicals" msgstr "Radicais Yi" #. +> trunk5 #: kcharselect-translation.cpp:160 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Lisu" msgstr "Lisu" #. +> trunk5 #: kcharselect-translation.cpp:161 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Vai" msgstr "Vai" #. +> trunk5 #: kcharselect-translation.cpp:162 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cyrillic Extended-B" msgstr "Cirílico ampliado-B" #. +> trunk5 #: kcharselect-translation.cpp:163 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Bamum" msgstr "Bamum" #. +> trunk5 #: kcharselect-translation.cpp:164 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Modifier Tone Letters" msgstr "Letra modificadoras do ton" #. +> trunk5 #: kcharselect-translation.cpp:165 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Latin Extended-D" msgstr "Latino ampliado - D" #. +> trunk5 #: kcharselect-translation.cpp:166 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Syloti Nagri" msgstr "Syloti Nagri" #. +> trunk5 #: kcharselect-translation.cpp:167 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Common Indic Number Forms" msgstr "Formas numéricas índicas habituais" #. +> trunk5 #: kcharselect-translation.cpp:168 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Phags-pa" msgstr "Phags-pa" #. +> trunk5 #: kcharselect-translation.cpp:169 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Saurashtra" msgstr "Saurashtra" #. +> trunk5 #: kcharselect-translation.cpp:170 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Devanagari Extended" msgstr "Devanagárico ampliado" #. +> trunk5 #: kcharselect-translation.cpp:171 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Kayah Li" msgstr "Kayah Li" #. +> trunk5 #: kcharselect-translation.cpp:172 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Rejang" msgstr "Rejang" #. +> trunk5 #: kcharselect-translation.cpp:173 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hangul Jamo Extended-A" msgstr "Hangul Jamo ampliado-A" #. +> trunk5 #: kcharselect-translation.cpp:174 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Javanese" msgstr "Xavanés" #. +> trunk5 #: kcharselect-translation.cpp:175 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Myanmar Extended-B" msgstr "Myanmar ampliado-B" #. +> trunk5 #: kcharselect-translation.cpp:176 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cham" msgstr "Cham" #. +> trunk5 #: kcharselect-translation.cpp:177 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Myanmar Extended-A" msgstr "Myanmar ampliado-A" #. +> trunk5 #: kcharselect-translation.cpp:178 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Tai Viet" msgstr "Tai Viet" #. +> trunk5 #: kcharselect-translation.cpp:179 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Meetei Mayek Extensions" msgstr "Ampliacións de Meetei Mayek" #. +> trunk5 #: kcharselect-translation.cpp:180 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ethiopic Extended-A" msgstr "Etíope ampliado-A" #. +> trunk5 #: kcharselect-translation.cpp:181 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Latin Extended-E" msgstr "Latino ampliado-E" #. +> trunk5 #: kcharselect-translation.cpp:182 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Cherokee Supplement" msgstr "Suplemento cherokee" #. +> trunk5 #: kcharselect-translation.cpp:183 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Meetei Mayek" msgstr "Meetei Mayek" #. +> trunk5 #: kcharselect-translation.cpp:184 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hangul Syllables" msgstr "Sílabas Hangul" #. +> trunk5 #: kcharselect-translation.cpp:185 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Hangul Jamo Extended-B" msgstr "Hangul Jamo ampliado-B" #. +> trunk5 #: kcharselect-translation.cpp:186 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "High Surrogates" msgstr "Substitutos altos" #. +> trunk5 #: kcharselect-translation.cpp:187 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "High Private Use Surrogates" msgstr "Substitutos altos de uso privado" #. +> trunk5 #: kcharselect-translation.cpp:188 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Low Surrogates" msgstr "Substitutos baixos" #. +> trunk5 #: kcharselect-translation.cpp:189 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Private Use Area" msgstr "Área de uso privado" #. +> trunk5 #: kcharselect-translation.cpp:190 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Compatibility Ideographs" msgstr "Ideogramas de compatibilidade CJK" #. +> trunk5 #: kcharselect-translation.cpp:191 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Alphabetic Presentation Forms" msgstr "Formas de presentación alfabética" #. +> trunk5 #: kcharselect-translation.cpp:192 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Arabic Presentation Forms-A" msgstr "Formas de presentación árabe - A" #. +> trunk5 #: kcharselect-translation.cpp:193 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Variation Selectors" msgstr "Selectores de variación" #. +> trunk5 #: kcharselect-translation.cpp:194 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Vertical Forms" msgstr "Formas verticais" #. +> trunk5 #: kcharselect-translation.cpp:195 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Combining Half Marks" msgstr "Medias marcas de combinación" #. +> trunk5 #: kcharselect-translation.cpp:196 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "CJK Compatibility Forms" msgstr "Formas de compatibilidade CJK" #. +> trunk5 #: kcharselect-translation.cpp:197 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Small Form Variants" msgstr "Variantes de formas pequenas" #. +> trunk5 #: kcharselect-translation.cpp:198 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Arabic Presentation Forms-B" msgstr "Formas de presentación árabe - B" #. +> trunk5 #: kcharselect-translation.cpp:199 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Halfwidth and Fullwidth Forms" msgstr "Formas de anchura media e completa" #. +> trunk5 #: kcharselect-translation.cpp:200 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Specials" msgstr "Especiais" #. +> trunk5 #: kcharselect-translation.cpp:202 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Mahjong Tiles" msgstr "Pezas de mahjong" #. +> trunk5 #: kcharselect-translation.cpp:203 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Domino Tiles" msgstr "Pezas de dominó" #. +> trunk5 #: kcharselect-translation.cpp:204 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Playing Cards" msgstr "Cartas da baralla" #. +> trunk5 #: kcharselect-translation.cpp:205 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Enclosed Alphanumeric Supplement" msgstr "Suplemento alfanumérico envolto" #. +> trunk5 #: kcharselect-translation.cpp:206 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Enclosed Ideographic Supplement" msgstr "Suplemento ideográfico envolto" #. +> trunk5 #: kcharselect-translation.cpp:207 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Miscellaneous Symbols and Pictographs" msgstr "Símbolos e pictogramas diversos" #. +> trunk5 #: kcharselect-translation.cpp:208 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Emoticons" msgstr "Emoticonas" #. +> trunk5 #: kcharselect-translation.cpp:209 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Ornamental Dingbats" msgstr "Viñetas ornamentais" #. +> trunk5 #: kcharselect-translation.cpp:210 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Transport and Map Symbols" msgstr "Símbolos de transporte e de mapas" #. +> trunk5 #: kcharselect-translation.cpp:211 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Alchemical Symbols" msgstr "Símbolos alquímicos" #. +> trunk5 #: kcharselect-translation.cpp:212 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Geometric Shapes Extended" msgstr "Formas xeométricas ampliadas" #. +> trunk5 #: kcharselect-translation.cpp:213 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Supplemental Arrows-C" msgstr "Frechas adicionais - C" #. +> trunk5 #: kcharselect-translation.cpp:214 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Supplemental Symbols and Pictographs" msgstr "Símbolos e pictogramas adicionais" #. +> trunk5 #: kcharselect-translation.cpp:215 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Chess Symbols" msgstr "Símbolos de xadrez" #. +> trunk5 #: kcharselect-translation.cpp:216 msgctxt "KCharSelectData|KCharselect unicode block name" msgid "Symbols and Pictographs Extended-A" msgstr "Símbolos e pictogramas ampliado-A" #. +> trunk5 #: kcharselect.cpp:405 kcharselect.cpp:407 msgctxt "KCharSelect|" msgid "Enter a search term or character here" msgstr "Insira aquí un termo ou carácter para buscalo" #. +> trunk5 #: kcharselect.cpp:412 msgctxt "KCharSelect|" msgid "&Find..." msgstr "&Atopar…" #. +> trunk5 #: kcharselect.cpp:432 msgctxt "KCharSelect|Goes to previous character" msgid "Previous in History" msgstr "Anterior no historial" #. +> trunk5 #: kcharselect.cpp:434 msgctxt "KCharSelect|" msgid "Previous Character in History" msgstr "Carácter anterior no historial" #. +> trunk5 #: kcharselect.cpp:439 msgctxt "KCharSelect|Goes to next character" msgid "Next in History" msgstr "Seguinte no historial" #. +> trunk5 #: kcharselect.cpp:441 msgctxt "KCharSelect|" msgid "Next Character in History" msgstr "Carácter seguinte no historial" #. +> trunk5 #: kcharselect.cpp:446 msgctxt "KCharSelect|go back" msgid "&Back" msgstr "&Atrás" #. +> trunk5 #: kcharselect.cpp:453 msgctxt "KCharSelect|go forward" msgid "&Forward" msgstr "A&diante" #. +> trunk5 #: kcharselect.cpp:468 msgctxt "KCharSelect|" msgid "Select a category" msgstr "Escoller unha categoría" #. +> trunk5 #: kcharselect.cpp:472 msgctxt "KCharSelect|" msgid "Select a block to be displayed" msgstr "Escoller un bloque para mostralo" #. +> trunk5 #: kcharselect.cpp:485 msgctxt "KCharSelect|" msgid "Set font" msgstr "Definir a fonte" #. +> trunk5 #: kcharselect.cpp:492 msgctxt "KCharSelect|" msgid "Set font size" msgstr "Escoller o tamaño do tipo de letra" #. +> trunk5 #: kcharselect.cpp:780 msgctxt "KCharSelect|" msgid "Character:" msgstr "Carácter:" #. +> trunk5 #: kcharselect.cpp:786 msgctxt "KCharSelect|" msgid "Name: " msgstr "Nome: " #. +> trunk5 #: kcharselect.cpp:795 msgctxt "KCharSelect|" msgid "Annotations and Cross References" msgstr "Anotacións e referencias cruzadas" #. +> trunk5 #: kcharselect.cpp:799 msgctxt "KCharSelect|" msgid "Alias names:" msgstr "Alcumes:" #. +> trunk5 #: kcharselect.cpp:807 msgctxt "KCharSelect|" msgid "Notes:" msgstr "Notas:" #. +> trunk5 #: kcharselect.cpp:815 msgctxt "KCharSelect|" msgid "See also:" msgstr "Consulte tamén:" #. +> trunk5 #: kcharselect.cpp:830 msgctxt "KCharSelect|" msgid "Equivalents:" msgstr "Equivalentes:" #. +> trunk5 #: kcharselect.cpp:838 msgctxt "KCharSelect|" msgid "Approximate equivalents:" msgstr "Equivalentes aproximados:" #. +> trunk5 #: kcharselect.cpp:846 msgctxt "KCharSelect|" msgid "Decomposition:" msgstr "Descomposición:" #. +> trunk5 #: kcharselect.cpp:858 msgctxt "KCharSelect|" msgid "CJK Ideograph Information" msgstr "Información do ideógrafo CJK" #. +> trunk5 #: kcharselect.cpp:861 msgctxt "KCharSelect|" msgid "Definition in English: " msgstr "Definición en inglés: " #. +> trunk5 #: kcharselect.cpp:868 msgctxt "KCharSelect|" msgid "Mandarin Pronunciation: " msgstr "Pronuncia en mandarín: " #. +> trunk5 #: kcharselect.cpp:875 msgctxt "KCharSelect|" msgid "Cantonese Pronunciation: " msgstr "Pronuncia en cantonés: " #. +> trunk5 #: kcharselect.cpp:882 msgctxt "KCharSelect|" msgid "Japanese On Pronunciation: " msgstr "Pronuncia en xaponés On: " #. +> trunk5 #: kcharselect.cpp:889 msgctxt "KCharSelect|" msgid "Japanese Kun Pronunciation: " msgstr "Pronuncia en xaponés Kun: " #. +> trunk5 #: kcharselect.cpp:896 msgctxt "KCharSelect|" msgid "Tang Pronunciation: " msgstr "Pronuncia Tang: " #. +> trunk5 #: kcharselect.cpp:903 msgctxt "KCharSelect|" msgid "Korean Pronunciation: " msgstr "Pronuncia coreana: " #. +> trunk5 #: kcharselect.cpp:909 msgctxt "KCharSelect|" msgid "General Character Properties" msgstr "Propiedades xerais do carácter" #. +> trunk5 #: kcharselect.cpp:910 msgctxt "KCharSelect|" msgid "Block: " msgstr "Bloque: " #. +> trunk5 #: kcharselect.cpp:911 msgctxt "KCharSelect|" msgid "Unicode category: " msgstr "Categoría unicode: " #. +> trunk5 #: kcharselect.cpp:915 msgctxt "KCharSelect|" msgid "Various Useful Representations" msgstr "Varias representacións útiles" #. +> trunk5 #: kcharselect.cpp:916 msgctxt "KCharSelect|" msgid "UTF-8:" msgstr "UTF-8:" #. +> trunk5 #: kcharselect.cpp:920 msgctxt "KCharSelect|" msgid "UTF-16: " msgstr "UTF-16: " #. +> trunk5 #: kcharselect.cpp:927 msgctxt "KCharSelect|" msgid "C octal escaped UTF-8: " msgstr "UTF-0 escapado en octal C: " #. +> trunk5 #: kcharselect.cpp:931 msgctxt "KCharSelect|" msgid "XML decimal entity:" msgstr "Entidade decimal XML:" #. +> trunk5 #: kcharselect.cpp:1078 msgctxt "KCharSelectItemModel|" msgid "Unicode code point:" msgstr "Código do punto unicode:" #. +> trunk5 #: kcharselect.cpp:1079 msgctxt "KCharSelectItemModel|Character" msgid "In decimal" msgstr "En decimal" #. +> trunk5 #: kcharselectdata.cpp:318 msgctxt "KCharSelectData|" msgid "" msgstr "" #. +> trunk5 #: kcharselectdata.cpp:339 msgctxt "KCharSelectData|" msgid "" msgstr "" #. +> trunk5 #: kcharselectdata.cpp:341 msgctxt "KCharSelectData|" msgid "" msgstr "" #. +> trunk5 #: kcharselectdata.cpp:343 msgctxt "KCharSelectData|" msgid "" msgstr "" #. +> trunk5 #: kcharselectdata.cpp:345 msgctxt "KCharSelectData|" msgid "" msgstr "" #. +> trunk5 #: kcharselectdata.cpp:377 msgctxt "KCharSelectData|" msgid "" msgstr "" #. +> trunk5 #: kcharselectdata.cpp:759 msgctxt "KCharSelectData|" msgid "Non-printable" msgstr "Non imprimíbel" #. +> trunk5 #: kcharselectdata.cpp:792 msgctxt "KCharSelectData|" msgid "Other, Control" msgstr "Outros, control" #. +> trunk5 #: kcharselectdata.cpp:793 msgctxt "KCharSelectData|" msgid "Other, Format" msgstr "Outros, formato" #. +> trunk5 #: kcharselectdata.cpp:794 msgctxt "KCharSelectData|" msgid "Other, Not Assigned" msgstr "Outros, non asignado" #. +> trunk5 #: kcharselectdata.cpp:795 msgctxt "KCharSelectData|" msgid "Other, Private Use" msgstr "Outros, uso privado" #. +> trunk5 #: kcharselectdata.cpp:796 msgctxt "KCharSelectData|" msgid "Other, Surrogate" msgstr "Outros, substitutos" #. +> trunk5 #: kcharselectdata.cpp:797 msgctxt "KCharSelectData|" msgid "Letter, Lowercase" msgstr "Carta, minúscula" #. +> trunk5 #: kcharselectdata.cpp:798 msgctxt "KCharSelectData|" msgid "Letter, Modifier" msgstr "Carta, modificador" #. +> trunk5 #: kcharselectdata.cpp:799 msgctxt "KCharSelectData|" msgid "Letter, Other" msgstr "Carta, outros" #. +> trunk5 #: kcharselectdata.cpp:800 msgctxt "KCharSelectData|" msgid "Letter, Titlecase" msgstr "Carta, títulos" #. +> trunk5 #: kcharselectdata.cpp:801 msgctxt "KCharSelectData|" msgid "Letter, Uppercase" msgstr "Carta, maiúsculas" #. +> trunk5 #: kcharselectdata.cpp:802 msgctxt "KCharSelectData|" msgid "Mark, Spacing Combining" msgstr "Sinal, espazo non separábel" #. +> trunk5 #: kcharselectdata.cpp:803 msgctxt "KCharSelectData|" msgid "Mark, Enclosing" msgstr "Sinal, anexando" #. +> trunk5 #: kcharselectdata.cpp:804 msgctxt "KCharSelectData|" msgid "Mark, Non-Spacing" msgstr "Sinal, non separación" #. +> trunk5 #: kcharselectdata.cpp:805 msgctxt "KCharSelectData|" msgid "Number, Decimal Digit" msgstr "Número, díxito decimal" #. +> trunk5 #: kcharselectdata.cpp:806 msgctxt "KCharSelectData|" msgid "Number, Letter" msgstr "Número, carta" #. +> trunk5 #: kcharselectdata.cpp:807 msgctxt "KCharSelectData|" msgid "Number, Other" msgstr "Número, outros" #. +> trunk5 #: kcharselectdata.cpp:808 msgctxt "KCharSelectData|" msgid "Punctuation, Connector" msgstr "Puntuación, conector" #. +> trunk5 #: kcharselectdata.cpp:809 msgctxt "KCharSelectData|" msgid "Punctuation, Dash" msgstr "Puntuación, trazo" #. +> trunk5 #: kcharselectdata.cpp:810 msgctxt "KCharSelectData|" msgid "Punctuation, Close" msgstr "Puntuación, pechar" #. +> trunk5 #: kcharselectdata.cpp:811 msgctxt "KCharSelectData|" msgid "Punctuation, Final Quote" msgstr "Puntuación, aspas finais" #. +> trunk5 #: kcharselectdata.cpp:812 msgctxt "KCharSelectData|" msgid "Punctuation, Initial Quote" msgstr "Puntuación, aspas iniciais" #. +> trunk5 #: kcharselectdata.cpp:813 msgctxt "KCharSelectData|" msgid "Punctuation, Other" msgstr "Puntuación, outro" #. +> trunk5 #: kcharselectdata.cpp:814 msgctxt "KCharSelectData|" msgid "Punctuation, Open" msgstr "Puntuación, abrir" #. +> trunk5 #: kcharselectdata.cpp:815 msgctxt "KCharSelectData|" msgid "Symbol, Currency" msgstr "Símbolo, divisa" #. +> trunk5 #: kcharselectdata.cpp:816 msgctxt "KCharSelectData|" msgid "Symbol, Modifier" msgstr "Símbolo, modificador" #. +> trunk5 #: kcharselectdata.cpp:817 msgctxt "KCharSelectData|" msgid "Symbol, Math" msgstr "Símbolo, matemático" #. +> trunk5 #: kcharselectdata.cpp:818 msgctxt "KCharSelectData|" msgid "Symbol, Other" msgstr "Símbolo, outro" #. +> trunk5 #: kcharselectdata.cpp:819 msgctxt "KCharSelectData|" msgid "Separator, Line" msgstr "Separador, liña" #. +> trunk5 #: kcharselectdata.cpp:820 msgctxt "KCharSelectData|" msgid "Separator, Paragraph" msgstr "Separador, parágrafo" #. +> trunk5 #: kcharselectdata.cpp:821 msgctxt "KCharSelectData|" msgid "Separator, Space" msgstr "Separador, espazo" #. +> trunk5 #: kcharselectdata.cpp:822 msgctxt "KCharSelectData|" msgid "Unknown" msgstr "Descoñecido" #. +> trunk5 #: kcolorcombo.cpp:341 msgctxt "KColorCombo|Custom color" msgid "Custom..." msgstr "Personalizado…" #. +> trunk5 #: kdatecombobox.cpp:171 msgctxt "KDateComboBox|@option next year" msgid "Next Year" msgstr "O ano vindeiro" #. +> trunk5 #: kdatecombobox.cpp:172 msgctxt "KDateComboBox|@option next month" msgid "Next Month" msgstr "O mes vindeiro" #. +> trunk5 #: kdatecombobox.cpp:173 msgctxt "KDateComboBox|@option next week" msgid "Next Week" msgstr "A vindeira semana" #. +> trunk5 #: kdatecombobox.cpp:174 msgctxt "KDateComboBox|@option tomorrow" msgid "Tomorrow" msgstr "Mañá" #. +> trunk5 #: kdatecombobox.cpp:175 msgctxt "KDateComboBox|@option today" msgid "Today" msgstr "Hoxe" #. +> trunk5 #: kdatecombobox.cpp:176 msgctxt "KDateComboBox|@option yesterday" msgid "Yesterday" msgstr "Onte" #. +> trunk5 #: kdatecombobox.cpp:177 msgctxt "KDateComboBox|@option last week" msgid "Last Week" msgstr "A semana pasada" #. +> trunk5 #: kdatecombobox.cpp:178 msgctxt "KDateComboBox|@option last month" msgid "Last Month" msgstr "O mes pasado" #. +> trunk5 #: kdatecombobox.cpp:179 msgctxt "KDateComboBox|@option last year" msgid "Last Year" msgstr "O ano pasado" #. +> trunk5 #: kdatecombobox.cpp:181 msgctxt "KDateComboBox|@option do not specify a date" msgid "No Date" msgstr "Sen data" #. +> trunk5 #: kdatecombobox.cpp:312 msgctxt "KDateComboBox|@info" msgid "The date you entered is invalid" msgstr "A data que inseriu é incorrecta" #. +> trunk5 #: kdatecombobox.cpp:315 #, qt-format msgctxt "KDateComboBox|@info" msgid "Date cannot be earlier than %1" msgstr "A data non pode ser anterior a %1" #. +> trunk5 #: kdatecombobox.cpp:322 #, qt-format msgctxt "KDateComboBox|@info" msgid "Date cannot be later than %1" msgstr "A data non pode ser posterior a %1" #. +> trunk5 #: kdatepicker.cpp:187 #, qt-format msgctxt "KDatePicker|" msgid "Week %1" msgstr "Semana %1" #. +> trunk5 #: kdatepicker.cpp:292 msgctxt "KDatePicker|" msgid "Next year" msgstr "O próximo ano" #. +> trunk5 #: kdatepicker.cpp:293 msgctxt "KDatePicker|" msgid "Previous year" msgstr "O ano anterior" #. +> trunk5 #: kdatepicker.cpp:294 msgctxt "KDatePicker|" msgid "Next month" msgstr "O mes que ven" #. +> trunk5 #: kdatepicker.cpp:295 msgctxt "KDatePicker|" msgid "Previous month" msgstr "O mes anterior" #. +> trunk5 #: kdatepicker.cpp:296 msgctxt "KDatePicker|" msgid "Select a week" msgstr "Escoller una semana" #. +> trunk5 #: kdatepicker.cpp:297 msgctxt "KDatePicker|" msgid "Select a month" msgstr "Escoller un mes" #. +> trunk5 #: kdatepicker.cpp:298 msgctxt "KDatePicker|" msgid "Select a year" msgstr "Escoller un ano" #. +> trunk5 #: kdatepicker.cpp:299 msgctxt "KDatePicker|" msgid "Select the current day" msgstr "Escolla o día de hoxe" #. +> trunk5 #: kdatepicker.cpp:638 msgctxt "KDatePicker|@action:button" msgid "Close" msgstr "Pechar" #. +> trunk5 #: kdatetimeedit.cpp:186 msgctxt "KDateTimeEdit|UTC time zone" msgid "UTC" msgstr "UTC" #. +> trunk5 #: kdatetimeedit.cpp:187 msgctxt "KDateTimeEdit|No specific time zone" msgid "Floating" msgstr "Flutuante" #. +> trunk5 #: kdatetimeedit.cpp:227 msgctxt "KDateTimeEdit|@info" msgid "The entered date and time is before the minimum allowed date and time." msgstr "A data e hora que inseriu é anterior á mínima permitida." #. +> trunk5 #: kdatetimeedit.cpp:237 msgctxt "KDateTimeEdit|@info" msgid "The entered date and time is after the maximum allowed date and time." msgstr "A data e hora que inseriu é posterior á máxima permitida." #. +> trunk5 #: keditlistwidget.cpp:305 msgctxt "KEditListWidget|" msgid "&Add" msgstr "Eng&adir" #. +> trunk5 #: keditlistwidget.cpp:317 msgctxt "KEditListWidget|" msgid "&Remove" msgstr "&Retirar" #. +> trunk5 #: keditlistwidget.cpp:329 msgctxt "KEditListWidget|" msgid "Move &Up" msgstr "&Subir" #. +> trunk5 #: keditlistwidget.cpp:334 msgctxt "KEditListWidget|" msgid "Move &Down" msgstr "&Baixar" #. +> trunk5 #: kfontchooser.cpp:160 msgctxt "KFontChooser|@info:whatsthis" msgid "Here you can choose the font to be used." msgstr "Aquí pode escoller a fonte para usar." #. +> trunk5 #: kfontchooser.cpp:182 msgctxt "KFontChooser|" msgid "Requested Font" msgstr "Fonte solicitada" #. +> trunk5 #: kfontchooser.cpp:199 msgctxt "KFontChooser|@option:check" msgid "Font" msgstr "Fonte" #. +> trunk5 #: kfontchooser.cpp:203 msgctxt "KFontChooser|@info:whatsthis" msgid "Enable this checkbox to change the font family settings." msgstr "" "Active esta caixa para marcar para cambiar a configuración da familia da" " fonte." #. +> trunk5 #: kfontchooser.cpp:204 msgctxt "KFontChooser|@info:tooltip" msgid "Change font family?" msgstr "Cambiar a familia da fonte?" #. +> trunk5 #: kfontchooser.cpp:208 msgctxt "KFontChooser|@label" msgid "Font:" msgstr "Fonte:" #. +> trunk5 #: kfontchooser.cpp:215 msgctxt "KFontChooser|@option:check" msgid "Font style" msgstr "Estilo da fonte" #. +> trunk5 #: kfontchooser.cpp:219 msgctxt "KFontChooser|@info:whatsthis" msgid "Enable this checkbox to change the font style settings." msgstr "" "Active esta caixa para marcar para cambiar a configuración do estilo da fonte." #. +> trunk5 #: kfontchooser.cpp:220 msgctxt "KFontChooser|@info:tooltip" msgid "Change font style?" msgstr "Cambiar o estilo da fonte?" #. +> trunk5 #: kfontchooser.cpp:224 msgctxt "KFontChooser|" msgid "Font style:" msgstr "Estilo da fonte:" #. +> trunk5 #: kfontchooser.cpp:232 msgctxt "KFontChooser|@option:check" msgid "Size" msgstr "Tamaño" #. +> trunk5 #: kfontchooser.cpp:236 msgctxt "KFontChooser|@info:whatsthis" msgid "Enable this checkbox to change the font size settings." msgstr "" "Active esta caixa para marcar para cambiar a configuración do tamaño das" " letras." #. +> trunk5 #: kfontchooser.cpp:237 msgctxt "KFontChooser|@info:tooltip" msgid "Change font size?" msgstr "Cambiar o tamaño dos tipos?" #. +> trunk5 #: kfontchooser.cpp:241 msgctxt "KFontChooser|@label:listbox Font size" msgid "Size:" msgstr "Tamaño:" #. +> trunk5 #: kfontchooser.cpp:257 msgctxt "KFontChooser|@info:whatsthis" msgid "Here you can choose the font family to be used." msgstr "Aquí pode escoller a familia de fonte que se vai usar." #. +> trunk5 #: kfontchooser.cpp:281 msgctxt "KFontChooser|@info:whatsthis" msgid "Here you can choose the font style to be used." msgstr "Aquí pode escoller o estilo das fontes para usar." #. +> trunk5 #: kfontchooser.cpp:289 msgctxt "KFontChooser|QFontDatabase" msgid "Normal" msgstr "Normal" #. +> trunk5 #: kfontchooser.cpp:290 kfontchooser.cpp:602 msgctxt "KFontChooser|@item font" msgid "Italic" msgstr "Cursiva" #. +> trunk5 #: kfontchooser.cpp:291 kfontchooser.cpp:603 msgctxt "KFontChooser|@item font" msgid "Oblique" msgstr "Oblicua" #. +> trunk5 #: kfontchooser.cpp:292 msgctxt "KFontChooser|@item font" msgid "Bold" msgstr "Grosa" #. +> trunk5 #: kfontchooser.cpp:293 msgctxt "KFontChooser|@item font" msgid "Bold Italic" msgstr "Letra grosa cursiva" #. +> trunk5 #: kfontchooser.cpp:312 msgctxt "KFontChooser|@item font size" msgid "Relative" msgstr "Relativo" #. +> trunk5 #: kfontchooser.cpp:314 msgctxt "KFontChooser|" msgid "" "Font size
" "fixed or relative
" "to environment" msgstr "" "Tamaño de tipo de letra
" "fixo ou relativo
" " ao ambiente" #. +> trunk5 #: kfontchooser.cpp:316 msgctxt "KFontChooser|" msgid "" "Here you can switch between fixed font size and font size to be calculated" " dynamically and adjusted to changing environment (e.g. widget dimensions," " paper size)." msgstr "" "Aquí pode cambiar entre o tamaño de fonte monoespazo ou calculado" " dinamicamente e axustado ao ambiente (p.ex. dimensións dos trebellos, tamaño" " do papel)." #. +> trunk5 #: kfontchooser.cpp:340 msgctxt "KFontChooser|" msgid "Here you can choose the font size to be used." msgstr "Aquí pode escoller o tamaño de tipo de letra que se vai empregar." #. +> trunk5 #: kfontchooser.cpp:378 msgctxt "KFontChooser|" msgid "The Quick Brown Fox Jumps Over The Lazy Dog" msgstr "Fíxate, o mesquiño bacharel pide vinganza" #. +> trunk5 #: kfontchooser.cpp:381 msgctxt "KFontChooser|" msgid "" "This sample text illustrates the current settings. You may edit it to test" " special characters." msgstr "" "Este texto de exemplo ilustra a configuración actual. Pode editalo para" " probar con caracteres especiais." #. +> trunk5 #: kfontchooser.cpp:587 #, qt-format msgctxt "KFontChooser|@item Font style" msgid "%1" msgstr "%1" #. +> trunk5 #: kfontrequester.cpp:219 msgctxt "KFontRequester|" msgid "Choose Font..." msgstr "Escoller a fonte…" #. +> trunk5 #: kfontrequester.cpp:225 msgctxt "KFontRequester|" msgid "Preview of the selected font" msgstr "Vista previa da fonte seleccionada" #. +> trunk5 #: kfontrequester.cpp:226 msgctxt "KFontRequester|" msgid "" "This is a preview of the selected font. You can change it by clicking the" " \"Choose Font...\" button." msgstr "" "Esta é unha vista previa da fonte seleccionada. Pode cambiala premendo o" " botón «Escoller a fonte…»." #. +> trunk5 #: kfontrequester.cpp:229 #, qt-format msgctxt "KFontRequester|" msgid "Preview of the \"%1\" font" msgstr "Vista previa da fonte «%1»" #. +> trunk5 #: kfontrequester.cpp:230 #, qt-format msgctxt "KFontRequester|" msgid "" "This is a preview of the \"%1\" font. You can change it by clicking the" " \"Choose Font...\" button." msgstr "" "Esta é unha vista previa da fonte «%1». Pode cambiala premendo o botón" " «Escoller a fonte…»." #. +> trunk5 #: kled.cpp:194 msgctxt "KLed|Accessible name of a Led whose state is on" msgid "LED on" msgstr "LED acendido" #. +> trunk5 #: kled.cpp:195 msgctxt "KLed|Accessible name of a Led whose state is off" msgid "LED off" msgstr "LED apagado" #. +> trunk5 #: kmessagebox.cpp:76 msgctxt "KMessageBox|@action:button post-filter" msgid "." msgstr "." #. +> trunk5 #: kmessagebox.cpp:315 msgctxt "KMessageBox|" msgid "Details" msgstr "Detalles" #. +> trunk5 #: kmessagebox.cpp:473 kmessagebox.cpp:527 msgctxt "KMessageBox|" msgid "Question" msgstr "Pregunta" #. +> trunk5 #: kmessagebox.cpp:485 kmessagebox.cpp:541 kmessagebox.cpp:612 #: kmessagebox.cpp:676 kmessagebox.cpp:759 msgctxt "KMessageBox|" msgid "Do not ask again" msgstr "Non preguntar máis." #. +> trunk5 #: kmessagebox.cpp:600 kmessagebox.cpp:664 kmessagebox.cpp:746 msgctxt "KMessageBox|" msgid "Warning" msgstr "Aviso" #. +> trunk5 #: kmessagebox.cpp:798 kmessagebox.cpp:819 msgctxt "KMessageBox|" msgid "Error" msgstr "Erro" #. +> trunk5 #: kmessagebox.cpp:846 kmessagebox.cpp:879 kmessagebox.cpp:1146 msgctxt "KMessageBox|" msgid "Sorry" msgstr "Desculpe" #. +> trunk5 #: kmessagebox.cpp:922 msgctxt "KMessageBox|" msgid "Information" msgstr "Información" #. +> trunk5 #: kmessagebox.cpp:933 msgctxt "KMessageBox|" msgid "Do not show this message again" msgstr "Non volver mostrar esta mensaxe." #. +> trunk5 #: kmessagewidget.cpp:95 msgctxt "KMessageWidget|" msgid "&Close" msgstr "&Pechar" #. +> trunk5 #: kmessagewidget.cpp:96 msgctxt "KMessageWidget|" msgid "Close message" msgstr "Pechar a mensaxe" #. +> trunk5 #: kmimetypechooser.cpp:86 msgctxt "KMimeTypeChooser|" msgid "Mime Type" msgstr "Tipo MIME" #. +> trunk5 #: kmimetypechooser.cpp:89 msgctxt "KMimeTypeChooser|" msgid "Comment" msgstr "Comentario" #. +> trunk5 #: kmimetypechooser.cpp:92 msgctxt "KMimeTypeChooser|" msgid "Patterns" msgstr "Padróns" #. +> trunk5 #: kmimetypechooser.cpp:105 msgctxt "KMimeTypeChooser|" msgid "&Edit..." msgstr "&Editar…" #. +> trunk5 #: kmimetypechooser.cpp:115 msgctxt "KMimeTypeChooser|" msgid "Click this button to display the familiar KDE mime type editor." msgstr "Prema este botón para mostrar o editor de KDE para os tipos MIME." #. +> trunk5 #: knewpassworddialog.cpp:69 #, qt-format msgctxt "KNewPasswordDialog|" msgid "Password must be at least %n character(s) long." msgid_plural "Password must be at least %n character(s) long." msgstr[0] "O contrasinal debe ter unha lonxitude de polo menos %n caracter." msgstr[1] "O contrasinal debe ter unha lonxitude de polo menos %n caracteres." #. +> trunk5 #: knewpassworddialog.cpp:73 msgctxt "KNewPasswordDialog|" msgid "Password is empty." msgstr "O contrasinal está baleiro." #. +> trunk5 #: knewpassworddialog.cpp:77 msgctxt "KNewPasswordDialog|" msgid "Passwords do not match." msgstr "Os contrasinais non coinciden." #. +> trunk5 #: knewpassworddialog.cpp:82 msgctxt "KNewPasswordDialog|" msgid "Passwords match." msgstr "Os contrasinais coinciden." #. +> trunk5 #: knewpassworddialog.cpp:154 msgctxt "KNewPasswordDialog|" msgid "Low Password Strength" msgstr "Contrasinal de pouca seguranza" #. +> trunk5 #: knewpassworddialog.cpp:155 msgctxt "KNewPasswordDialog|" msgid "" "The password you have entered has a low strength. To improve the strength of" " the password, try:\n" " - using a longer password;\n" " - using a mixture of upper- and lower-case letters;\n" " - using numbers or symbols as well as letters.\n" "\n" "Would you like to use this password anyway?" msgstr "" "O contrasinal que inseriu é feble. Para facelo máis resistente, probe a:\n" " - usar un contrasinal máis longo;\n" " - usar unha mestura de letras maiúsculas e minúsculas;\n" " - usar números ou símbolos, como #, ademais de letras.\n" "\n" "Desexa usar este contrasinal aínda así?" #. +> trunk5 #: knewpasswordwidget.cpp:64 msgctxt "KNewPasswordWidget|@info:whatsthis" msgid "" "The password strength meter gives an indication of the security of the" " password you have entered. To improve the strength of the password, try:" "
    " "
  • using a longer password;
    • " "
  • using a mixture of upper- and lower-case letters;
    • " "
  • using numbers or symbols, such as #, as well as letters.
    • " "
" msgstr "" "O medidor da resistencia do contrasinal dá unha indicación da seguranza do" " contrasinal que inseriu. Para mellorar a resistencia do contrasinal, intente:" "
    " "
  • usar un contrasinal máis longo;
    • " "
  • usar unha mestura de letras maiúsculas e minúsculas;
    • " "
  • usar números ou símbolos, como #, ademais de letras.
    • " "
" #. +> trunk5 #: knewpasswordwidget.ui:19 msgctxt "KNewPasswordWidget|" msgid "Password:" msgstr "Contrasinal:" #. +> trunk5 #: knewpasswordwidget.ui:29 msgctxt "KNewPasswordWidget|" msgid "&Verify:" msgstr "&Verificar:" #. +> trunk5 #: knewpasswordwidget.ui:54 msgctxt "KNewPasswordWidget|" msgid "Password strength &meter:" msgstr "&Medidor da seguranza do contrasinal:" #. +> trunk5 #: kpassworddialog.cpp:63 msgctxt "KPasswordDialog|" msgid "Password" msgstr "Contrasinal" #. +> trunk5 #: kpassworddialog.cpp:103 msgctxt "KPasswordDialog|" msgid "Supply a password below." msgstr "Indique en baixo o contrasinal." #. +> trunk5 #: kpassworddialog.ui:33 msgctxt "KPasswordDialog|" msgid "Supply a username and password below." msgstr "Indique en baixo un nome de usuario e o contrasinal." #. +> trunk5 #: kpassworddialog.ui:70 msgctxt "KPasswordDialog|" msgid "No password, use anonymous (or &guest) login" msgstr "Sen contrasinal, usar o acceso anónimo (ou &convidado)" #. +> trunk5 #: kpassworddialog.ui:77 msgctxt "KPasswordDialog|" msgid "Use this password:" msgstr "Usar este contrasinal:" #. +> trunk5 #: kpassworddialog.ui:102 msgctxt "KPasswordDialog|" msgid "Username:" msgstr "Nome de usuario:" #. +> trunk5 #: kpassworddialog.ui:116 msgctxt "KPasswordDialog|" msgid "Domain:" msgstr "Dominio:" #. +> trunk5 #: kpassworddialog.ui:130 msgctxt "KPasswordDialog|" msgid "Password:" msgstr "Contrasinal:" #. +> trunk5 #: kpassworddialog.ui:144 msgctxt "KPasswordDialog|" msgid "Remember password" msgstr "Lembrar o contrasinal" #. +> trunk5 #: kpasswordlineedit.cpp:56 msgctxt "QObject|" msgid "Change the visibility of the password" msgstr "Cambiar a visibilidade do contrasinal" #. +> trunk5 #: kpixmapregionselectordialog.cpp:72 msgctxt "KPixmapRegionSelectorDialog|" msgid "Select Region of Image" msgstr "Escolla unha rexión da imaxe" #. +> trunk5 #: kpixmapregionselectordialog.cpp:76 msgctxt "KPixmapRegionSelectorDialog|" msgid "Please click and drag on the image to select the region of interest:" msgstr "Prema e arrastre na imaxe para escoller a rexión de interese:" #. +> trunk5 #: kpixmapregionselectorwidget.cpp:192 msgctxt "KPixmapRegionSelectorWidget|" msgid "Image Operations" msgstr "Operacións coa imaxe" #. +> trunk5 #: kpixmapregionselectorwidget.cpp:194 msgctxt "KPixmapRegionSelectorWidget|" msgid "&Rotate Clockwise" msgstr "Rotar en sentido &horario" #. +> trunk5 #: kpixmapregionselectorwidget.cpp:196 msgctxt "KPixmapRegionSelectorWidget|" msgid "Rotate &Counterclockwise" msgstr "Rotar en sentido &antihorario" #. +> trunk5 #: ksqueezedtextlabel.cpp:216 msgctxt "KSqueezedTextLabel|" msgid "&Copy Full Text" msgstr "&Copiar todo o texto" #. +> trunk5 #: kstandardguiitem.cpp:108 msgctxt "KStandardGuiItem|" msgid "&OK" msgstr "&Aceptar" #. +> trunk5 #: kstandardguiitem.cpp:113 msgctxt "KStandardGuiItem|" msgid "&Cancel" msgstr "&Cancelar" #. +> trunk5 #: kstandardguiitem.cpp:118 msgctxt "KStandardGuiItem|" msgid "&Yes" msgstr "&Si" #. +> trunk5 #: kstandardguiitem.cpp:118 msgctxt "KStandardGuiItem|" msgid "Yes" msgstr "Si" #. +> trunk5 #: kstandardguiitem.cpp:123 msgctxt "KStandardGuiItem|" msgid "&No" msgstr "&Non" #. +> trunk5 #: kstandardguiitem.cpp:123 msgctxt "KStandardGuiItem|" msgid "No" msgstr "Non" #. +> trunk5 #: kstandardguiitem.cpp:128 msgctxt "KStandardGuiItem|" msgid "&Discard" msgstr "&Descartar" #. +> trunk5 #: kstandardguiitem.cpp:128 msgctxt "KStandardGuiItem|" msgid "Discard changes" msgstr "Descartar os cambios" #. +> trunk5 #: kstandardguiitem.cpp:129 msgctxt "KStandardGuiItem|" msgid "" "Pressing this button will discard all recent changes made in this dialog." msgstr "" "Se preme este botón descartará todos os cambios recentes feitos neste diálogo." #. +> trunk5 #: kstandardguiitem.cpp:135 msgctxt "KStandardGuiItem|" msgid "&Save" msgstr "&Gardar" #. +> trunk5 #: kstandardguiitem.cpp:135 msgctxt "KStandardGuiItem|" msgid "Save data" msgstr "Gardar os datos" #. +> trunk5 #: kstandardguiitem.cpp:140 msgctxt "KStandardGuiItem|" msgid "&Do Not Save" msgstr "&Non gardar" #. +> trunk5 #: kstandardguiitem.cpp:141 msgctxt "KStandardGuiItem|" msgid "Do not save data" msgstr "Non gardar os datos" #. +> trunk5 #: kstandardguiitem.cpp:146 msgctxt "KStandardGuiItem|" msgid "Save &As..." msgstr "Gardar &como…" #. +> trunk5 #: kstandardguiitem.cpp:147 msgctxt "KStandardGuiItem|" msgid "Save file with another name" msgstr "Gardar o ficheiro con outro nome" #. +> trunk5 #: kstandardguiitem.cpp:152 msgctxt "KStandardGuiItem|" msgid "&Apply" msgstr "&Aplicar" #. +> trunk5 #: kstandardguiitem.cpp:152 msgctxt "KStandardGuiItem|" msgid "Apply changes" msgstr "Aplicar os cambios" #. +> trunk5 #: kstandardguiitem.cpp:153 msgctxt "KStandardGuiItem|" msgid "" "When you click Apply, the settings will be handed over to the program," " but the dialog will not be closed.\n" "Use this to try different settings." msgstr "" "Cando prema Aplicar, as opcións han pasarse ao programa, pero non se" " pechará o diálogo.\n" "Use isto para probar distintas configuracións." #. +> trunk5 #: kstandardguiitem.cpp:161 msgctxt "KStandardGuiItem|" msgid "Administrator &Mode..." msgstr "&Modo de administrador…" #. +> trunk5 #: kstandardguiitem.cpp:161 msgctxt "KStandardGuiItem|" msgid "Enter Administrator Mode" msgstr "Entrar no modo de administrador" #. +> trunk5 #: kstandardguiitem.cpp:162 msgctxt "KStandardGuiItem|" msgid "" "When you click Administrator Mode you will be prompted for the" " administrator (root) password in order to make changes which require root" " privileges." msgstr "" "Cando prema o Modo de Administrador preguntaráselle o contrasinal de" " administrador (root) para ser quen de efectuar cambios que requiran" " privilexios de root." #. +> trunk5 #: kstandardguiitem.cpp:169 msgctxt "KStandardGuiItem|" msgid "C&lear" msgstr "&Limpar" #. +> trunk5 #: kstandardguiitem.cpp:170 msgctxt "KStandardGuiItem|" msgid "Clear input" msgstr "Limpar a entrada" #. +> trunk5 #: kstandardguiitem.cpp:171 msgctxt "KStandardGuiItem|" msgid "Clear the input in the edit field" msgstr "Limpar o texto no campo de edición" #. +> trunk5 #: kstandardguiitem.cpp:176 msgctxt "KStandardGuiItem|show help" msgid "&Help" msgstr "&Axuda" #. +> trunk5 #: kstandardguiitem.cpp:177 msgctxt "KStandardGuiItem|" msgid "Show help" msgstr "Mostrar axuda" #. +> trunk5 #: kstandardguiitem.cpp:182 msgctxt "KStandardGuiItem|" msgid "&Close" msgstr "&Pechar" #. +> trunk5 #: kstandardguiitem.cpp:183 msgctxt "KStandardGuiItem|" msgid "Close the current window or document" msgstr "Pechar a xanela ou documento actual" #. +> trunk5 #: kstandardguiitem.cpp:188 msgctxt "KStandardGuiItem|" msgid "&Close Window" msgstr "&Pechar a xanela" #. +> trunk5 #: kstandardguiitem.cpp:189 msgctxt "KStandardGuiItem|" msgid "Close the current window." msgstr "Pechar a xanela actual." #. +> trunk5 #: kstandardguiitem.cpp:194 msgctxt "KStandardGuiItem|" msgid "&Close Document" msgstr "Pechar o &documento" #. +> trunk5 #: kstandardguiitem.cpp:195 msgctxt "KStandardGuiItem|" msgid "Close the current document." msgstr "Pechar o documento actual." #. +> trunk5 #: kstandardguiitem.cpp:200 msgctxt "KStandardGuiItem|" msgid "&Defaults" msgstr "Valores &predeterminados" #. +> trunk5 #: kstandardguiitem.cpp:201 msgctxt "KStandardGuiItem|" msgid "Reset all items to their default values" msgstr "Restabelecer os valores predeterminados para todos os elementos" #. +> trunk5 #: kstandardguiitem.cpp:208 msgctxt "KStandardGuiItem|go back" msgid "&Back" msgstr "&Atrás" #. +> trunk5 #: kstandardguiitem.cpp:209 msgctxt "KStandardGuiItem|" msgid "Go back one step" msgstr "Retroceder un paso" #. +> trunk5 #: kstandardguiitem.cpp:216 msgctxt "KStandardGuiItem|go forward" msgid "&Forward" msgstr "A&diante" #. +> trunk5 #: kstandardguiitem.cpp:217 msgctxt "KStandardGuiItem|" msgid "Go forward one step" msgstr "Avanzar un paso" #. +> trunk5 #: kstandardguiitem.cpp:227 msgctxt "KStandardGuiItem|" msgid "&Print..." msgstr "Im&primir…" #. +> trunk5 #: kstandardguiitem.cpp:228 msgctxt "KStandardGuiItem|" msgid "Opens the print dialog to print the current document" msgstr "Abre o diálogo de impresión para imprimir o documento actual" #. +> trunk5 #: kstandardguiitem.cpp:234 msgctxt "KStandardGuiItem|" msgid "C&ontinue" msgstr "&Continuar" #. +> trunk5 #: kstandardguiitem.cpp:235 msgctxt "KStandardGuiItem|" msgid "Continue operation" msgstr "Continuar a operación" #. +> trunk5 #: kstandardguiitem.cpp:240 msgctxt "KStandardGuiItem|" msgid "&Delete" msgstr "Elimina&r" #. +> trunk5 #: kstandardguiitem.cpp:241 msgctxt "KStandardGuiItem|" msgid "Delete item(s)" msgstr "Eliminar os elementos" #. +> trunk5 #: kstandardguiitem.cpp:246 msgctxt "KStandardGuiItem|" msgid "&Open..." msgstr "&Abrir…" #. +> trunk5 #: kstandardguiitem.cpp:247 msgctxt "KStandardGuiItem|" msgid "Open file" msgstr "Abrir un ficheiro" #. +> trunk5 #: kstandardguiitem.cpp:252 msgctxt "KStandardGuiItem|" msgid "&Quit" msgstr "&Saír" #. +> trunk5 #: kstandardguiitem.cpp:253 msgctxt "KStandardGuiItem|" msgid "Quit application" msgstr "Saír da aplicación" #. +> trunk5 #: kstandardguiitem.cpp:258 msgctxt "KStandardGuiItem|" msgid "&Reset" msgstr "&Restaurar" #. +> trunk5 #: kstandardguiitem.cpp:259 msgctxt "KStandardGuiItem|" msgid "Reset configuration" msgstr "Restaurar a configuración cos valores iniciais" #. +> trunk5 #: kstandardguiitem.cpp:264 msgctxt "KStandardGuiItem|Verb" msgid "&Insert" msgstr "&Inserir" #. +> trunk5 #: kstandardguiitem.cpp:269 msgctxt "KStandardGuiItem|" msgid "Confi&gure..." msgstr "Confi&gurar…" #. +> trunk5 #: kstandardguiitem.cpp:274 msgctxt "KStandardGuiItem|" msgid "&Find" msgstr "&Atopar" #. +> trunk5 #: kstandardguiitem.cpp:279 msgctxt "KStandardGuiItem|" msgid "Stop" msgstr "Deter" #. +> trunk5 #: kstandardguiitem.cpp:284 msgctxt "KStandardGuiItem|" msgid "Add" msgstr "Engadir" #. +> trunk5 #: kstandardguiitem.cpp:289 msgctxt "KStandardGuiItem|" msgid "Remove" msgstr "Retirar" #. +> trunk5 #: kstandardguiitem.cpp:294 msgctxt "KStandardGuiItem|" msgid "Test" msgstr "Probar" #. +> trunk5 #: kstandardguiitem.cpp:299 msgctxt "KStandardGuiItem|" msgid "Properties" msgstr "Propiedades" #. +> trunk5 #: kstandardguiitem.cpp:304 msgctxt "KStandardGuiItem|" msgid "&Overwrite" msgstr "S&ubstituír" #. +> trunk5 #: ktimecombobox.cpp:266 msgctxt "KTimeComboBox|@info" msgid "The time you entered is invalid" msgstr "A hora que inseriu é incorrecta" #. +> trunk5 #: ktimecombobox.cpp:269 #, qt-format msgctxt "KTimeComboBox|@info" msgid "Time cannot be earlier than %1" msgstr "A hora non pode ser anterior a %1" #. +> trunk5 #: ktimecombobox.cpp:276 #, qt-format msgctxt "KTimeComboBox|@info" msgid "Time cannot be later than %1" msgstr "A hora non pode ser posterior a %1" #. +> trunk5 #: ktogglefullscreenaction.cpp:44 msgctxt "KToggleFullScreenAction|@action:inmenu" msgid "Exit F&ull Screen Mode" msgstr "Saír do modo a panta&lla completa" #. +> trunk5 #: ktogglefullscreenaction.cpp:45 msgctxt "KToggleFullScreenAction|@action:intoolbar" msgid "Exit Full Screen" msgstr "Saír da pantalla completa" #. +> trunk5 #: ktogglefullscreenaction.cpp:46 msgctxt "KToggleFullScreenAction|@info:tooltip" msgid "Exit full screen mode" msgstr "Saír do modo a pantalla completa" #. +> trunk5 #: ktogglefullscreenaction.cpp:49 msgctxt "KToggleFullScreenAction|@action:inmenu" msgid "F&ull Screen Mode" msgstr "Modo a pantalla &completa" #. +> trunk5 #: ktogglefullscreenaction.cpp:50 msgctxt "KToggleFullScreenAction|@action:intoolbar" msgid "Full Screen" msgstr "Pantalla completa" #. +> trunk5 #: ktogglefullscreenaction.cpp:51 msgctxt "KToggleFullScreenAction|@info:tooltip" msgid "Display the window in full screen" msgstr "Mostra a xanela a pantalla completa"